MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000349 -- main2 MTD ms_run[1]-location D:\JobRequest\ResultFiles\20200417\20200417151800575569^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\Data140714_Kuno5.pilotFin.txt MTD software[1] [MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767] MTD software[1]-setting FASTA=uniprot_mouse_20200318.fasta MTD software[1]-setting PARAGON_VERSION=5.0.0.0, 4767 MTD software[1]-setting UI_SAMPLE_TYPE=Identification MTD software[1]-setting UI_CYS_ALKYLATION=Iodoacetamide MTD software[1]-setting UI_DIGESTION=Trypsin + Lys C MTD software[1]-setting UI_INSTRUMENT=TripleTOF 5600 MTD software[1]-setting UI_SEARCH_EFFORT=Thorough MTD software[1]-setting UI_ID_FOCUS=Biological modifications MTD software[1]-setting UI_MIN_UNUSED_PROTSCORE=0.0458 MTD software[1]-setting MSTOLERANCE=0.05 MTD software[1]-setting MSTOLERANCE_U=Daltons MTD software[1]-setting MSMSTOLERANCE=0.1 MTD software[1]-setting MSMSTOLERANCE_U=Daltons MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.uniprot_mouse_20200318 MTD software[2]-setting CLE=[R]|{P},[K]|{} MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M) MTD software[2]-setting TOL(-)=10 MTD software[2]-setting TOL(+)=10 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=100 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=1 MTD software[3] [MS, MS:1002251, Comet, 2015.02 rev. 0] MTD software[3]-setting Taxon=userFasta.uniprot_mouse_20200318 MTD software[3]-setting search_enzyme_number=2 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Oxidation (M) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=1 MTD software[3]-setting peptide_mass_tolerance=10 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=1.0005 MTD software[3]-setting fragment_bin_offset=0.4 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[1]-site M MTD variable_mod[1]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT tr|Q91VB8|Q91VB8_MOUSE Isoform of P01942, GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hba-a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 58.0 null 0.27 58.0 17 3 0 PRT tr|A8DUK4|A8DUK4_MOUSE GLOBIN domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Hbb-bs PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 48.0 null 56-UNIMOD:35,94-UNIMOD:4,110-UNIMOD:35 0.97 48.0 64 15 2 PRT sp|P00329|ADH1_MOUSE Alcohol dehydrogenase 1 OS=Mus musculus (Mouse) OX=10090 GN=Adh1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 46.0 null 83-UNIMOD:4,171-UNIMOD:4,175-UNIMOD:4,196-UNIMOD:4,212-UNIMOD:4,241-UNIMOD:4,98-UNIMOD:4,101-UNIMOD:4,112-UNIMOD:4,137-UNIMOD:28,47-UNIMOD:4,119-UNIMOD:35,337-UNIMOD:35,41-UNIMOD:35 0.68 46.0 50 19 4 PRT sp|Q91Y97|ALDOB_MOUSE Fructose-bisphosphate aldolase B OS=Mus musculus (Mouse) OX=10090 GN=Aldob PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 45.0 null 158-UNIMOD:4,251-UNIMOD:35,240-UNIMOD:4,40-UNIMOD:35,233-UNIMOD:35,2-UNIMOD:1,329-UNIMOD:35 0.51 45.0 53 20 4 PRT sp|P17563|SBP1_MOUSE Methanethiol oxidase OS=Mus musculus (Mouse) OX=10090 GN=Selenbp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45.0 null 268-UNIMOD:4,244-UNIMOD:35,371-UNIMOD:4,80-UNIMOD:4,83-UNIMOD:4,31-UNIMOD:4,389-UNIMOD:35 0.64 45.0 55 26 8 PRT sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus (Mouse) OX=10090 GN=P4hb PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45.0 null 427-UNIMOD:35 0.51 45.0 31 22 16 PRT sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Sord PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 44.0 null 179-UNIMOD:4,140-UNIMOD:4,120-UNIMOD:4,130-UNIMOD:4,45-UNIMOD:4,301-UNIMOD:4,2-UNIMOD:1,195-UNIMOD:35,186-UNIMOD:35,165-UNIMOD:4 0.70 44.0 35 20 9 PRT sp|P19157|GSTP1_MOUSE Glutathione S-transferase P 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 44.0 null 90-UNIMOD:35,92-UNIMOD:35 0.49 44.0 43 12 3 PRT sp|O35490|BHMT1_MOUSE Betaine--homocysteine S-methyltransferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Bhmt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 44.0 null 131-UNIMOD:4,109-UNIMOD:28,217-UNIMOD:4,256-UNIMOD:4,186-UNIMOD:4,201-UNIMOD:4,299-UNIMOD:4,300-UNIMOD:4,71-UNIMOD:35,104-UNIMOD:4,185-UNIMOD:35,337-UNIMOD:35,383-UNIMOD:35,367-UNIMOD:35,259-UNIMOD:28,245-UNIMOD:35,143-UNIMOD:28,149-UNIMOD:35 0.81 44.0 104 30 5 PRT sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 44.0 null 249-UNIMOD:4,178-UNIMOD:35,708-UNIMOD:28,673-UNIMOD:35,459-UNIMOD:4,463-UNIMOD:4,464-UNIMOD:4,518-UNIMOD:385,518-UNIMOD:4,734-UNIMOD:35,663-UNIMOD:4 0.33 44.0 63 31 12 PRT sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadha PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44.0 null 443-UNIMOD:35 0.30 44.0 16 15 14 PRT tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gm10358 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44.0 null 150-UNIMOD:4,154-UNIMOD:4,326-UNIMOD:35,329-UNIMOD:35,131-UNIMOD:35,173-UNIMOD:35,128-UNIMOD:35 0.49 44.0 37 12 2 PRT sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43.0 null 364-UNIMOD:4,695-UNIMOD:4,154-UNIMOD:35,738-UNIMOD:35 0.14 43.0 27 11 3 PRT sp|Q61176|ARGI1_MOUSE Arginase-1 OS=Mus musculus (Mouse) OX=10090 GN=Arg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 276-UNIMOD:35,119-UNIMOD:4,168-UNIMOD:4,303-UNIMOD:4,212-UNIMOD:35 0.85 43.0 51 20 7 PRT sp|P54869|HMCS2_MOUSE Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hmgcs2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 283-UNIMOD:28,305-UNIMOD:4,96-UNIMOD:4,106-UNIMOD:4,363-UNIMOD:35,93-UNIMOD:35 0.50 43.0 31 19 9 PRT sp|Q64374|RGN_MOUSE Regucalcin OS=Mus musculus (Mouse) OX=10090 GN=Rgn PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 43.0 null 16-UNIMOD:385,16-UNIMOD:4,2-UNIMOD:1,8-UNIMOD:4,262-UNIMOD:4,65-UNIMOD:28,118-UNIMOD:35,207-UNIMOD:4,275-UNIMOD:28,258-UNIMOD:35 0.62 43.0 37 17 5 PRT sp|P52760|RIDA_MOUSE 2-iminobutanoate/2-iminopropanoate deaminase OS=Mus musculus (Mouse) OX=10090 GN=Rida PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 42.0 null 71-UNIMOD:4,86-UNIMOD:35 0.94 42.0 28 11 3 PRT sp|P35505|FAAA_MOUSE Fumarylacetoacetase OS=Mus musculus (Mouse) OX=10090 GN=Fah PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 408-UNIMOD:4,315-UNIMOD:4,396-UNIMOD:4,132-UNIMOD:28,308-UNIMOD:35,140-UNIMOD:35 0.45 42.0 28 14 5 PRT sp|P17182|ENOA_MOUSE Alpha-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 389-UNIMOD:4,119-UNIMOD:4,337-UNIMOD:4,339-UNIMOD:4 0.67 42.0 34 21 12 PRT sp|P01942|HBA_MOUSE Hemoglobin subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Hba PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 41.0 null 105-UNIMOD:4,33-UNIMOD:35 0.64 41.0 46 8 1 PRT sp|Q8C196|CPSM_MOUSE Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cps1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 516-UNIMOD:4,761-UNIMOD:4,600-UNIMOD:4,478-UNIMOD:28,542-UNIMOD:35,616-UNIMOD:35,570-UNIMOD:35,508-UNIMOD:35,920-UNIMOD:4,1076-UNIMOD:35,462-UNIMOD:35,1256-UNIMOD:4,816-UNIMOD:4,1283-UNIMOD:35,1015-UNIMOD:4,1027-UNIMOD:4,179-UNIMOD:35,585-UNIMOD:35,1327-UNIMOD:4,1337-UNIMOD:4,799-UNIMOD:35,225-UNIMOD:4,1209-UNIMOD:35,920-UNIMOD:385,815-UNIMOD:35,769-UNIMOD:35,198-UNIMOD:28,1049-UNIMOD:4,1052-UNIMOD:4,1327-UNIMOD:385,1178-UNIMOD:35 0.65 40.0 219 86 24 PRT sp|P60710|ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus (Mouse) OX=10090 GN=Actb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 2-UNIMOD:1,17-UNIMOD:4,217-UNIMOD:4,227-UNIMOD:35,305-UNIMOD:35,16-UNIMOD:35,47-UNIMOD:35,153-UNIMOD:35,325-UNIMOD:35,285-UNIMOD:4 0.69 40.0 53 20 6 PRT sp|Q03265|ATPA_MOUSE ATP synthase subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 433-UNIMOD:35,51-UNIMOD:35 0.45 40.0 30 21 14 PRT sp|P63260|ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus (Mouse) OX=10090 GN=Actg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 40.0 null 2-UNIMOD:1,17-UNIMOD:4,285-UNIMOD:385,285-UNIMOD:4 0.07 40.0 2 2 1 PRT sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp4a PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39.0 null 516-UNIMOD:35,624-UNIMOD:35 0.05 39.0 12 5 1 PRT sp|O08705|NTCP_MOUSE Sodium/bile acid cotransporter OS=Mus musculus (Mouse) OX=10090 GN=Slc10a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39.0 null 0.07 39.0 5 2 0 PRT sp|P16460|ASSY_MOUSE Argininosuccinate synthase OS=Mus musculus (Mouse) OX=10090 GN=Ass1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 132-UNIMOD:4,252-UNIMOD:35,181-UNIMOD:35,331-UNIMOD:4,186-UNIMOD:35,302-UNIMOD:35,166-UNIMOD:28,161-UNIMOD:35,97-UNIMOD:4,102-UNIMOD:28,147-UNIMOD:35 0.68 39.0 76 26 4 PRT sp|Q9QYG0|NDRG2_MOUSE Protein NDRG2 OS=Mus musculus (Mouse) OX=10090 GN=Ndrg2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 2-UNIMOD:1,88-UNIMOD:35,78-UNIMOD:4,255-UNIMOD:385,255-UNIMOD:4,274-UNIMOD:4 0.52 39.0 31 15 6 PRT sp|P35762|CD81_MOUSE CD81 antigen OS=Mus musculus (Mouse) OX=10090 GN=Cd81 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 156-UNIMOD:4,157-UNIMOD:4,125-UNIMOD:28 0.19 39.0 5 2 0 PRT sp|O09173|HGD_MOUSE Homogentisate 1,2-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Hgd PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 35-UNIMOD:4,51-UNIMOD:4,180-UNIMOD:4,120-UNIMOD:4,416-UNIMOD:4,418-UNIMOD:4,146-UNIMOD:4,338-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:4,138-UNIMOD:4,146-UNIMOD:385,377-UNIMOD:4 0.68 39.0 38 20 12 PRT sp|Q8R0Y6|AL1L1_MOUSE Cytosolic 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 686-UNIMOD:4,404-UNIMOD:4,587-UNIMOD:4,707-UNIMOD:4,152-UNIMOD:4,17-UNIMOD:4,238-UNIMOD:4,451-UNIMOD:4,810-UNIMOD:35,662-UNIMOD:4,762-UNIMOD:4 0.61 39.0 65 45 29 PRT sp|Q923D2|BLVRB_MOUSE Flavin reductase (NADPH) OS=Mus musculus (Mouse) OX=10090 GN=Blvrb PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39.0 null 0.21 39.0 3 2 1 PRT sp|P07724|ALBU_MOUSE Serum albumin OS=Mus musculus (Mouse) OX=10090 GN=Alb PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 39.0 null 313-UNIMOD:4,322-UNIMOD:35,340-UNIMOD:4,591-UNIMOD:4,269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,582-UNIMOD:4,583-UNIMOD:4,511-UNIMOD:4,77-UNIMOD:4,86-UNIMOD:4,538-UNIMOD:4,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4,289-UNIMOD:4,572-UNIMOD:35,500-UNIMOD:4,501-UNIMOD:4,288-UNIMOD:35,384-UNIMOD:385,99-UNIMOD:4,114-UNIMOD:4,115-UNIMOD:4,416-UNIMOD:4,302-UNIMOD:4,303-UNIMOD:4,550-UNIMOD:28,500-UNIMOD:385,58-UNIMOD:385,58-UNIMOD:4,201-UNIMOD:4,485-UNIMOD:4,461-UNIMOD:4,462-UNIMOD:4,472-UNIMOD:4 0.76 39.0 96 42 13 PRT sp|P18760|COF1_MOUSE Cofilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Cfl1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 2-UNIMOD:1,39-UNIMOD:4 0.42 38.0 10 7 4 PRT sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus (Mouse) OX=10090 GN=Dpp4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 295-UNIMOD:4,545-UNIMOD:4,438-UNIMOD:4,441-UNIMOD:4,448-UNIMOD:4,643-UNIMOD:4,388-UNIMOD:4,448-UNIMOD:385,497-UNIMOD:35,691-UNIMOD:28,379-UNIMOD:4,438-UNIMOD:385,643-UNIMOD:385,503-UNIMOD:35 0.39 38.0 53 26 12 PRT sp|Q9QXF8|GNMT_MOUSE Glycine N-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Gnmt PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38.0 null 186-UNIMOD:4,247-UNIMOD:4,216-UNIMOD:35,136-UNIMOD:4,147-UNIMOD:4,164-UNIMOD:35 0.52 38.0 24 9 3 PRT sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus (Mouse) OX=10090 GN=Eef1a1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 411-UNIMOD:4,234-UNIMOD:4,276-UNIMOD:35,111-UNIMOD:4,404-UNIMOD:35,155-UNIMOD:35,431-UNIMOD:28 0.52 38.0 46 21 12 PRT sp|P06151|LDHA_MOUSE L-lactate dehydrogenase A chain OS=Mus musculus (Mouse) OX=10090 GN=Ldha PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 38.0 null 185-UNIMOD:4,54-UNIMOD:35,233-UNIMOD:28,293-UNIMOD:4 0.51 38.0 25 13 6 PRT sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ephx2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38.0 null 78-UNIMOD:4,230-UNIMOD:4,489-UNIMOD:35,312-UNIMOD:4 0.39 38.0 20 14 10 PRT sp|P14152|MDHC_MOUSE Malate dehydrogenase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mdh1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 137-UNIMOD:4,90-UNIMOD:35,154-UNIMOD:4 0.39 37.0 24 11 3 PRT sp|O35114|SCRB2_MOUSE Lysosome membrane protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Scarb2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37.0 null 356-UNIMOD:35,274-UNIMOD:4 0.25 37.0 18 9 3 PRT sp|P08249|MDHM_MOUSE Malate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mdh2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 93-UNIMOD:4,89-UNIMOD:4,212-UNIMOD:4,285-UNIMOD:4,275-UNIMOD:4 0.62 37.0 29 16 8 PRT sp|A2BIM8|MUP18_MOUSE Major urinary protein 18 OS=Mus musculus (Mouse) OX=10090 GN=Mup18 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37.0 null 157-UNIMOD:4,121-UNIMOD:35,136-UNIMOD:35 0.68 37.0 32 13 4 PRT sp|Q91XD4|FTCD_MOUSE Formimidoyltransferase-cyclodeaminase OS=Mus musculus (Mouse) OX=10090 GN=Ftcd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 37.0 null 2-UNIMOD:1,7-UNIMOD:4,91-UNIMOD:4,286-UNIMOD:4,85-UNIMOD:35,104-UNIMOD:4,107-UNIMOD:4,33-UNIMOD:4 0.40 37.0 22 14 8 PRT sp|Q91VS7|MGST1_MOUSE Microsomal glutathione S-transferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Mgst1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 50-UNIMOD:4,28-UNIMOD:35 0.32 36.0 8 4 1 PRT sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Got2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 295-UNIMOD:4,272-UNIMOD:4,274-UNIMOD:4,106-UNIMOD:4,174-UNIMOD:35 0.44 36.0 29 17 7 PRT sp|P49429|HPPD_MOUSE 4-hydroxyphenylpyruvate dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Hpd PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 72-UNIMOD:4,103-UNIMOD:4,40-UNIMOD:35,238-UNIMOD:35,37-UNIMOD:4 0.58 36.0 33 18 6 PRT sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus (Mouse) OX=10090 GN=Hspa8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 17-UNIMOD:4,574-UNIMOD:385,574-UNIMOD:4,603-UNIMOD:4,61-UNIMOD:35,87-UNIMOD:35,549-UNIMOD:35 0.35 36.0 25 17 9 PRT sp|Q9QXZ6|SO1A1_MOUSE Solute carrier organic anion transporter family member 1A1 OS=Mus musculus (Mouse) OX=10090 GN=Slco1a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 651-UNIMOD:4,655-UNIMOD:4,439-UNIMOD:4,40-UNIMOD:35,1-UNIMOD:1,583-UNIMOD:385,583-UNIMOD:4,589-UNIMOD:4 0.24 36.0 21 16 12 PRT sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus (Mouse) OX=10090 GN=Abcb4 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 0.13 36.0 11 10 9 PRT sp|O08573|LEG9_MOUSE Galectin-9 OS=Mus musculus (Mouse) OX=10090 GN=Lgals9 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 73-UNIMOD:4,240-UNIMOD:35,258-UNIMOD:385,258-UNIMOD:4,101-UNIMOD:4,310-UNIMOD:4,314-UNIMOD:4,77-UNIMOD:28,138-UNIMOD:4,325-UNIMOD:4,96-UNIMOD:35 0.56 36.0 36 15 3 PRT sp|Q8K2B3|SDHA_MOUSE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sdha PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 0.10 36.0 4 4 4 PRT sp|P97429|ANXA4_MOUSE Annexin A4 OS=Mus musculus (Mouse) OX=10090 GN=Anxa4 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 108-UNIMOD:4 0.24 36.0 6 5 4 PRT sp|P63038|CH60_MOUSE 60 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspd1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36.0 null 442-UNIMOD:4 0.43 36.0 31 19 9 PRT sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus (Mouse) OX=10090 GN=Eef2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 728-UNIMOD:4,41-UNIMOD:4,591-UNIMOD:4,693-UNIMOD:4,466-UNIMOD:4,728-UNIMOD:385,369-UNIMOD:4 0.34 36.0 26 19 16 PRT sp|Q9JJL3|SO1B2_MOUSE Solute carrier organic anion transporter family member 1B2 OS=Mus musculus (Mouse) OX=10090 GN=Slco1b2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 501-UNIMOD:4,503-UNIMOD:4,469-UNIMOD:4,480-UNIMOD:4,484-UNIMOD:4,1-UNIMOD:1,1-UNIMOD:35,494-UNIMOD:35,603-UNIMOD:4,521-UNIMOD:4,568-UNIMOD:35,312-UNIMOD:28,677-UNIMOD:4 0.35 35.0 37 21 10 PRT sp|Q8BWT1|THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acaa2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35.0 null 92-UNIMOD:4,103-UNIMOD:4,107-UNIMOD:4,116-UNIMOD:4,122-UNIMOD:35,128-UNIMOD:4,203-UNIMOD:35,161-UNIMOD:35 0.73 35.0 36 22 14 PRT sp|P47738|ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35.0 null 210-UNIMOD:35,68-UNIMOD:4,388-UNIMOD:4 0.45 35.0 31 19 11 PRT sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc22a1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35.0 null 322-UNIMOD:4 0.13 35.0 9 6 4 PRT sp|Q07076|ANXA7_MOUSE Annexin A7 OS=Mus musculus (Mouse) OX=10090 GN=Anxa7 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35.0 null 338-UNIMOD:4,260-UNIMOD:4 0.19 35.0 8 7 6 PRT sp|P28474|ADHX_MOUSE Alcohol dehydrogenase class-3 OS=Mus musculus (Mouse) OX=10090 GN=Adh5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 195-UNIMOD:4,211-UNIMOD:4,240-UNIMOD:4,170-UNIMOD:4,174-UNIMOD:4,97-UNIMOD:4,100-UNIMOD:4,103-UNIMOD:4,2-UNIMOD:1 0.38 35.0 11 10 9 PRT sp|P17742|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus (Mouse) OX=10090 GN=Ppia PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 35.0 null 62-UNIMOD:4,115-UNIMOD:4,161-UNIMOD:4,61-UNIMOD:35 0.73 35.0 16 10 6 PRT sp|P50247|SAHH_MOUSE Adenosylhomocysteinase OS=Mus musculus (Mouse) OX=10090 GN=Ahcy PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 79-UNIMOD:4,195-UNIMOD:4,29-UNIMOD:35,278-UNIMOD:4,210-UNIMOD:35,33-UNIMOD:35,113-UNIMOD:4,127-UNIMOD:35,2-UNIMOD:1,228-UNIMOD:4 0.56 35.0 44 21 6 PRT sp|Q99LC5|ETFA_MOUSE Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Etfa PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35.0 null 53-UNIMOD:4,155-UNIMOD:4,68-UNIMOD:4 0.62 35.0 18 14 11 PRT sp|P0DP26|CALM1_MOUSE Calmodulin-1 OS=Mus musculus (Mouse) OX=10090 GN=Calm1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 35.0 null 2-UNIMOD:1 0.34 35.0 10 6 2 PRT tr|F7AEH4|F7AEH4_MOUSE Isoform of P63323, 40S ribosomal protein S12 OS=Mus musculus (Mouse) OX=10090 GN=Rps12 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 35.0 null 2-UNIMOD:1 0.17 35.0 1 1 1 PRT sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspa9 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 0.22 34.0 15 12 9 PRT sp|Q00623|APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus (Mouse) OX=10090 GN=Apoa1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 0.24 34.0 10 6 2 PRT sp|P04919|B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus (Mouse) OX=10090 GN=Slc4a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 759-UNIMOD:35,330-UNIMOD:4 0.16 34.0 23 11 3 PRT sp|P24549|AL1A1_MOUSE Retinal dehydrogenase 1 OS=Mus musculus (Mouse) OX=10090 GN=Aldh1a1 PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 126-UNIMOD:4,2-UNIMOD:1,186-UNIMOD:4,69-UNIMOD:28,133-UNIMOD:4 0.40 34.0 31 15 5 PRT sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus (Mouse) OX=10090 GN=Scp2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 365-UNIMOD:4,369-UNIMOD:4,495-UNIMOD:4,512-UNIMOD:35,533-UNIMOD:35 0.42 34.0 35 19 6 PRT sp|O70251|EF1B_MOUSE Elongation factor 1-beta OS=Mus musculus (Mouse) OX=10090 GN=Eef1b PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 0.13 34.0 3 2 1 PRT sp|Q9Z2V4|PCKGC_MOUSE Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Mus musculus (Mouse) OX=10090 GN=Pck1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 0.19 34.0 9 7 5 PRT sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstm1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 113-UNIMOD:35,115-UNIMOD:4,105-UNIMOD:35,109-UNIMOD:35,19-UNIMOD:35,35-UNIMOD:35,3-UNIMOD:35,123-UNIMOD:28 0.67 34.0 49 18 7 PRT sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acsl1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 133-UNIMOD:4,626-UNIMOD:4,242-UNIMOD:4,109-UNIMOD:4,298-UNIMOD:4,1-UNIMOD:1 0.32 34.0 24 18 14 PRT sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus (Mouse) OX=10090 GN=Cct7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 511-UNIMOD:4,364-UNIMOD:4,370-UNIMOD:4 0.17 34.0 9 8 7 PRT sp|P01887|B2MG_MOUSE Beta-2-microglobulin OS=Mus musculus (Mouse) OX=10090 GN=B2m PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34.0 null 100-UNIMOD:4,71-UNIMOD:35 0.51 34.0 9 5 2 PRT sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus (Mouse) OX=10090 GN=Myh9 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ] 33.0 null 789-UNIMOD:4,790-UNIMOD:4,917-UNIMOD:4 0.10 33.0 16 15 14 PRT sp|O35215|DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Ddt PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 33.0 null 24-UNIMOD:4,57-UNIMOD:4,2-UNIMOD:1 0.79 33.0 14 7 1 PRT tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE Isoform of P07759, Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 0.12 33.0 5 4 3 PRT sp|Q8BVI4|DHPR_MOUSE Dihydropteridine reductase OS=Mus musculus (Mouse) OX=10090 GN=Qdpr PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 158-UNIMOD:4 0.25 33.0 5 4 3 PRT sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsm1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 0.13 33.0 5 5 5 PRT sp|P12710|FABPL_MOUSE Fatty acid-binding protein, liver OS=Mus musculus (Mouse) OX=10090 GN=Fabp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 69-UNIMOD:4,19-UNIMOD:35,113-UNIMOD:35 0.87 33.0 24 11 4 PRT sp|Q63836|SBP2_MOUSE Selenium-binding protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Selenbp2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 424-UNIMOD:35,8-UNIMOD:4,186-UNIMOD:35 0.20 33.0 24 8 1 PRT sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus (Mouse) OX=10090 GN=Atp11c PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 197-UNIMOD:4,211-UNIMOD:4,424-UNIMOD:4,425-UNIMOD:4,779-UNIMOD:4,597-UNIMOD:4,562-UNIMOD:4,306-UNIMOD:4,467-UNIMOD:4,469-UNIMOD:4 0.34 33.0 54 32 16 PRT sp|Q9DCW4|ETFB_MOUSE Electron transfer flavoprotein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Etfb PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 42-UNIMOD:4,66-UNIMOD:4,71-UNIMOD:4,81-UNIMOD:35 0.58 33.0 19 11 5 PRT sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus (Mouse) OX=10090 GN=Dhrs4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 0.13 33.0 2 2 2 PRT sp|Q9QXD6|F16P1_MOUSE Fructose-1,6-bisphosphatase 1 OS=Mus musculus (Mouse) OX=10090 GN=Fbp1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 319-UNIMOD:35,282-UNIMOD:4,93-UNIMOD:4,2-UNIMOD:1 0.56 33.0 23 12 3 PRT sp|P42125|ECI1_MOUSE Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Eci1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 0.20 33.0 6 5 4 PRT sp|Q9DBJ1|PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgam1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 153-UNIMOD:4 0.30 33.0 6 5 4 PRT sp|O35945|AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus (Mouse) OX=10090 GN=Aldh1a7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 394-UNIMOD:35 0.27 33.0 20 12 8 PRT sp|P70694|DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus (Mouse) OX=10090 GN=Akr1c6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33.0 null 98-UNIMOD:4 0.51 33.0 20 14 9 PRT sp|Q64471|GSTT1_MOUSE Glutathione S-transferase theta-1 OS=Mus musculus (Mouse) OX=10090 GN=Gstt1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 33.0 null 14-UNIMOD:4 0.31 33.0 8 7 6 PRT sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus (Mouse) OX=10090 GN=Abcb11 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 33.0 null 475-UNIMOD:4,525-UNIMOD:35,1168-UNIMOD:4,584-UNIMOD:35,478-UNIMOD:35,842-UNIMOD:28 0.35 33.0 51 36 24 PRT sp|P08228|SODC_MOUSE Superoxide dismutase [Cu-Zn] OS=Mus musculus (Mouse) OX=10090 GN=Sod1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 147-UNIMOD:4,7-UNIMOD:4,58-UNIMOD:4 0.85 32.0 17 12 8 PRT sp|P10639|THIO_MOUSE Thioredoxin OS=Mus musculus (Mouse) OX=10090 GN=Txn PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 32-UNIMOD:4,35-UNIMOD:4 0.48 32.0 6 4 2 PRT sp|P15105|GLNA_MOUSE Glutamine synthetase OS=Mus musculus (Mouse) OX=10090 GN=Glul PE=1 SV=6 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 346-UNIMOD:4,359-UNIMOD:4,2-UNIMOD:1,209-UNIMOD:4,269-UNIMOD:4,183-UNIMOD:4,99-UNIMOD:4,198-UNIMOD:35,49-UNIMOD:4,29-UNIMOD:35,16-UNIMOD:35,269-UNIMOD:385 0.52 32.0 34 18 8 PRT sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.05 32.0 2 1 0 PRT sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Trap1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.02 32.0 3 1 0 PRT sp|Q9WVL0|MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gstz1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.38 32.0 10 6 2 PRT sp|P07356|ANXA2_MOUSE Annexin A2 OS=Mus musculus (Mouse) OX=10090 GN=Anxa2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 133-UNIMOD:4,2-UNIMOD:1,9-UNIMOD:4 0.36 32.0 13 9 5 PRT sp|Q91ZJ5|UGPA_MOUSE UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugp2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.28 32.0 13 11 9 PRT sp|P63101|1433Z_MOUSE 14-3-3 protein zeta/delta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaz PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 94-UNIMOD:4,1-UNIMOD:1 0.40 32.0 8 8 8 PRT sp|P16015|CAH3_MOUSE Carbonic anhydrase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ca3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 182-UNIMOD:4,187-UNIMOD:4,136-UNIMOD:28 0.62 32.0 26 13 3 PRT sp|Q99J08|S14L2_MOUSE SEC14-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Sec14l2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 355-UNIMOD:4,276-UNIMOD:28,155-UNIMOD:4 0.35 32.0 11 9 8 PRT sp|P09411|PGK1_MOUSE Phosphoglycerate kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgk1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32.0 null 99-UNIMOD:4,108-UNIMOD:4,367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4 0.42 32.0 14 12 10 PRT sp|Q91YI0|ARLY_MOUSE Argininosuccinate lyase OS=Mus musculus (Mouse) OX=10090 GN=Asl PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 368-UNIMOD:35,397-UNIMOD:35,21-UNIMOD:35,307-UNIMOD:4 0.57 31.0 38 23 10 PRT sp|Q64433|CH10_MOUSE 10 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspe1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 2-UNIMOD:1 0.78 31.0 15 8 5 PRT sp|Q9CQ62|DECR_MOUSE 2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Decr1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.21 31.0 7 5 3 PRT sp|Q64105|SPRE_MOUSE Sepiapterin reductase OS=Mus musculus (Mouse) OX=10090 GN=Spr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 160-UNIMOD:4 0.31 31.0 8 6 4 PRT sp|Q9JLF6|TGM1_MOUSE Protein-glutamine gamma-glutamyltransferase K OS=Mus musculus (Mouse) OX=10090 GN=Tgm1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 486-UNIMOD:35,118-UNIMOD:4 0.22 31.0 15 13 11 PRT sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadh PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 201-UNIMOD:4 0.24 31.0 9 6 3 PRT sp|Q91VI7|RINI_MOUSE Ribonuclease inhibitor OS=Mus musculus (Mouse) OX=10090 GN=Rnh1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.07 31.0 2 2 2 PRT sp|O08709|PRDX6_MOUSE Peroxiredoxin-6 OS=Mus musculus (Mouse) OX=10090 GN=Prdx6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 47-UNIMOD:4 0.64 31.0 16 13 10 PRT tr|Q6GT24|Q6GT24_MOUSE Isoform of O08709, Thioredoxin domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Prdx6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 31.0 null 0.10 31.0 2 1 0 PRT sp|Q02248|CTNB1_MOUSE Catenin beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Ctnnb1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 619-UNIMOD:4,466-UNIMOD:4,381-UNIMOD:4 0.20 31.0 16 12 8 PRT sp|Q8VC30|TKFC_MOUSE Triokinase/FMN cyclase OS=Mus musculus (Mouse) OX=10090 GN=Tkfc PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 382-UNIMOD:4,155-UNIMOD:4 0.28 31.0 16 13 11 PRT sp|Q9DBH5|LMAN2_MOUSE Vesicular integral-membrane protein VIP36 OS=Mus musculus (Mouse) OX=10090 GN=Lman2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.06 31.0 1 1 1 PRT sp|Q9DB29|IAH1_MOUSE Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Mus musculus (Mouse) OX=10090 GN=Iah1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 173-UNIMOD:4 0.11 31.0 2 2 2 PRT sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus (Mouse) OX=10090 GN=Ces2a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.18 31.0 6 6 6 PRT tr|B2RT14|B2RT14_MOUSE UDP-glucuronosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugt1a5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.04 31.0 1 1 1 PRT tr|Q91WT7|Q91WT7_MOUSE Aldo_ket_red domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Akr1c14 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 145-UNIMOD:4,217-UNIMOD:4 0.28 31.0 7 6 5 PRT sp|P51863|VA0D1_MOUSE V-type proton ATPase subunit d 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v0d1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 39-UNIMOD:4,335-UNIMOD:4 0.32 31.0 12 9 7 PRT sp|P21550|ENOB_MOUSE Beta-enolase OS=Mus musculus (Mouse) OX=10090 GN=Eno3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31.0 null 357-UNIMOD:4 0.04 31.0 1 1 1 PRT sp|P30115|GSTA3_MOUSE Glutathione S-transferase A3 OS=Mus musculus (Mouse) OX=10090 GN=Gsta3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 31.0 null 2-UNIMOD:1,212-UNIMOD:385,212-UNIMOD:4 0.45 31.0 25 12 5 PRT sp|P00342|LDHC_MOUSE L-lactate dehydrogenase C chain OS=Mus musculus (Mouse) OX=10090 GN=Ldhc PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 163-UNIMOD:4 0.07 30.0 3 2 1 PRT sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus (Mouse) OX=10090 GN=Gnb2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 204-UNIMOD:4,271-UNIMOD:4,25-UNIMOD:4,2-UNIMOD:1,263-UNIMOD:35 0.22 30.0 12 5 0 PRT sp|P26443|DHE3_MOUSE Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Glud1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 172-UNIMOD:4,376-UNIMOD:4,172-UNIMOD:385 0.39 30.0 29 18 8 PRT sp|Q61207|SAP_MOUSE Prosaposin OS=Mus musculus (Mouse) OX=10090 GN=Psap PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 94-UNIMOD:4,106-UNIMOD:4,63-UNIMOD:4,66-UNIMOD:4 0.09 30.0 6 4 2 PRT sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pc PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 131-UNIMOD:4 0.19 30.0 24 15 7 PRT sp|P35700|PRDX1_MOUSE Peroxiredoxin-1 OS=Mus musculus (Mouse) OX=10090 GN=Prdx1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 71-UNIMOD:4,83-UNIMOD:4,94-UNIMOD:28,21-UNIMOD:35,141-UNIMOD:28 0.66 30.0 45 16 4 PRT sp|P97807|FUMH_MOUSE Fumarate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Fh PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 161-UNIMOD:35 0.25 30.0 10 8 6 PRT sp|P62075|TIM13_MOUSE Mitochondrial import inner membrane translocase subunit Tim13 OS=Mus musculus (Mouse) OX=10090 GN=Timm13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 0.16 30.0 1 1 1 PRT sp|P40142|TKT_MOUSE Transketolase OS=Mus musculus (Mouse) OX=10090 GN=Tkt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 386-UNIMOD:4,133-UNIMOD:4 0.30 30.0 14 14 14 PRT sp|P97449|AMPN_MOUSE Aminopeptidase N OS=Mus musculus (Mouse) OX=10090 GN=Anpep PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 672-UNIMOD:35 0.19 30.0 16 15 14 PRT sp|Q61735|CD47_MOUSE Leukocyte surface antigen CD47 OS=Mus musculus (Mouse) OX=10090 GN=Cd47 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 0.10 30.0 2 2 2 PRT sp|Q9QZ85|IIGP1_MOUSE Interferon-inducible GTPase 1 OS=Mus musculus (Mouse) OX=10090 GN=Iigp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 0.12 30.0 4 4 4 PRT sp|P35492|HUTH_MOUSE Histidine ammonia-lyase OS=Mus musculus (Mouse) OX=10090 GN=Hal PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 17-UNIMOD:4 0.12 30.0 5 5 5 PRT sp|O35488|S27A2_MOUSE Very long-chain acyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Slc27a2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 427-UNIMOD:4 0.10 30.0 5 4 3 PRT sp|P11499|HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musculus (Mouse) OX=10090 GN=Hsp90ab1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 466-UNIMOD:35,412-UNIMOD:4 0.19 30.0 21 13 7 PRT sp|P26231|CTNA1_MOUSE Catenin alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Ctnna1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30.0 null 438-UNIMOD:4,461-UNIMOD:4,116-UNIMOD:4 0.18 30.0 13 11 9 PRT sp|P24270|CATA_MOUSE Catalase OS=Mus musculus (Mouse) OX=10090 GN=Cat PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 232-UNIMOD:4,425-UNIMOD:4,2-UNIMOD:1,377-UNIMOD:4,460-UNIMOD:4 0.45 29.0 32 20 14 PRT sp|P01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus (Mouse) OX=10090 GN=H2-K1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 122-UNIMOD:4,185-UNIMOD:4,142-UNIMOD:4 0.26 29.0 8 6 4 PRT sp|P09041|PGK2_MOUSE Phosphoglycerate kinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgk2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.13 29.0 5 4 3 PRT sp|P11725|OTC_MOUSE Ornithine carbamoyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Otc PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 246-UNIMOD:35,69-UNIMOD:28,288-UNIMOD:35,134-UNIMOD:35,303-UNIMOD:4 0.55 29.0 25 14 7 PRT sp|P16858|G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gapdh PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 245-UNIMOD:4 0.08 29.0 5 3 1 PRT sp|Q9JLJ2|AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh9a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 220-UNIMOD:4,267-UNIMOD:4,2-UNIMOD:1,45-UNIMOD:4,355-UNIMOD:4 0.31 29.0 14 10 6 PRT sp|Q99LB7|SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sardh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 382-UNIMOD:4,498-UNIMOD:4,236-UNIMOD:4,800-UNIMOD:4 0.23 29.0 16 13 10 PRT tr|Q6PDB7|Q6PDB7_MOUSE Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|P97328|KHK_MOUSE Ketohexokinase OS=Mus musculus (Mouse) OX=10090 GN=Khk PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 47-UNIMOD:4,282-UNIMOD:4 0.17 29.0 5 4 3 PRT sp|P07758|A1AT1_MOUSE Alpha-1-antitrypsin 1-1 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1a PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.32 29.0 15 12 9 PRT sp|Q02013|AQP1_MOUSE Aquaporin-1 OS=Mus musculus (Mouse) OX=10090 GN=Aqp1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.19 29.0 6 4 2 PRT tr|E9Q6L7|E9Q6L7_MOUSE Glutathione S-transferase OS=Mus musculus (Mouse) OX=10090 GN=Gm10639 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.11 29.0 6 2 1 PRT sp|P28230|CXB1_MOUSE Gap junction beta-1 protein OS=Mus musculus (Mouse) OX=10090 GN=Gjb1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 53-UNIMOD:4,60-UNIMOD:4,64-UNIMOD:4 0.26 29.0 8 4 2 PRT sp|Q8QZT1|THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acat1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 271-UNIMOD:27 0.30 29.0 10 8 6 PRT sp|Q61830|MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus (Mouse) OX=10090 GN=Mrc1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 617-UNIMOD:4,149-UNIMOD:4,316-UNIMOD:4,478-UNIMOD:4,486-UNIMOD:4,600-UNIMOD:4,391-UNIMOD:4,1189-UNIMOD:4 0.10 29.0 14 12 10 PRT sp|O70475|UGDH_MOUSE UDP-glucose 6-dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Ugdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 276-UNIMOD:4 0.24 29.0 13 9 5 PRT sp|P68372|TBB4B_MOUSE Tubulin beta-4B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb4b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 267-UNIMOD:35,239-UNIMOD:4,354-UNIMOD:4,73-UNIMOD:35 0.46 29.0 25 13 4 PRT tr|A0A2R8VHP3|A0A2R8VHP3_MOUSE IF rod domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm5478 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|P56480|ATPB_MOUSE ATP synthase subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 408-UNIMOD:35,113-UNIMOD:35,145-UNIMOD:35,443-UNIMOD:35 0.46 29.0 35 18 7 PRT sp|O88587|COMT_MOUSE Catechol O-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Comt PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 112-UNIMOD:4 0.36 29.0 8 8 8 PRT sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Abcc2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 735-UNIMOD:4,629-UNIMOD:4,1344-UNIMOD:4 0.18 29.0 28 21 14 PRT sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2e1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 268-UNIMOD:4 0.11 29.0 4 4 4 PRT sp|Q61171|PRDX2_MOUSE Peroxiredoxin-2 OS=Mus musculus (Mouse) OX=10090 GN=Prdx2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 2-UNIMOD:1,70-UNIMOD:4 0.58 29.0 13 10 7 PRT sp|P09055|ITB1_MOUSE Integrin beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Itgb1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 553-UNIMOD:4,555-UNIMOD:4,560-UNIMOD:4,691-UNIMOD:4,464-UNIMOD:385,464-UNIMOD:4,466-UNIMOD:4 0.20 29.0 13 11 9 PRT sp|Q8QZR5|ALAT1_MOUSE Alanine aminotransferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gpt PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 29-UNIMOD:4 0.19 29.0 7 7 7 PRT sp|Q8VEK0|CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus (Mouse) OX=10090 GN=Tmem30a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 91-UNIMOD:4,2-UNIMOD:1,3-UNIMOD:35 0.17 29.0 8 4 1 PRT sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Abcb6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.06 29.0 5 3 1 PRT sp|Q9CRB3|HIUH_MOUSE 5-hydroxyisourate hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Urah PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 29.0 null 2-UNIMOD:1,25-UNIMOD:4,52-UNIMOD:4 0.37 29.0 2 2 2 PRT sp|Q8BI08|MAL2_MOUSE Protein MAL2 OS=Mus musculus (Mouse) OX=10090 GN=Mal2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 29.0 null 2-UNIMOD:1 0.18 29.0 5 2 0 PRT sp|Q01768|NDKB_MOUSE Nucleoside diphosphate kinase B OS=Mus musculus (Mouse) OX=10090 GN=Nme2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.17 28.0 2 2 2 PRT sp|Q9D3D9|ATPD_MOUSE ATP synthase subunit delta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1d PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.15 28.0 2 2 2 PRT sp|Q923B6|STEA4_MOUSE Metalloreductase STEAP4 OS=Mus musculus (Mouse) OX=10090 GN=Steap4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 23-UNIMOD:4,41-UNIMOD:4 0.23 28.0 10 7 4 PRT sp|Q99MZ7|PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus (Mouse) OX=10090 GN=Pecr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.20 28.0 8 5 3 PRT sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus (Mouse) OX=10090 GN=Hsp90aa1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 98-UNIMOD:35 0.31 28.0 31 19 13 PRT sp|Q78JT3|3HAO_MOUSE 3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Haao PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 224-UNIMOD:28,245-UNIMOD:4 0.54 28.0 13 9 6 PRT sp|Q01279|EGFR_MOUSE Epidermal growth factor receptor OS=Mus musculus (Mouse) OX=10090 GN=Egfr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 506-UNIMOD:4,510-UNIMOD:4,515-UNIMOD:4,311-UNIMOD:4,248-UNIMOD:4,251-UNIMOD:4,539-UNIMOD:4,231-UNIMOD:4,232-UNIMOD:4,236-UNIMOD:4,240-UNIMOD:4,260-UNIMOD:4,215-UNIMOD:4,219-UNIMOD:4,362-UNIMOD:4,470-UNIMOD:4,539-UNIMOD:385,307-UNIMOD:4,777-UNIMOD:4 0.25 28.0 33 24 16 PRT sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus (Mouse) OX=10090 GN=Cyb5a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.48 28.0 12 6 4 PRT sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus (Mouse) OX=10090 GN=Hsp90b1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.10 28.0 10 8 6 PRT sp|P13707|GPDA_MOUSE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Gpd1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 329-UNIMOD:4,162-UNIMOD:4,168-UNIMOD:4,214-UNIMOD:4,7-UNIMOD:4,200-UNIMOD:4 0.52 28.0 19 14 9 PRT sp|Q91X83|METK1_MOUSE S-adenosylmethionine synthase isoform type-1 OS=Mus musculus (Mouse) OX=10090 GN=Mat1a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 35-UNIMOD:4,57-UNIMOD:4,61-UNIMOD:4 0.31 28.0 13 10 7 PRT sp|P06802|ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus (Mouse) OX=10090 GN=Enpp1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 146-UNIMOD:4,148-UNIMOD:4,152-UNIMOD:4 0.04 28.0 2 2 2 PRT sp|P17751|TPIS_MOUSE Triosephosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Tpi1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 177-UNIMOD:4,117-UNIMOD:4,268-UNIMOD:4 0.38 28.0 16 9 3 PRT sp|Q8C0Z1|F234A_MOUSE Protein FAM234A OS=Mus musculus (Mouse) OX=10090 GN=Fam234a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 353-UNIMOD:4 0.21 28.0 9 8 7 PRT sp|Q8CGC7|SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus (Mouse) OX=10090 GN=Eprs1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.04 28.0 4 4 4 PRT sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus (Mouse) OX=10090 GN=Rap1a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 139-UNIMOD:4,141-UNIMOD:4 0.29 28.0 5 4 3 PRT sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2d9 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.13 28.0 6 5 4 PRT sp|P49722|PSA2_MOUSE Proteasome subunit alpha type-2 OS=Mus musculus (Mouse) OX=10090 GN=Psma2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.15 28.0 2 2 2 PRT sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus (Mouse) OX=10090 GN=Ces1d PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 287-UNIMOD:28,284-UNIMOD:4,273-UNIMOD:4,116-UNIMOD:4 0.30 28.0 14 11 8 PRT sp|P62737|ACTA_MOUSE Actin, aortic smooth muscle OS=Mus musculus (Mouse) OX=10090 GN=Acta2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 84-UNIMOD:35 0.05 28.0 4 1 0 PRT sp|Q60931|VDAC3_MOUSE Voltage-dependent anion-selective channel protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Vdac3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.07 28.0 2 1 0 PRT sp|Q9JIL4|NHRF3_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus (Mouse) OX=10090 GN=Pdzk1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 455-UNIMOD:4,136-UNIMOD:4 0.48 27.0 26 20 14 PRT sp|P18572|BASI_MOUSE Basigin OS=Mus musculus (Mouse) OX=10090 GN=Bsg PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 203-UNIMOD:4 0.18 27.0 10 7 4 PRT sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acads PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.10 27.0 3 3 3 PRT sp|P34927|ASGR1_MOUSE Asialoglycoprotein receptor 1 OS=Mus musculus (Mouse) OX=10090 GN=Asgr1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 181-UNIMOD:4,204-UNIMOD:35,138-UNIMOD:4,140-UNIMOD:35,268-UNIMOD:4 0.33 27.0 17 8 2 PRT sp|Q9DBM2|ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus (Mouse) OX=10090 GN=Ehhadh PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 471-UNIMOD:4,17-UNIMOD:4,561-UNIMOD:4 0.30 27.0 18 16 14 PRT sp|Q9EQF5|DPYS_MOUSE Dihydropyrimidinase OS=Mus musculus (Mouse) OX=10090 GN=Dpys PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 242-UNIMOD:4 0.27 27.0 12 10 9 PRT sp|P09671|SODM_MOUSE Superoxide dismutase [Mn], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sod2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.17 27.0 5 3 1 PRT sp|Q8VC12|HUTU_MOUSE Urocanate hydratase OS=Mus musculus (Mouse) OX=10090 GN=Uroc1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 265-UNIMOD:4,95-UNIMOD:4 0.24 27.0 15 11 7 PRT sp|P14094|AT1B1_MOUSE Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Atp1b1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 214-UNIMOD:4,175-UNIMOD:4 0.24 27.0 13 7 3 PRT sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc2a2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.11 27.0 12 6 3 PRT sp|Q91Z53|GRHPR_MOUSE Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus (Mouse) OX=10090 GN=Grhpr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.25 27.0 8 7 6 PRT sp|P50580|PA2G4_MOUSE Proliferation-associated protein 2G4 OS=Mus musculus (Mouse) OX=10090 GN=Pa2g4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 49-UNIMOD:4 0.09 27.0 2 2 2 PRT sp|P11352|GPX1_MOUSE Glutathione peroxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Gpx1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 76-UNIMOD:4,154-UNIMOD:4 0.67 27.0 10 8 7 PRT sp|P14211|CALR_MOUSE Calreticulin OS=Mus musculus (Mouse) OX=10090 GN=Calr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 105-UNIMOD:4 0.27 27.0 13 10 8 PRT sp|G3X982|AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus (Mouse) OX=10090 GN=Aox3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 152-UNIMOD:4 0.19 27.0 21 16 11 PRT sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2c29 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 372-UNIMOD:4 0.19 27.0 11 6 3 PRT sp|O88844|IDHC_MOUSE Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Idh1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 269-UNIMOD:4,379-UNIMOD:4,363-UNIMOD:4 0.49 27.0 25 18 12 PRT sp|O35459|ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ech1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.16 27.0 4 3 2 PRT sp|P16406|AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Enpep PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.08 27.0 6 5 4 PRT sp|P68368|TBA4A_MOUSE Tubulin alpha-4A chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba4a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus (Mouse) OX=10090 GN=Ctsd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27.0 null 288-UNIMOD:4,117-UNIMOD:4,324-UNIMOD:35,327-UNIMOD:4 0.20 27.0 7 5 3 PRT sp|P16331|PH4H_MOUSE Phenylalanine-4-hydroxylase OS=Mus musculus (Mouse) OX=10090 GN=Pah PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 374-UNIMOD:4,445-UNIMOD:4,357-UNIMOD:4,2-UNIMOD:1 0.32 27.0 12 11 10 PRT sp|Q9JII6|AK1A1_MOUSE Aldo-keto reductase family 1 member A1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1a1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 27.0 null 2-UNIMOD:1,46-UNIMOD:4 0.45 27.0 12 11 10 PRT sp|Q9Z239|PLM_MOUSE Phospholemman OS=Mus musculus (Mouse) OX=10090 GN=Fxyd1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.14 26.0 3 1 0 PRT sp|P97300|NPTN_MOUSE Neuroplastin OS=Mus musculus (Mouse) OX=10090 GN=Nptn PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echs1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 225-UNIMOD:4 0.28 26.0 7 6 5 PRT sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Cct2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 2-UNIMOD:1,353-UNIMOD:35 0.22 26.0 8 8 8 PRT sp|P27600|GNA12_MOUSE Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus (Mouse) OX=10090 GN=Gna12 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 3 1 0 PRT sp|P70424|ERBB2_MOUSE Receptor tyrosine-protein kinase erbB-2 OS=Mus musculus (Mouse) OX=10090 GN=Erbb2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus (Mouse) OX=10090 GN=Hspa1l PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.09 26.0 7 5 3 PRT sp|P31786|ACBP_MOUSE Acyl-CoA-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Dbi PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 34-UNIMOD:28,2-UNIMOD:1 0.60 26.0 8 4 2 PRT sp|Q9CXN7|PBLD2_MOUSE Phenazine biosynthesis-like domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pbld2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 1-UNIMOD:35,24-UNIMOD:4 0.17 26.0 5 4 3 PRT sp|Q9DCU9|HOGA1_MOUSE 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hoga1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 251-UNIMOD:4 0.12 26.0 2 2 2 PRT sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus (Mouse) OX=10090 GN=Acaa1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 177-UNIMOD:4,381-UNIMOD:4,386-UNIMOD:28 0.31 26.0 10 8 6 PRT sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hspa2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.10 26.0 8 6 4 PRT sp|Q8BT60|CPNE3_MOUSE Copine-3 OS=Mus musculus (Mouse) OX=10090 GN=Cpne3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 202-UNIMOD:4,249-UNIMOD:4 0.11 26.0 5 4 3 PRT sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus (Mouse) OX=10090 GN=Slc38a3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 0.10 26.0 5 4 3 PRT sp|P52196|THTR_MOUSE Thiosulfate sulfurtransferase OS=Mus musculus (Mouse) OX=10090 GN=Tst PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 0.25 26.0 7 5 4 PRT sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lrp1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 3823-UNIMOD:4,3829-UNIMOD:4,2518-UNIMOD:4,3316-UNIMOD:4,3318-UNIMOD:4 0.03 26.0 10 10 10 PRT sp|Q61838|PZP_MOUSE Pregnancy zone protein OS=Mus musculus (Mouse) OX=10090 GN=Pzp PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.12 26.0 17 14 11 PRT sp|Q60932|VDAC1_MOUSE Voltage-dependent anion-selective channel protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Vdac1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 140-UNIMOD:4 0.22 26.0 4 4 4 PRT sp|P05213|TBA1B_MOUSE Tubulin alpha-1B chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 376-UNIMOD:4,295-UNIMOD:4,315-UNIMOD:4,316-UNIMOD:4,347-UNIMOD:4,313-UNIMOD:35,85-UNIMOD:28 0.38 26.0 24 11 4 PRT sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus (Mouse) OX=10090 GN=Sptb PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 1544-UNIMOD:4,529-UNIMOD:35 0.10 26.0 14 14 14 PRT sp|P07759|SPA3K_MOUSE Serine protease inhibitor A3K OS=Mus musculus (Mouse) OX=10090 GN=Serpina3k PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 260-UNIMOD:4 0.28 26.0 13 9 5 PRT sp|Q3T9X0|GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus (Mouse) OX=10090 GN=Slc2a9 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.04 26.0 4 2 1 PRT sp|P24369|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus (Mouse) OX=10090 GN=Ppib PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.20 26.0 4 3 2 PRT sp|P32883|RASK_MOUSE GTPase KRas OS=Mus musculus (Mouse) OX=10090 GN=Kras PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 80-UNIMOD:4 0.08 26.0 1 1 1 PRT sp|Q9EQ20|MMSA_MOUSE Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh6a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 249-UNIMOD:4,368-UNIMOD:4 0.26 26.0 12 10 9 PRT sp|Q61646|HPT_MOUSE Haptoglobin OS=Mus musculus (Mouse) OX=10090 GN=Hp PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 322-UNIMOD:4 0.16 26.0 5 4 3 PRT sp|P62259|1433E_MOUSE 14-3-3 protein epsilon OS=Mus musculus (Mouse) OX=10090 GN=Ywhae PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 97-UNIMOD:4,98-UNIMOD:4 0.30 26.0 9 7 5 PRT sp|Q8VCN5|CGL_MOUSE Cystathionine gamma-lyase OS=Mus musculus (Mouse) OX=10090 GN=Cth PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 171-UNIMOD:4,108-UNIMOD:4,251-UNIMOD:4,254-UNIMOD:4,255-UNIMOD:4 0.38 26.0 17 11 6 PRT sp|P06745|G6PI_MOUSE Glucose-6-phosphate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gpi PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.13 26.0 6 5 4 PRT sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus (Mouse) OX=10090 GN=Cdc42 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.09 26.0 1 1 1 PRT sp|Q9DAS9|GBG12_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Mus musculus (Mouse) OX=10090 GN=Gng12 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 54-UNIMOD:35,43-UNIMOD:4 0.79 25.0 7 5 3 PRT sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ces1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q9D0F3|LMAN1_MOUSE Protein ERGIC-53 OS=Mus musculus (Mouse) OX=10090 GN=Lman1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.11 25.0 3 3 3 PRT tr|K7N6K9|K7N6K9_MOUSE Sulfotransferase OS=Mus musculus (Mouse) OX=10090 GN=Sult2a5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|Q9CPY7|AMPL_MOUSE Cytosol aminopeptidase OS=Mus musculus (Mouse) OX=10090 GN=Lap3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 445-UNIMOD:4,376-UNIMOD:4,335-UNIMOD:4,313-UNIMOD:4 0.39 25.0 16 14 12 PRT tr|Q9JHF5|Q9JHF5_MOUSE V-type proton ATPase subunit a OS=Mus musculus (Mouse) OX=10090 GN=Tcirg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 318-UNIMOD:385,318-UNIMOD:4,325-UNIMOD:4 0.16 25.0 13 10 8 PRT sp|P20029|BIP_MOUSE Endoplasmic reticulum chaperone BiP OS=Mus musculus (Mouse) OX=10090 GN=Hspa5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.42 25.0 32 23 17 PRT sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Csad PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 313-UNIMOD:4,2-UNIMOD:1 0.21 25.0 9 8 7 PRT sp|Q9DCN2|NB5R3_MOUSE NADH-cytochrome b5 reductase 3 OS=Mus musculus (Mouse) OX=10090 GN=Cyb5r3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.21 25.0 5 5 5 PRT sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus (Mouse) OX=10090 GN=Fmo5 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 18-UNIMOD:4,468-UNIMOD:4,132-UNIMOD:4 0.21 25.0 11 7 3 PRT sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tpp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 344-UNIMOD:35,364-UNIMOD:4 0.12 25.0 4 4 4 PRT sp|Q9R013|CATF_MOUSE Cathepsin F OS=Mus musculus (Mouse) OX=10090 GN=Ctsf PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 311-UNIMOD:4,304-UNIMOD:4 0.11 25.0 3 3 3 PRT sp|Q9JMD3|STA10_MOUSE START domain-containing protein 10 OS=Mus musculus (Mouse) OX=10090 GN=Stard10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 181-UNIMOD:4 0.18 25.0 4 4 4 PRT sp|O55125|NIPS1_MOUSE Protein NipSnap homolog 1 OS=Mus musculus (Mouse) OX=10090 GN=Nipsnap1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 83-UNIMOD:4 0.17 25.0 6 4 3 PRT tr|Q8BGL3|Q8BGL3_MOUSE Sulfotransferase OS=Mus musculus (Mouse) OX=10090 GN=Sult2a8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 232-UNIMOD:4,96-UNIMOD:35 0.27 25.0 9 6 5 PRT sp|Q8VC28|AK1CD_MOUSE Aldo-keto reductase family 1 member C13 OS=Mus musculus (Mouse) OX=10090 GN=Akr1c13 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 39-UNIMOD:4 0.11 25.0 2 2 2 PRT tr|B2RT89|B2RT89_MOUSE MFS domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Slc22a28 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.09 25.0 6 5 4 PRT sp|P06801|MAOX_MOUSE NADP-dependent malic enzyme OS=Mus musculus (Mouse) OX=10090 GN=Me1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 47-UNIMOD:4 0.13 25.0 6 5 4 PRT tr|E9Q1Z0|E9Q1Z0_MOUSE IF rod domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Krt90 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.04 25.0 3 2 1 PRT sp|Q8BH00|AL8A1_MOUSE 2-aminomuconic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh8a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 354-UNIMOD:4,287-UNIMOD:4,289-UNIMOD:4 0.31 25.0 13 10 7 PRT sp|P14824|ANXA6_MOUSE Annexin A6 OS=Mus musculus (Mouse) OX=10090 GN=Anxa6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 358-UNIMOD:4,114-UNIMOD:4,114-UNIMOD:385 0.34 25.0 24 19 14 PRT sp|P25688|URIC_MOUSE Uricase OS=Mus musculus (Mouse) OX=10090 GN=Uox PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1,188-UNIMOD:4,195-UNIMOD:4,272-UNIMOD:35 0.40 25.0 18 10 5 PRT sp|O08749|DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dld PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.12 25.0 4 4 4 PRT sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Hspa1b PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.04 25.0 2 1 0 PRT sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2d26 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.05 25.0 2 2 2 PRT sp|P17717|UDB17_MOUSE UDP-glucuronosyltransferase 2B17 OS=Mus musculus (Mouse) OX=10090 GN=Ugt2b17 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.10 25.0 6 4 2 PRT sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ppt1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.16 25.0 3 3 3 PRT sp|P38060|HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hmgcl PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 141-UNIMOD:4 0.22 25.0 5 5 5 PRT sp|Q3V3R4|ITA1_MOUSE Integrin alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Itga1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 297-UNIMOD:4 0.06 25.0 8 6 4 PRT sp|Q8BXB6|SO2B1_MOUSE Solute carrier organic anion transporter family member 2B1 OS=Mus musculus (Mouse) OX=10090 GN=Slco2b1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 330-UNIMOD:28 0.07 25.0 6 4 2 PRT sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus (Mouse) OX=10090 GN=Glo1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 139-UNIMOD:4,36-UNIMOD:35 0.41 25.0 7 6 5 PRT sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus (Mouse) OX=10090 GN=Fasn PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 1222-UNIMOD:4,410-UNIMOD:28 0.15 25.0 27 26 25 PRT sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus (Mouse) OX=10090 GN=Abcc6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 0.13 25.0 20 12 6 PRT sp|P50544|ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadvl PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25.0 null 216-UNIMOD:4 0.26 25.0 10 10 10 PRT sp|P70441|NHRF1_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a3r1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 25.0 null 2-UNIMOD:1,201-UNIMOD:4 0.29 25.0 9 7 5 PRT sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein OS=Mus musculus (Mouse) OX=10090 GN=Plac8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1 0.14 25.0 1 1 1 PRT sp|Q9D0F9|PGM1_MOUSE Phosphoglucomutase-1 OS=Mus musculus (Mouse) OX=10090 GN=Pgm1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 160-UNIMOD:4 0.15 24.0 6 6 6 PRT sp|P40936|INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Inmt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 231-UNIMOD:4 0.21 24.0 5 4 3 PRT sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc16a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 392-UNIMOD:4,393-UNIMOD:4 0.10 24.0 4 3 2 PRT sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus (Mouse) OX=10090 GN=Ces3a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 59-UNIMOD:35,100-UNIMOD:4,434-UNIMOD:4 0.33 24.0 21 13 7 PRT tr|A6ZI47|A6ZI47_MOUSE Fructose-bisphosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Aldoart2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|P10630|IF4A2_MOUSE Eukaryotic initiation factor 4A-II OS=Mus musculus (Mouse) OX=10090 GN=Eif4a2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.10 24.0 4 3 2 PRT sp|P31649|S6A13_MOUSE Sodium- and chloride-dependent GABA transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc6a13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 569-UNIMOD:4 0.02 24.0 2 1 0 PRT sp|Q9DB05|SNAA_MOUSE Alpha-soluble NSF attachment protein OS=Mus musculus (Mouse) OX=10090 GN=Napa PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 42-UNIMOD:4 0.25 24.0 6 5 4 PRT sp|P53657|KPYR_MOUSE Pyruvate kinase PKLR OS=Mus musculus (Mouse) OX=10090 GN=Pklr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.26 24.0 12 10 8 PRT sp|Q921I1|TRFE_MOUSE Serotransferrin OS=Mus musculus (Mouse) OX=10090 GN=Tf PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 156-UNIMOD:4,692-UNIMOD:4,246-UNIMOD:4 0.20 24.0 15 11 7 PRT sp|Q3THS6|METK2_MOUSE S-adenosylmethionine synthase isoform type-2 OS=Mus musculus (Mouse) OX=10090 GN=Mat2a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.09 24.0 5 3 1 PRT sp|Q9R0P3|ESTD_MOUSE S-formylglutathione hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Esd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 176-UNIMOD:4,181-UNIMOD:4,45-UNIMOD:4,56-UNIMOD:4,206-UNIMOD:4 0.30 24.0 6 5 4 PRT sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.15 24.0 13 9 6 PRT sp|O08601|MTP_MOUSE Microsomal triglyceride transfer protein large subunit OS=Mus musculus (Mouse) OX=10090 GN=Mttp PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.09 24.0 8 6 4 PRT sp|E9PV24|FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus (Mouse) OX=10090 GN=Fga PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.06 24.0 5 4 3 PRT sp|Q91X91|NADC_MOUSE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mus musculus (Mouse) OX=10090 GN=Qprt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 111-UNIMOD:4,111-UNIMOD:385,202-UNIMOD:4 0.31 24.0 9 6 3 PRT sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus (Mouse) OX=10090 GN=Vcp PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 105-UNIMOD:4,535-UNIMOD:4,522-UNIMOD:4,2-UNIMOD:1 0.24 24.0 16 13 10 PRT tr|A0A0A6YW67|A0A0A6YW67_MOUSE Predicted pseudogene 8797 OS=Mus musculus (Mouse) OX=10090 GN=Gm8797 PE=4 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.47 24.0 5 3 2 PRT sp|O09044|SNP23_MOUSE Synaptosomal-associated protein 23 OS=Mus musculus (Mouse) OX=10090 GN=Snap23 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 1-UNIMOD:1 0.28 24.0 5 4 3 PRT sp|P01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus (Mouse) OX=10090 GN=H2-L PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 188-UNIMOD:4 0.11 24.0 4 3 2 PRT sp|Q9DBF1|AL7A1_MOUSE Alpha-aminoadipic semialdehyde dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh7a1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 70-UNIMOD:4,522-UNIMOD:4 0.24 24.0 12 10 8 PRT sp|P50431|GLYC_MOUSE Serine hydroxymethyltransferase, cytosolic OS=Mus musculus (Mouse) OX=10090 GN=Shmt1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 374-UNIMOD:4,378-UNIMOD:4,62-UNIMOD:4,329-UNIMOD:4 0.18 24.0 8 6 4 PRT tr|G3X9G9|G3X9G9_MOUSE Methyltransferase-like 7A3 OS=Mus musculus (Mouse) OX=10090 GN=Mettl7a3 PE=4 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 79-UNIMOD:4 0.07 24.0 1 1 1 PRT sp|P30999|CTND1_MOUSE Catenin delta-1 OS=Mus musculus (Mouse) OX=10090 GN=Ctnnd1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 533-UNIMOD:4,579-UNIMOD:4,581-UNIMOD:4 0.12 24.0 10 8 7 PRT sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus (Mouse) OX=10090 GN=Actn4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.15 24.0 11 10 9 PRT sp|Q8VCM7|FIBG_MOUSE Fibrinogen gamma chain OS=Mus musculus (Mouse) OX=10090 GN=Fgg PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 160-UNIMOD:4,164-UNIMOD:4 0.19 24.0 7 6 5 PRT sp|P11679|K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus (Mouse) OX=10090 GN=Krt8 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.27 24.0 15 10 5 PRT sp|Q9D379|HYEP_MOUSE Epoxide hydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ephx1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.10 24.0 3 3 3 PRT tr|Q5SQ27|Q5SQ27_MOUSE SEC14-like 3 (S. cerevisiae) OS=Mus musculus (Mouse) OX=10090 GN=Sec14l3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 302-UNIMOD:4 0.05 24.0 1 1 1 PRT sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus (Mouse) OX=10090 GN=Arf6 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.13 24.0 1 1 1 PRT sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus (Mouse) OX=10090 GN=Rab10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.10 24.0 2 2 2 PRT sp|Q00519|XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus (Mouse) OX=10090 GN=Xdh PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.08 24.0 6 6 6 PRT sp|Q9WTP6|KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ak2 PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 208-UNIMOD:4 0.22 24.0 3 3 3 PRT sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 91-UNIMOD:4,58-UNIMOD:4 0.19 24.0 5 3 2 PRT sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus (Mouse) OX=10090 GN=Rab1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.19 24.0 2 2 2 PRT sp|Q60759|GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gcdh PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 24.0 null 115-UNIMOD:4 0.20 24.0 7 5 3 PRT sp|P48036|ANXA5_MOUSE Annexin A5 OS=Mus musculus (Mouse) OX=10090 GN=Anxa5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.18 24.0 7 5 3 PRT sp|P61982|1433G_MOUSE 14-3-3 protein gamma OS=Mus musculus (Mouse) OX=10090 GN=Ywhag PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 24.0 null 97-UNIMOD:4,2-UNIMOD:1,112-UNIMOD:4 0.24 24.0 5 5 5 PRT sp|Q99L88|SNTB1_MOUSE Beta-1-syntrophin OS=Mus musculus (Mouse) OX=10090 GN=Sntb1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 24.0 null 2-UNIMOD:1 0.18 24.0 6 5 4 PRT sp|Q9R0P5|DEST_MOUSE Destrin OS=Mus musculus (Mouse) OX=10090 GN=Dstn PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 24.0 null 2-UNIMOD:1,12-UNIMOD:4 0.48 24.0 8 6 4 PRT sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus (Mouse) OX=10090 GN=Rab15 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.06 24.0 2 1 0 PRT sp|O70570|PIGR_MOUSE Polymeric immunoglobulin receptor OS=Mus musculus (Mouse) OX=10090 GN=Pigr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 257-UNIMOD:4,278-UNIMOD:4 0.07 23.0 4 4 4 PRT tr|D3Z5G7|D3Z5G7_MOUSE Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|O70435|PSA3_MOUSE Proteasome subunit alpha type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psma3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1 0.13 23.0 2 2 2 PRT sp|P00186|CP1A2_MOUSE Cytochrome P450 1A2 OS=Mus musculus (Mouse) OX=10090 GN=Cyp1a2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.09 23.0 3 3 3 PRT sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus (Mouse) OX=10090 GN=Rac3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 157-UNIMOD:4,6-UNIMOD:4 0.12 23.0 2 2 2 PRT sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hibadh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 0.19 23.0 4 4 4 PRT sp|Q8CHT0|AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh4a1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.08 23.0 6 4 2 PRT sp|P15532|NDKA_MOUSE Nucleoside diphosphate kinase A OS=Mus musculus (Mouse) OX=10090 GN=Nme1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 90-UNIMOD:35,109-UNIMOD:4 0.49 23.0 12 7 4 PRT sp|P59999|ARPC4_MOUSE Actin-related protein 2/3 complex subunit 4 OS=Mus musculus (Mouse) OX=10090 GN=Arpc4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.14 23.0 2 2 2 PRT sp|O35604|NPC1_MOUSE NPC intracellular cholesterol transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Npc1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 5 3 1 PRT sp|Q9Z2U1|PSA5_MOUSE Proteasome subunit alpha type-5 OS=Mus musculus (Mouse) OX=10090 GN=Psma5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.14 23.0 3 2 1 PRT sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc29a1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ] 23.0 null 0.07 23.0 6 3 2 PRT sp|Q9D819|IPYR_MOUSE Inorganic pyrophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Ppa1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 242-UNIMOD:4 0.20 23.0 5 4 3 PRT sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus (Mouse) OX=10090 GN=Cryz PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 166-UNIMOD:4 0.14 23.0 2 2 2 PRT sp|Q8VBW8|TTC36_MOUSE Tetratricopeptide repeat protein 36 OS=Mus musculus (Mouse) OX=10090 GN=Ttc36 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.33 23.0 7 5 3 PRT sp|P17047|LAMP2_MOUSE Lysosome-associated membrane glycoprotein 2 OS=Mus musculus (Mouse) OX=10090 GN=Lamp2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.09 23.0 5 4 3 PRT sp|Q9D1L9|LTOR5_MOUSE Ragulator complex protein LAMTOR5 OS=Mus musculus (Mouse) OX=10090 GN=Lamtor5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.23 23.0 3 1 0 PRT sp|P15116|CADH2_MOUSE Cadherin-2 OS=Mus musculus (Mouse) OX=10090 GN=Cdh2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus (Mouse) OX=10090 GN=Pdia3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 85-UNIMOD:4,92-UNIMOD:4 0.33 23.0 17 13 9 PRT sp|Q61598|GDIB_MOUSE Rab GDP dissociation inhibitor beta OS=Mus musculus (Mouse) OX=10090 GN=Gdi2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.12 23.0 4 4 4 PRT tr|A2BIN1|A2BIN1_MOUSE Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup10 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.07 23.0 2 1 0 PRT tr|E9Q0F0|E9Q0F0_MOUSE IF rod domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Krt78 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 3 2 1 PRT sp|Q93092|TALDO_MOUSE Transaldolase OS=Mus musculus (Mouse) OX=10090 GN=Taldo1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 250-UNIMOD:4 0.04 23.0 1 1 1 PRT sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus (Mouse) OX=10090 GN=Pdia6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.13 23.0 4 4 4 PRT sp|P28798|GRN_MOUSE Progranulin OS=Mus musculus (Mouse) OX=10090 GN=Grn PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 539-UNIMOD:4,540-UNIMOD:4,304-UNIMOD:4,305-UNIMOD:4,214-UNIMOD:4,220-UNIMOD:4,221-UNIMOD:4,554-UNIMOD:4,555-UNIMOD:4,561-UNIMOD:4,282-UNIMOD:4,288-UNIMOD:4,294-UNIMOD:4,295-UNIMOD:4 0.12 23.0 7 5 3 PRT sp|P47740|AL3A2_MOUSE Aldehyde dehydrogenase family 3 member A2 OS=Mus musculus (Mouse) OX=10090 GN=Aldh3a2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 1 1 1 PRT tr|Q80X68|Q80X68_MOUSE Citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Csl PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|P01027|CO3_MOUSE Complement C3 OS=Mus musculus (Mouse) OX=10090 GN=C3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 816-UNIMOD:4,1489-UNIMOD:4,1158-UNIMOD:4 0.08 23.0 10 10 10 PRT sp|P08752|GNAI2_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Gnai2 PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.15 23.0 4 3 2 PRT sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus (Mouse) OX=10090 GN=Ank1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 1066-UNIMOD:4 0.06 23.0 9 8 7 PRT sp|Q7TMS5|ABCG2_MOUSE Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Mus musculus (Mouse) OX=10090 GN=Abcg2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.12 23.0 9 7 5 PRT sp|Q91V76|CK054_MOUSE Ester hydrolase C11orf54 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1918234 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 249-UNIMOD:4,187-UNIMOD:4 0.17 23.0 4 4 4 PRT sp|Q9R0H0|ACOX1_MOUSE Peroxisomal acyl-coenzyme A oxidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Acox1 PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 392-UNIMOD:4 0.25 23.0 13 11 9 PRT sp|P46735|MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus (Mouse) OX=10090 GN=Myo1b PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 2 2 2 PRT tr|Q80X81|Q80X81_MOUSE Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus (Mouse) OX=10090 GN=Acat3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 65-UNIMOD:4 0.24 23.0 11 8 5 PRT sp|P26039|TLN1_MOUSE Talin-1 OS=Mus musculus (Mouse) OX=10090 GN=Tln1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 3 3 3 PRT sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus (Mouse) OX=10090 GN=Gnb4 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 148-UNIMOD:4,149-UNIMOD:4 0.11 23.0 6 3 1 PRT sp|P62874|GBB1_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Gnb1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 23.0 null 2-UNIMOD:1,25-UNIMOD:4,204-UNIMOD:4 0.20 23.0 8 6 4 PRT tr|A0A1Y7VJZ2|A0A1Y7VJZ2_MOUSE Isoform of Q9WVL0, Maleylacetoacetate isomerase OS=Mus musculus (Mouse) OX=10090 GN=Gstz1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1 0.06 23.0 1 1 1 PRT sp|P62962|PROF1_MOUSE Profilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Pfn1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.44 23.0 4 4 4 PRT sp|Q9CZM2|RL15_MOUSE 60S ribosomal protein L15 OS=Mus musculus (Mouse) OX=10090 GN=Rpl15 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.07 23.0 1 1 1 PRT sp|Q8BFR5|EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Tufm PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.11 22.0 3 3 3 PRT sp|P08226|APOE_MOUSE Apolipoprotein E OS=Mus musculus (Mouse) OX=10090 GN=Apoe PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.25 22.0 10 7 4 PRT sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Uqcrc2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|P48771|CX7A2_MOUSE Cytochrome c oxidase subunit 7A2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cox7a2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.13 22.0 1 1 1 PRT sp|O88792|JAM1_MOUSE Junctional adhesion molecule A OS=Mus musculus (Mouse) OX=10090 GN=F11r PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 49-UNIMOD:4,152-UNIMOD:4 0.11 22.0 3 2 1 PRT sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Hint1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.12 22.0 2 1 0 PRT sp|Q8K009|AL1L2_MOUSE Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aldh1l2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 728-UNIMOD:4 0.05 22.0 7 5 3 PRT sp|Q922D8|C1TC_MOUSE C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Mthfd1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 863-UNIMOD:4,785-UNIMOD:4 0.25 22.0 22 18 14 PRT sp|P54116|STOM_MOUSE Erythrocyte band 7 integral membrane protein OS=Mus musculus (Mouse) OX=10090 GN=Stom PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 87-UNIMOD:4,228-UNIMOD:35 0.28 22.0 8 5 2 PRT sp|Q9CZN7|GLYM_MOUSE Serine hydroxymethyltransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Shmt2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 91-UNIMOD:4,80-UNIMOD:4 0.08 22.0 3 3 3 PRT tr|Q8R084|Q8R084_MOUSE UDP-glucuronosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugt2b1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 128-UNIMOD:4 0.13 22.0 7 5 3 PRT tr|A0A0R4J135|A0A0R4J135_MOUSE Isoform of Q63836, Selenium-binding protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Selenbp2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ] 22.0 null 8-UNIMOD:385,8-UNIMOD:4,334-UNIMOD:28,100-UNIMOD:35,412-UNIMOD:28 0.13 22.0 7 5 0 PRT sp|A2AQ07|TBB1_MOUSE Tubulin beta-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 2 1 0 PRT sp|Q9JM62|REEP6_MOUSE Receptor expression-enhancing protein 6 OS=Mus musculus (Mouse) OX=10090 GN=Reep6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.07 22.0 2 1 0 PRT sp|Q9CR57|RL14_MOUSE 60S ribosomal protein L14 OS=Mus musculus (Mouse) OX=10090 GN=Rpl14 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.12 22.0 3 2 1 PRT sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus (Mouse) OX=10090 GN=Cct8 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 244-UNIMOD:4,187-UNIMOD:4 0.20 22.0 9 7 5 PRT sp|P13597|ICAM1_MOUSE Intercellular adhesion molecule 1 OS=Mus musculus (Mouse) OX=10090 GN=Icam1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 239-UNIMOD:4,374-UNIMOD:4 0.10 22.0 4 4 4 PRT tr|Q5I0W6|Q5I0W6_MOUSE Methyltransf_11 domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mettl7a2 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.07 22.0 1 1 1 PRT sp|P14206|RSSA_MOUSE 40S ribosomal protein SA OS=Mus musculus (Mouse) OX=10090 GN=Rpsa PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 148-UNIMOD:4 0.23 22.0 8 4 1 PRT sp|Q8VBT2|SDHL_MOUSE L-serine dehydratase/L-threonine deaminase OS=Mus musculus (Mouse) OX=10090 GN=Sds PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 270-UNIMOD:4,2-UNIMOD:1 0.13 22.0 3 3 3 PRT sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2c50 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 372-UNIMOD:4 0.07 22.0 2 2 2 PRT sp|P52430|PON1_MOUSE Serum paraoxonase/arylesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pon1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 42-UNIMOD:4 0.09 22.0 2 2 2 PRT sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.14 22.0 4 3 2 PRT sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus (Mouse) OX=10090 GN=Rdh7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 256-UNIMOD:4,266-UNIMOD:4,274-UNIMOD:4,171-UNIMOD:4,176-UNIMOD:4 0.29 22.0 8 7 6 PRT tr|E9QPD7|E9QPD7_MOUSE Isoform of Q05920, Pyruvate carboxylase OS=Mus musculus (Mouse) OX=10090 GN=Pcx PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P19639|GSTM3_MOUSE Glutathione S-transferase Mu 3 OS=Mus musculus (Mouse) OX=10090 GN=Gstm3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.09 22.0 1 1 1 PRT sp|P99029|PRDX5_MOUSE Peroxiredoxin-5, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Prdx5 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 200-UNIMOD:4,96-UNIMOD:4 0.54 22.0 11 10 9 PRT sp|P11438|LAMP1_MOUSE Lysosome-associated membrane glycoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lamp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 22.0 null 327-UNIMOD:385,327-UNIMOD:4,133-UNIMOD:35 0.13 22.0 10 4 0 PRT sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aifm1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.06 22.0 2 2 2 PRT sp|Q80SZ7|GBG5_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Mus musculus (Mouse) OX=10090 GN=Gng5 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 2-UNIMOD:1 0.32 21.0 2 2 2 PRT sp|P10648|GSTA2_MOUSE Glutathione S-transferase A2 OS=Mus musculus (Mouse) OX=10090 GN=Gsta2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.05 21.0 3 1 0 PRT sp|O70404|VAMP8_MOUSE Vesicle-associated membrane protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Vamp8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.15 21.0 1 1 1 PRT sp|Q8CG76|ARK72_MOUSE Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus (Mouse) OX=10090 GN=Akr7a2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.08 21.0 2 2 2 PRT sp|Q9DCG6|PBLD1_MOUSE Phenazine biosynthesis-like domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pbld1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.09 21.0 2 2 2 PRT sp|O35682|MYADM_MOUSE Myeloid-associated differentiation marker OS=Mus musculus (Mouse) OX=10090 GN=Myadm PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.06 21.0 1 1 1 PRT sp|Q8VCW8|ACSF2_MOUSE Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acsf2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 503-UNIMOD:4 0.20 21.0 11 9 7 PRT sp|Q9CXF0|KYNU_MOUSE Kynureninase OS=Mus musculus (Mouse) OX=10090 GN=Kynu PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 22-UNIMOD:4,401-UNIMOD:4 0.06 21.0 2 2 2 PRT sp|P04104|K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus (Mouse) OX=10090 GN=Krt1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.06 21.0 3 3 3 PRT sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus (Mouse) OX=10090 GN=Eef1g PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.09 21.0 8 3 0 PRT sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus (Mouse) OX=10090 GN=Myh11 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 4 4 4 PRT sp|Q60605|MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus (Mouse) OX=10090 GN=Myl6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 32-UNIMOD:4,2-UNIMOD:1,2-UNIMOD:4 0.46 21.0 8 6 4 PRT tr|Q9D881|Q9D881_MOUSE Isoform of P19536, Cytochrome c oxidase subunit 5B, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cox5b-ps PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 21.0 null 0.15 21.0 1 1 1 PRT sp|P55264|ADK_MOUSE Adenosine kinase OS=Mus musculus (Mouse) OX=10090 GN=Adk PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 159-UNIMOD:4,139-UNIMOD:4,142-UNIMOD:4 0.24 21.0 9 7 5 PRT sp|Q8R0F9|S14L4_MOUSE SEC14-like protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Sec14l4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 301-UNIMOD:4 0.12 21.0 3 3 3 PRT sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus (Mouse) OX=10090 GN=Arl8b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.15 21.0 2 2 2 PRT sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus (Mouse) OX=10090 GN=Cct3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 213-UNIMOD:4,455-UNIMOD:4 0.11 21.0 6 5 4 PRT sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus (Mouse) OX=10090 GN=Rhoa PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 159-UNIMOD:4 0.07 21.0 1 1 1 PRT sp|Q9CQV8|1433B_MOUSE 14-3-3 protein beta/alpha OS=Mus musculus (Mouse) OX=10090 GN=Ywhab PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Abcc3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 0.05 21.0 7 6 5 PRT sp|Q9Z2I8|SUCB2_MOUSE Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.09 21.0 5 3 1 PRT sp|Q8R086|SUOX_MOUSE Sulfite oxidase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suox PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|P56528|CD38_MOUSE ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Cd38 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 86-UNIMOD:4 0.12 21.0 5 3 1 PRT sp|Q8VCR7|ABHEB_MOUSE Protein ABHD14B OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 138-UNIMOD:4 0.22 21.0 6 4 2 PRT tr|A2AFQ2|A2AFQ2_MOUSE Isoform of O08756, 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.16 21.0 4 3 2 PRT sp|P97371|PSME1_MOUSE Proteasome activator complex subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Psme1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.15 21.0 4 3 2 PRT sp|Q9DCX2|ATP5H_MOUSE ATP synthase subunit d, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5pd PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 101-UNIMOD:4 0.19 21.0 2 2 2 PRT sp|O09061|PSB1_MOUSE Proteasome subunit beta type-1 OS=Mus musculus (Mouse) OX=10090 GN=Psmb1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.14 21.0 2 2 2 PRT sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus (Mouse) OX=10090 GN=Gbe1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9ET01|PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus (Mouse) OX=10090 GN=Pygl PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 0.17 21.0 13 12 11 PRT sp|P99024|TBB5_MOUSE Tubulin beta-5 chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 73-UNIMOD:35,12-UNIMOD:4 0.11 21.0 4 3 2 PRT sp|Q9CWH6|PSMA8_MOUSE Proteasome subunit alpha type-8 OS=Mus musculus (Mouse) OX=10090 GN=Psma8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.21 21.0 3 3 3 PRT sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus (Mouse) OX=10090 GN=Arf4 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 62-UNIMOD:4 0.08 21.0 1 1 1 PRT sp|P62889|RL30_MOUSE 60S ribosomal protein L30 OS=Mus musculus (Mouse) OX=10090 GN=Rpl30 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 92-UNIMOD:4 0.15 21.0 1 1 1 PRT sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Tfr2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9JHW2|NIT2_MOUSE Omega-amidase NIT2 OS=Mus musculus (Mouse) OX=10090 GN=Nit2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.24 21.0 6 4 2 PRT sp|P97384|ANX11_MOUSE Annexin A11 OS=Mus musculus (Mouse) OX=10090 GN=Anxa11 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 382-UNIMOD:4 0.04 21.0 2 2 2 PRT sp|Q9CQ22|LTOR1_MOUSE Ragulator complex protein LAMTOR1 OS=Mus musculus (Mouse) OX=10090 GN=Lamtor1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.29 21.0 2 2 2 PRT sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus (Mouse) OX=10090 GN=Rab7a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.13 21.0 3 2 1 PRT sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Uba1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.06 21.0 3 3 3 PRT sp|P28271|ACOC_MOUSE Cytoplasmic aconitate hydratase OS=Mus musculus (Mouse) OX=10090 GN=Aco1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 21.0 null 118-UNIMOD:4,392-UNIMOD:4 0.18 21.0 10 10 10 PRT sp|O70456|1433S_MOUSE 14-3-3 protein sigma OS=Mus musculus (Mouse) OX=10090 GN=Sfn PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 220-UNIMOD:35 0.11 21.0 5 3 1 PRT sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus (Mouse) OX=10090 GN=Ube2d3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 107-UNIMOD:4,111-UNIMOD:4 0.17 21.0 1 1 1 PRT sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ldhd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ] 21.0 null 251-UNIMOD:4,369-UNIMOD:4 0.14 21.0 3 3 3 PRT sp|Q9WVT6|CAH14_MOUSE Carbonic anhydrase 14 OS=Mus musculus (Mouse) OX=10090 GN=Ca14 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.11 21.0 5 3 1 PRT sp|P21614|VTDB_MOUSE Vitamin D-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Gc PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 220-UNIMOD:4 0.07 21.0 2 2 2 PRT sp|P47955|RLA1_MOUSE 60S acidic ribosomal protein P1 OS=Mus musculus (Mouse) OX=10090 GN=Rplp1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.15 21.0 1 1 1 PRT sp|P47757|CAPZB_MOUSE F-actin-capping protein subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Capzb PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 36-UNIMOD:4 0.13 21.0 2 2 2 PRT sp|Q9DCT1|AKCL2_MOUSE 1,5-anhydro-D-fructose reductase OS=Mus musculus (Mouse) OX=10090 GN=Akr1e2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 2 1 0 PRT sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus (Mouse) OX=10090 GN=Cct5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 2 1 0 PRT tr|A0A087WP24|A0A087WP24_MOUSE Isoform of Q8VCR7, AB hydrolase-1 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Abhd14b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 21.0 null 2-UNIMOD:1 0.15 21.0 2 2 2 PRT sp|P62814|VATB2_MOUSE V-type proton ATPase subunit B, brain isoform OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1b2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 207-UNIMOD:4 0.09 21.0 3 3 3 PRT tr|Q8K154|Q8K154_MOUSE UDP-glucuronosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugt2b34 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P62717|RL18A_MOUSE 60S ribosomal protein L18a OS=Mus musculus (Mouse) OX=10090 GN=Rpl18a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21.0 null 109-UNIMOD:4 0.08 21.0 1 1 1 PRT sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 660-UNIMOD:4,426-UNIMOD:4 0.02 20.0 3 2 1 PRT sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus (Mouse) OX=10090 GN=Hacl1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 6 4 3 PRT sp|P97372|PSME2_MOUSE Proteasome activator complex subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Psme2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.17 20.0 2 2 2 PRT sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus (Mouse) OX=10090 GN=Dcxr PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 100-UNIMOD:4 0.15 20.0 3 3 3 PRT sp|P52825|CPT2_MOUSE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cpt2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 5 5 5 PRT sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus (Mouse) OX=10090 GN=Rab5c PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.24 20.0 4 4 4 PRT tr|G5E8H9|G5E8H9_MOUSE Retinol dehydrogenase 19 OS=Mus musculus (Mouse) OX=10090 GN=Rdh19 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 60-UNIMOD:4,37-UNIMOD:4 0.13 20.0 6 3 0 PRT sp|Q9DC51|GNAI3_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Gnai3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 325-UNIMOD:4,66-UNIMOD:4,139-UNIMOD:4 0.16 20.0 4 4 4 PRT sp|P02535|K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus (Mouse) OX=10090 GN=Krt10 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|B2RXS4|PLXB2_MOUSE Plexin-B2 OS=Mus musculus (Mouse) OX=10090 GN=Plxnb2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 769-UNIMOD:4,772-UNIMOD:4,313-UNIMOD:4,1488-UNIMOD:4,471-UNIMOD:4,477-UNIMOD:4,480-UNIMOD:4 0.07 20.0 9 9 9 PRT sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus (Mouse) OX=10090 GN=Atp11a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 3 2 1 PRT sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus (Mouse) OX=10090 GN=Napsa PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9Z2U0|PSA7_MOUSE Proteasome subunit alpha type-7 OS=Mus musculus (Mouse) OX=10090 GN=Psma7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 0.15 20.0 3 3 3 PRT sp|Q9R1P4|PSA1_MOUSE Proteasome subunit alpha type-1 OS=Mus musculus (Mouse) OX=10090 GN=Psma1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 2 2 2 PRT sp|Q64735|CR1L_MOUSE Complement component receptor 1-like protein OS=Mus musculus (Mouse) OX=10090 GN=Cr1l PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q91WT9|CBS_MOUSE Cystathionine beta-synthase OS=Mus musculus (Mouse) OX=10090 GN=Cbs PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.07 20.0 3 3 3 PRT sp|O08917|FLOT1_MOUSE Flotillin-1 OS=Mus musculus (Mouse) OX=10090 GN=Flot1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 34-UNIMOD:4 0.23 20.0 7 7 7 PRT sp|P10518|HEM2_MOUSE Delta-aminolevulinic acid dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Alad PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 203-UNIMOD:4 0.13 20.0 3 3 3 PRT sp|P29699|FETUA_MOUSE Alpha-2-HS-glycoprotein OS=Mus musculus (Mouse) OX=10090 GN=Ahsg PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 208-UNIMOD:4 0.14 20.0 2 2 2 PRT sp|O35660|GSTM6_MOUSE Glutathione S-transferase Mu 6 OS=Mus musculus (Mouse) OX=10090 GN=Gstm6 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 87-UNIMOD:4 0.13 20.0 4 3 2 PRT sp|P14148|RL7_MOUSE 60S ribosomal protein L7 OS=Mus musculus (Mouse) OX=10090 GN=Rpl7 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.04 20.0 2 1 0 PRT sp|Q9WUM5|SUCA_MOUSE Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Suclg1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 60-UNIMOD:4,172-UNIMOD:4,181-UNIMOD:4 0.18 20.0 5 4 3 PRT sp|Q91WM6|EVA1A_MOUSE Protein eva-1 homolog A OS=Mus musculus (Mouse) OX=10090 GN=Eva1a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.08 20.0 2 1 0 PRT sp|Q08857|CD36_MOUSE Platelet glycoprotein 4 OS=Mus musculus (Mouse) OX=10090 GN=Cd36 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 311-UNIMOD:4,313-UNIMOD:4 0.15 20.0 5 5 5 PRT sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus (Mouse) OX=10090 GN=Fmo1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 2 2 2 PRT sp|Q60930|VDAC2_MOUSE Voltage-dependent anion-selective channel protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Vdac2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 48-UNIMOD:4 0.18 20.0 3 3 3 PRT sp|P34884|MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus (Mouse) OX=10090 GN=Mif PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 81-UNIMOD:4 0.19 20.0 3 2 1 PRT sp|P11609|CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus (Mouse) OX=10090 GN=Cd1d1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.07 20.0 2 2 2 PRT sp|P67778|PHB_MOUSE Prohibitin OS=Mus musculus (Mouse) OX=10090 GN=Phb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.08 20.0 2 2 2 PRT sp|Q02257|PLAK_MOUSE Junction plakoglobin OS=Mus musculus (Mouse) OX=10090 GN=Jup PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 3 3 3 PRT sp|P17439|GLCM_MOUSE Lysosomal acid glucosylceramidase OS=Mus musculus (Mouse) OX=10090 GN=Gba PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 104-UNIMOD:35,145-UNIMOD:4 0.23 20.0 9 8 7 PRT sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpk PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q9WUM3|COR1B_MOUSE Coronin-1B OS=Mus musculus (Mouse) OX=10090 GN=Coro1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 41-UNIMOD:4 0.03 20.0 1 1 1 PRT sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus (Mouse) OX=10090 GN=Rhob PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 20-UNIMOD:4 0.05 20.0 1 1 1 PRT sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Tcp1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 1-UNIMOD:1 0.12 20.0 6 5 4 PRT sp|P63242|IF5A1_MOUSE Eukaryotic translation initiation factor 5A-1 OS=Mus musculus (Mouse) OX=10090 GN=Eif5a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.08 20.0 1 1 1 PRT sp|Q9JI75|NQO2_MOUSE Ribosyldihydronicotinamide dehydrogenase [quinone] OS=Mus musculus (Mouse) OX=10090 GN=Nqo2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.19 20.0 3 3 3 PRT sp|P58735|S26A1_MOUSE Sulfate anion transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc26a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 653-UNIMOD:4,654-UNIMOD:4 0.13 20.0 7 6 5 PRT sp|Q9EPK2|XRP2_MOUSE Protein XRP2 OS=Mus musculus (Mouse) OX=10090 GN=Rp2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P54071|IDHP_MOUSE Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Idh2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 4 3 2 PRT sp|Q9DBT9|M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dmgdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.07 20.0 4 4 4 PRT tr|E9Q509|E9Q509_MOUSE Isoform of P53657, Pyruvate kinase OS=Mus musculus (Mouse) OX=10090 GN=Pklr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 2 1 0 PRT sp|P50516|VATA_MOUSE V-type proton ATPase catalytic subunit A OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P05784|K1C18_MOUSE Keratin, type I cytoskeletal 18 OS=Mus musculus (Mouse) OX=10090 GN=Krt18 PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.30 20.0 11 9 7 PRT sp|P97370|AT1B3_MOUSE Sodium/potassium-transporting ATPase subunit beta-3 OS=Mus musculus (Mouse) OX=10090 GN=Atp1b3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 144-UNIMOD:4,154-UNIMOD:4 0.20 20.0 4 3 2 PRT sp|Q91WU0|CES1F_MOUSE Carboxylesterase 1F OS=Mus musculus (Mouse) OX=10090 GN=Ces1f PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.18 20.0 7 5 3 PRT sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus (Mouse) OX=10090 GN=Iqgap2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 0.04 20.0 4 4 4 PRT sp|Q99JY0|ECHB_MOUSE Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hadhb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 436-UNIMOD:4 0.17 20.0 8 7 6 PRT sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus (Mouse) OX=10090 GN=Rab8a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|P10107|ANXA1_MOUSE Annexin A1 OS=Mus musculus (Mouse) OX=10090 GN=Anxa1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P51174|ACADL_MOUSE Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadl PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.14 20.0 5 4 3 PRT sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus (Mouse) OX=10090 GN=Cbr1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 20.0 null 2-UNIMOD:1 0.18 20.0 5 4 3 PRT sp|P13745|GSTA1_MOUSE Glutathione S-transferase A1 OS=Mus musculus (Mouse) OX=10090 GN=Gsta1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 20.0 null 2-UNIMOD:1 0.10 20.0 6 3 1 PRT sp|Q9JJX6|P2RX4_MOUSE P2X purinoceptor 4 OS=Mus musculus (Mouse) OX=10090 GN=P2rx4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20.0 null 270-UNIMOD:4 0.06 20.0 2 2 2 PRT sp|P23492|PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus (Mouse) OX=10090 GN=Pnp PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.12 19.0 3 3 3 PRT sp|Q9DBA8|HUTI_MOUSE Probable imidazolonepropionase OS=Mus musculus (Mouse) OX=10090 GN=Amdhd1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 155-UNIMOD:4 0.11 19.0 4 4 4 PRT sp|O35453|HEPS_MOUSE Serine protease hepsin OS=Mus musculus (Mouse) OX=10090 GN=Hpn PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 157-UNIMOD:4,159-UNIMOD:4,109-UNIMOD:4 0.08 19.0 4 3 2 PRT sp|P47963|RL13_MOUSE 60S ribosomal protein L13 OS=Mus musculus (Mouse) OX=10090 GN=Rpl13 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.12 19.0 2 2 2 PRT sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Uqcrc1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 380-UNIMOD:4 0.03 19.0 1 1 1 PRT sp|Q60770|STXB3_MOUSE Syntaxin-binding protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Stxbp3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 2 2 2 PRT sp|Q62165|DAG1_MOUSE Dystroglycan OS=Mus musculus (Mouse) OX=10090 GN=Dag1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 711-UNIMOD:4 0.02 19.0 1 1 1 PRT sp|Q9JL15|LEG8_MOUSE Galectin-8 OS=Mus musculus (Mouse) OX=10090 GN=Lgals8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 74-UNIMOD:4,77-UNIMOD:4 0.17 19.0 4 4 4 PRT sp|P62754|RS6_MOUSE 40S ribosomal protein S6 OS=Mus musculus (Mouse) OX=10090 GN=Rps6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 12-UNIMOD:4 0.10 19.0 2 2 2 PRT tr|L7N463|L7N463_MOUSE Cytochrome P450, family 2, subfamily d, polypeptide 34 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2d34 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 2 2 2 PRT sp|P24668|MPRD_MOUSE Cation-dependent mannose-6-phosphate receptor OS=Mus musculus (Mouse) OX=10090 GN=M6pr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 33-UNIMOD:4 0.09 19.0 2 2 2 PRT sp|Q9R112|SQOR_MOUSE Sulfide:quinone oxidoreductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sqor PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P57776|EF1D_MOUSE Elongation factor 1-delta OS=Mus musculus (Mouse) OX=10090 GN=Eef1d PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.18 19.0 4 3 2 PRT sp|P35951|LDLR_MOUSE Low-density lipoprotein receptor OS=Mus musculus (Mouse) OX=10090 GN=Ldlr PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9CVB6|ARPC2_MOUSE Actin-related protein 2/3 complex subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Arpc2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q8CI59|STEA3_MOUSE Metalloreductase STEAP3 OS=Mus musculus (Mouse) OX=10090 GN=Steap3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 2 1 0 PRT sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a22 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap1b1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 95-UNIMOD:4 0.03 19.0 3 2 1 PRT sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus (Mouse) OX=10090 GN=Rab35 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus (Mouse) OX=10090 GN=Arf3 PE=2 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.43 19.0 6 5 4 PRT sp|P14131|RS16_MOUSE 40S ribosomal protein S16 OS=Mus musculus (Mouse) OX=10090 GN=Rps16 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 25-UNIMOD:4 0.23 19.0 3 3 3 PRT tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE Uncharacterized protein OS=Mus musculus (Mouse) OX=10090 GN=ENSMUSG00000118552 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.11 19.0 1 1 1 PRT sp|Q9WV54|ASAH1_MOUSE Acid ceramidase OS=Mus musculus (Mouse) OX=10090 GN=Asah1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ] 19.0 null 291-UNIMOD:4,142-UNIMOD:4 0.08 19.0 3 3 3 PRT sp|Q68FD5|CLH1_MOUSE Clathrin heavy chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Cltc PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 870-UNIMOD:4 0.08 19.0 10 9 8 PRT sp|Q60634|FLOT2_MOUSE Flotillin-2 OS=Mus musculus (Mouse) OX=10090 GN=Flot2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 88-UNIMOD:4 0.21 19.0 7 7 7 PRT sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus (Mouse) OX=10090 GN=Cyp1a1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 2 2 2 PRT sp|O88343|S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc4a4 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q9EQK5|MVP_MOUSE Major vault protein OS=Mus musculus (Mouse) OX=10090 GN=Mvp PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 4 3 2 PRT sp|Q9CXW4|RL11_MOUSE 60S ribosomal protein L11 OS=Mus musculus (Mouse) OX=10090 GN=Rpl11 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hint2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.10 19.0 1 1 1 PRT sp|Q61490|CD166_MOUSE CD166 antigen OS=Mus musculus (Mouse) OX=10090 GN=Alcam PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 2 2 2 PRT sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus (Mouse) OX=10090 GN=Sar1a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|P45952|ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acadm PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.10 19.0 4 3 2 PRT sp|P62267|RS23_MOUSE 40S ribosomal protein S23 OS=Mus musculus (Mouse) OX=10090 GN=Rps23 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|Q9DB20|ATPO_MOUSE ATP synthase subunit O, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5po PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.11 19.0 3 2 1 PRT sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus (Mouse) OX=10090 GN=Abca6 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 1487-UNIMOD:4,1587-UNIMOD:4 0.04 19.0 5 4 3 PRT sp|Q8BP67|RL24_MOUSE 60S ribosomal protein L24 OS=Mus musculus (Mouse) OX=10090 GN=Rpl24 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|P46460|NSF_MOUSE Vesicle-fusing ATPase OS=Mus musculus (Mouse) OX=10090 GN=Nsf PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 599-UNIMOD:4 0.11 19.0 8 6 4 PRT sp|Q9CQA3|SDHB_MOUSE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sdhb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.10 19.0 2 2 2 PRT sp|Q9QXY6|EHD3_MOUSE EH domain-containing protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Ehd3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 2 2 2 PRT sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Acly PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 229-UNIMOD:4 0.06 19.0 5 5 5 PRT sp|Q62433|NDRG1_MOUSE Protein NDRG1 OS=Mus musculus (Mouse) OX=10090 GN=Ndrg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P05201|AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Got1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.23 19.0 8 6 4 PRT sp|O35469|3BHS6_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus (Mouse) OX=10090 GN=Hsd3b6 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q63886|UD11_MOUSE UDP-glucuronosyltransferase 1-1 OS=Mus musculus (Mouse) OX=10090 GN=Ugt1a1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 2 2 2 PRT tr|A0A0N4SVU1|A0A0N4SVU1_MOUSE Predicted gene 7298 OS=Mus musculus (Mouse) OX=10090 GN=Gm7298 PE=4 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 86-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|P00920|CAH2_MOUSE Carbonic anhydrase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ca2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.07 19.0 1 1 1 PRT sp|P10605|CATB_MOUSE Cathepsin B OS=Mus musculus (Mouse) OX=10090 GN=Ctsb PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 93-UNIMOD:4 0.10 19.0 3 2 1 PRT sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Actr3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 19.0 null 2-UNIMOD:1,8-UNIMOD:4,12-UNIMOD:4 0.10 19.0 4 4 4 PRT sp|Q9DCY0|KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus (Mouse) OX=10090 GN=Keg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 19.0 null 99-UNIMOD:28 0.25 19.0 7 5 3 PRT sp|O35639|ANXA3_MOUSE Annexin A3 OS=Mus musculus (Mouse) OX=10090 GN=Anxa3 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P52480|KPYM_MOUSE Pyruvate kinase PKM OS=Mus musculus (Mouse) OX=10090 GN=Pkm PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 49-UNIMOD:4 0.05 19.0 2 2 2 PRT sp|O88384|VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus (Mouse) OX=10090 GN=Vti1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19.0 null 2-UNIMOD:1 0.06 19.0 1 1 1 PRT sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc30a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.05 19.0 1 1 1 PRT sp|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus (Mouse) OX=10090 GN=Elf2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 2 1 0 PRT sp|Q8K183|PDXK_MOUSE Pyridoxal kinase OS=Mus musculus (Mouse) OX=10090 GN=Pdxk PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.09 19.0 2 2 2 PRT sp|Q01339|APOH_MOUSE Beta-2-glycoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Apoh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 325-UNIMOD:4,23-UNIMOD:4,260-UNIMOD:4 0.12 19.0 3 3 3 PRT sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Txn2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.16 19.0 1 1 1 PRT sp|P09813|APOA2_MOUSE Apolipoprotein A-II OS=Mus musculus (Mouse) OX=10090 GN=Apoa2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.21 18.0 3 2 1 PRT sp|O70131|NINJ1_MOUSE Ninjurin-1 OS=Mus musculus (Mouse) OX=10090 GN=Ninj1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.09 18.0 1 1 1 PRT sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a4 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 2 2 2 PRT tr|B2RUS7|B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus (Mouse) OX=10090 GN=Abcc8 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P26043|RADI_MOUSE Radixin OS=Mus musculus (Mouse) OX=10090 GN=Rdx PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 7 6 5 PRT sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Spta1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 15 12 10 PRT tr|A9R9W0|A9R9W0_MOUSE Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup15 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 156-UNIMOD:4 0.13 18.0 3 2 1 PRT sp|Q8VCX1|AK1D1_MOUSE Aldo-keto reductase family 1 member D1 OS=Mus musculus (Mouse) OX=10090 GN=Akr1d1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT tr|L7N264|L7N264_MOUSE Solute carrier organic anion transporter family member OS=Mus musculus (Mouse) OX=10090 GN=Gm5724 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|O70250|PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus (Mouse) OX=10090 GN=Pgam2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.09 18.0 2 2 2 PRT sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Ddc PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT tr|A6ZI46|A6ZI46_MOUSE Fructose-bisphosphate aldolase OS=Mus musculus (Mouse) OX=10090 GN=Aldoart1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 394-UNIMOD:4 0.05 18.0 4 2 1 PRT sp|P07309|TTHY_MOUSE Transthyretin OS=Mus musculus (Mouse) OX=10090 GN=Ttr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 1 1 1 PRT sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus (Mouse) OX=10090 GN=Cad PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 3 3 3 PRT sp|P08556|RASN_MOUSE GTPase NRas OS=Mus musculus (Mouse) OX=10090 GN=Nras PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.15 18.0 2 2 2 PRT sp|P61226|RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus (Mouse) OX=10090 GN=Rap2b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q91X72|HEMO_MOUSE Hemopexin OS=Mus musculus (Mouse) OX=10090 GN=Hpx PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 18.0 null 406-UNIMOD:4,364-UNIMOD:4,255-UNIMOD:4,255-UNIMOD:385 0.14 18.0 6 4 3 PRT sp|Q99P30|NUDT7_MOUSE Peroxisomal coenzyme A diphosphatase NUDT7 OS=Mus musculus (Mouse) OX=10090 GN=Nudt7 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 2 2 2 PRT sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp2b1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 3 3 3 PRT sp|Q64727|VINC_MOUSE Vinculin OS=Mus musculus (Mouse) OX=10090 GN=Vcl PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 2 2 2 PRT sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Chdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 3 3 3 PRT sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Slc25a3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.07 18.0 3 2 1 PRT sp|Q8BHG3|CC50B_MOUSE Cell cycle control protein 50B OS=Mus musculus (Mouse) OX=10090 GN=Tmem30b PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 2 1 0 PRT sp|Q71RI9|KAT3_MOUSE Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus (Mouse) OX=10090 GN=Kyat3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 169-UNIMOD:35 0.09 18.0 4 3 2 PRT sp|Q61009|SCRB1_MOUSE Scavenger receptor class B member 1 OS=Mus musculus (Mouse) OX=10090 GN=Scarb1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.13 18.0 7 6 5 PRT sp|P61458|PHS_MOUSE Pterin-4-alpha-carbinolamine dehydratase OS=Mus musculus (Mouse) OX=10090 GN=Pcbd1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 1 1 1 PRT sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b13 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q99KI0|ACON_MOUSE Aconitate hydratase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aco2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.12 18.0 6 6 6 PRT sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Cct4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 120-UNIMOD:4 0.17 18.0 7 6 5 PRT sp|B2RSH2|GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Gnai1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 254-UNIMOD:4 0.09 18.0 3 3 3 PRT sp|Q9D6Y7|MSRA_MOUSE Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus (Mouse) OX=10090 GN=Msra PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.22 18.0 3 3 3 PRT sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptan1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 3 3 3 PRT tr|G3UXE9|G3UXE9_MOUSE Ig-like domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm8909 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 2 1 0 PRT sp|P62852|RS25_MOUSE 40S ribosomal protein S25 OS=Mus musculus (Mouse) OX=10090 GN=Rps25 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus (Mouse) OX=10090 GN=Cct6a PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.14 18.0 4 4 4 PRT sp|Q9D0I9|SYRC_MOUSE Arginine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Rars1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 369-UNIMOD:4 0.04 18.0 2 2 2 PRT sp|O35632|HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus (Mouse) OX=10090 GN=Hyal2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P68040|RACK1_MOUSE Receptor of activated protein C kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Rack1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 249-UNIMOD:4 0.08 18.0 2 2 2 PRT sp|Q9R0Q7|TEBP_MOUSE Prostaglandin E synthase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ptges3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 40-UNIMOD:4 0.09 18.0 1 1 1 PRT sp|Q91XE8|TM205_MOUSE Transmembrane protein 205 OS=Mus musculus (Mouse) OX=10090 GN=Tmem205 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.10 18.0 1 1 1 PRT sp|Q9CYS6|CB072_MOUSE Uncharacterized protein C2orf72 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1920042 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 103-UNIMOD:4 0.08 18.0 3 2 1 PRT sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2r1a PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P33622|APOC3_MOUSE Apolipoprotein C-III OS=Mus musculus (Mouse) OX=10090 GN=Apoc3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.20 18.0 1 1 1 PRT sp|P29391|FRIL1_MOUSE Ferritin light chain 1 OS=Mus musculus (Mouse) OX=10090 GN=Ftl1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.21 18.0 3 3 3 PRT sp|Q9D1D4|TMEDA_MOUSE Transmembrane emp24 domain-containing protein 10 OS=Mus musculus (Mouse) OX=10090 GN=Tmed10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.11 18.0 2 2 2 PRT sp|O88668|CREG1_MOUSE Protein CREG1 OS=Mus musculus (Mouse) OX=10090 GN=Creg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus (Mouse) OX=10090 GN=Ppp1ca PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|P70697|DCUP_MOUSE Uroporphyrinogen decarboxylase OS=Mus musculus (Mouse) OX=10090 GN=Urod PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P68033|ACTC_MOUSE Actin, alpha cardiac muscle 1 OS=Mus musculus (Mouse) OX=10090 GN=Actc1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.05 18.0 1 1 0 PRT sp|P15626|GSTM2_MOUSE Glutathione S-transferase Mu 2 OS=Mus musculus (Mouse) OX=10090 GN=Gstm2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.07 18.0 1 1 1 PRT sp|Q9WV32|ARC1B_MOUSE Actin-related protein 2/3 complex subunit 1B OS=Mus musculus (Mouse) OX=10090 GN=Arpc1b PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 18.0 null 2-UNIMOD:1,13-UNIMOD:4 0.09 18.0 2 2 2 PRT sp|Q01405|SC23A_MOUSE Protein transport protein Sec23A OS=Mus musculus (Mouse) OX=10090 GN=Sec23a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 61-UNIMOD:4 0.03 18.0 2 2 2 PRT sp|P62281|RS11_MOUSE 40S ribosomal protein S11 OS=Mus musculus (Mouse) OX=10090 GN=Rps11 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 131-UNIMOD:4 0.12 18.0 1 1 1 PRT sp|Q8CGK3|LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Lonp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P20918|PLMN_MOUSE Plasminogen OS=Mus musculus (Mouse) OX=10090 GN=Plg PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 502-UNIMOD:4 0.04 18.0 2 2 2 PRT sp|Q9DCQ2|ASPD_MOUSE Putative L-aspartate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Aspdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.07 18.0 2 2 2 PRT sp|Q9CWL8|CTBL1_MOUSE Beta-catenin-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ctnnbl1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18.0 null 387-UNIMOD:35 0.02 18.0 1 1 1 PRT sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus (Mouse) OX=10090 GN=Pdia4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 3 3 3 PRT tr|G3UZP7|G3UZP7_MOUSE Isoform of P14427, Ig-like domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=H2-D1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q9D7B6|ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Acad8 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psmb6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.10 17.0 3 2 1 PRT sp|Q922Q1|MARC2_MOUSE Mitochondrial amidoxime reducing component 2 OS=Mus musculus (Mouse) OX=10090 GN=Mtarc2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 2 2 2 PRT sp|Q9DCM2|GSTK1_MOUSE Glutathione S-transferase kappa 1 OS=Mus musculus (Mouse) OX=10090 GN=Gstk1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 176-UNIMOD:4 0.14 17.0 3 2 1 PRT sp|Q8VE09|TT39C_MOUSE Tetratricopeptide repeat protein 39C OS=Mus musculus (Mouse) OX=10090 GN=Ttc39c PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q9CPQ1|COX6C_MOUSE Cytochrome c oxidase subunit 6C OS=Mus musculus (Mouse) OX=10090 GN=Cox6c PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.12 17.0 1 1 1 PRT sp|P70296|PEBP1_MOUSE Phosphatidylethanolamine-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pebp1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.12 17.0 2 2 2 PRT sp|P62918|RL8_MOUSE 60S ribosomal protein L8 OS=Mus musculus (Mouse) OX=10090 GN=Rpl8 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|P62242|RS8_MOUSE 40S ribosomal protein S8 OS=Mus musculus (Mouse) OX=10090 GN=Rps8 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.17 17.0 3 3 3 PRT sp|P26041|MOES_MOUSE Moesin OS=Mus musculus (Mouse) OX=10090 GN=Msn PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 2 2 2 PRT sp|P62900|RL31_MOUSE 60S ribosomal protein L31 OS=Mus musculus (Mouse) OX=10090 GN=Rpl31 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 1 1 1 PRT sp|Q91XF0|PNPO_MOUSE Pyridoxine-5'-phosphate oxidase OS=Mus musculus (Mouse) OX=10090 GN=Pnpo PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|Q9D0J8|PTMS_MOUSE Parathymosin OS=Mus musculus (Mouse) OX=10090 GN=Ptms PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.12 17.0 1 1 1 PRT sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus (Mouse) OX=10090 GN=Atp2b4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|P68254|1433T_MOUSE 14-3-3 protein theta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaq PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.14 17.0 2 2 2 PRT sp|P97792|CXAR_MOUSE Coxsackievirus and adenovirus receptor homolog OS=Mus musculus (Mouse) OX=10090 GN=Cxadr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 223-UNIMOD:4 0.12 17.0 4 4 4 PRT sp|Q99LX0|PARK7_MOUSE Protein/nucleic acid deglycase DJ-1 OS=Mus musculus (Mouse) OX=10090 GN=Park7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 46-UNIMOD:4 0.14 17.0 2 2 2 PRT sp|P32507|NECT2_MOUSE Nectin-2 OS=Mus musculus (Mouse) OX=10090 GN=Nectin2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 274-UNIMOD:4 0.05 17.0 2 2 2 PRT sp|Q8K0E8|FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus (Mouse) OX=10090 GN=Fgb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 231-UNIMOD:4 0.07 17.0 3 3 3 PRT sp|Q8VDK1|NIT1_MOUSE Deaminated glutathione amidase OS=Mus musculus (Mouse) OX=10090 GN=Nit1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 63-UNIMOD:4 0.07 17.0 2 2 2 PRT sp|O08677|KNG1_MOUSE Kininogen-1 OS=Mus musculus (Mouse) OX=10090 GN=Kng1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 339-UNIMOD:4 0.02 17.0 1 1 1 PRT sp|Q6R0H7|GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus (Mouse) OX=10090 GN=Gnas PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 2 2 2 PRT sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus (Mouse) OX=10090 GN=Psmb5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.10 17.0 2 2 2 PRT tr|A2CEK7|A2CEK7_MOUSE Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup14 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.09 17.0 2 2 2 PRT sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus (Mouse) OX=10090 GN=Arl8a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 158-UNIMOD:4,159-UNIMOD:4,164-UNIMOD:4 0.19 17.0 4 3 2 PRT sp|Q99L47|F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=St13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 2 2 2 PRT sp|Q9QUM9|PSA6_MOUSE Proteasome subunit alpha type-6 OS=Mus musculus (Mouse) OX=10090 GN=Psma6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.12 17.0 2 2 2 PRT tr|A0A0N4SVP8|A0A0N4SVP8_MOUSE Eukaryotic translation initiation factor 4A3-like 2 OS=Mus musculus (Mouse) OX=10090 GN=Eif4a3l2 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|Q62425|NDUA4_MOUSE Cytochrome c oxidase subunit NDUFA4 OS=Mus musculus (Mouse) OX=10090 GN=Ndufa4 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.13 17.0 2 1 0 PRT sp|P62827|RAN_MOUSE GTP-binding nuclear protein Ran OS=Mus musculus (Mouse) OX=10090 GN=Ran PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus (Mouse) OX=10090 GN=Ces3b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q8R164|BPHL_MOUSE Valacyclovir hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Bphl PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 206-UNIMOD:4 0.09 17.0 2 2 2 PRT sp|Q61559|FCGRN_MOUSE IgG receptor FcRn large subunit p51 OS=Mus musculus (Mouse) OX=10090 GN=Fcgrt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 182-UNIMOD:4,221-UNIMOD:4,275-UNIMOD:4 0.19 17.0 5 3 1 PRT sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Dars1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.12 17.0 6 5 4 PRT sp|Q99KG5|LSR_MOUSE Lipolysis-stimulated lipoprotein receptor OS=Mus musculus (Mouse) OX=10090 GN=Lsr PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|O08807|PRDX4_MOUSE Peroxiredoxin-4 OS=Mus musculus (Mouse) OX=10090 GN=Prdx4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 3 1 0 PRT sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2f2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 3 3 3 PRT tr|A0A494B9Z0|A0A494B9Z0_MOUSE Isoform of P35545, 40S ribosomal protein S30 OS=Mus musculus (Mouse) OX=10090 GN=Fau PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.17 17.0 1 1 1 PRT sp|Q61503|5NTD_MOUSE 5'-nucleotidase OS=Mus musculus (Mouse) OX=10090 GN=Nt5e PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|O35609|SCAM3_MOUSE Secretory carrier-associated membrane protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Scamp3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.09 17.0 3 2 1 PRT sp|Q8R1I1|QCR9_MOUSE Cytochrome b-c1 complex subunit 9 OS=Mus musculus (Mouse) OX=10090 GN=Uqcr10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.28 17.0 1 1 1 PRT sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus (Mouse) OX=10090 GN=Por PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 4 4 4 PRT sp|Q9DCL9|PUR6_MOUSE Multifunctional protein ADE2 OS=Mus musculus (Mouse) OX=10090 GN=Paics PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.08 17.0 2 2 2 PRT sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgrmc1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.16 17.0 4 4 4 PRT sp|Q00898|A1AT5_MOUSE Alpha-1-antitrypsin 1-5 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1e PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|P35980|RL18_MOUSE 60S ribosomal protein L18 OS=Mus musculus (Mouse) OX=10090 GN=Rpl18 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.07 17.0 1 1 1 PRT sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces2c PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|P40124|CAP1_MOUSE Adenylyl cyclase-associated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cap1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus (Mouse) OX=10090 GN=Rab1A PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 26-UNIMOD:4 0.12 17.0 3 2 1 PRT sp|P17426|AP2A1_MOUSE AP-2 complex subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Ap2a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 2 2 2 PRT sp|Q8BG32|PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus (Mouse) OX=10090 GN=Psmd11 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 17.0 null 2-UNIMOD:1 0.06 17.0 2 2 2 PRT tr|G3UWD9|G3UWD9_MOUSE MFS domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Slc17a3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17.0 null 2-UNIMOD:1 0.05 17.0 1 1 1 PRT sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|Q9DCM0|ETHE1_MOUSE Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ethe1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus (Mouse) OX=10090 GN=Cyp2a12 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|Q9D2G2|ODO2_MOUSE Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dlst PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 2 2 2 PRT sp|P35564|CALX_MOUSE Calnexin OS=Mus musculus (Mouse) OX=10090 GN=Canx PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 2 2 2 PRT sp|P45591|COF2_MOUSE Cofilin-2 OS=Mus musculus (Mouse) OX=10090 GN=Cfl2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 1 1 1 PRT sp|Q9CZX8|RS19_MOUSE 40S ribosomal protein S19 OS=Mus musculus (Mouse) OX=10090 GN=Rps19 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.08 16.0 1 1 1 PRT sp|P01837|IGKC_MOUSE Immunoglobulin kappa constant OS=Mus musculus (Mouse) OX=10090 GN=Igkc PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.08 16.0 1 1 1 PRT sp|P62908|RS3_MOUSE 40S ribosomal protein S3 OS=Mus musculus (Mouse) OX=10090 GN=Rps3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q9QYB1|CLIC4_MOUSE Chloride intracellular channel protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Clic4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 1 1 1 PRT sp|Q5SZA1|NPT3_MOUSE Sodium-dependent phosphate transport protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Slc17a2 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q811D0|DLG1_MOUSE Disks large homolog 1 OS=Mus musculus (Mouse) OX=10090 GN=Dlg1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus (Mouse) OX=10090 GN=D1Pas1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q8VDM4|PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Psmd2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 2 2 2 PRT sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hagh PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.10 16.0 3 2 1 PRT sp|Q9CQ88|TSN31_MOUSE Tetraspanin-31 OS=Mus musculus (Mouse) OX=10090 GN=Tspan31 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 16.0 null 146-UNIMOD:4,150-UNIMOD:4,3-UNIMOD:4,8-UNIMOD:4 0.11 16.0 2 2 2 PRT tr|G3X9Y6|G3X9Y6_MOUSE Aldo_ket_red domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Akr1c19 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 2 2 2 PRT sp|P00405|COX2_MOUSE Cytochrome c oxidase subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Mtco2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.17 16.0 4 3 2 PRT sp|Q8BVW3|TRI14_MOUSE Tripartite motif-containing protein 14 OS=Mus musculus (Mouse) OX=10090 GN=Trim14 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q920A5|RISC_MOUSE Retinoid-inducible serine carboxypeptidase OS=Mus musculus (Mouse) OX=10090 GN=Scpep1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus (Mouse) OX=10090 GN=Eftud2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|Q9WUU7|CATZ_MOUSE Cathepsin Z OS=Mus musculus (Mouse) OX=10090 GN=Ctsz PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 172-UNIMOD:4,175-UNIMOD:4 0.11 16.0 3 3 3 PRT sp|Q8BWF0|SSDH_MOUSE Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh5a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 81-UNIMOD:4 0.07 16.0 3 3 3 PRT sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus (Mouse) OX=10090 GN=Lyn PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q8C1B7|SEP11_MOUSE Septin-11 OS=Mus musculus (Mouse) OX=10090 GN=Septin11 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q9WTR5|CAD13_MOUSE Cadherin-13 OS=Mus musculus (Mouse) OX=10090 GN=Cdh13 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|P62071|RRAS2_MOUSE Ras-related protein R-Ras2 OS=Mus musculus (Mouse) OX=10090 GN=Rras2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 1 1 1 PRT sp|Q99J93|IFM2_MOUSE Interferon-induced transmembrane protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Ifitm2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 2 1 0 PRT sp|P10833|RRAS_MOUSE Ras-related protein R-Ras OS=Mus musculus (Mouse) OX=10090 GN=Rras PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 1 1 1 PRT sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus (Mouse) OX=10090 GN=Acot13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.17 16.0 2 2 2 PRT tr|G3X9R9|G3X9R9_MOUSE Isoform of P43142, G-protein-coupled receptor 182 OS=Mus musculus (Mouse) OX=10090 GN=Gpr182 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q91XE0|GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Glyat PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.10 16.0 2 2 2 PRT sp|O88951|LIN7B_MOUSE Protein lin-7 homolog B OS=Mus musculus (Mouse) OX=10090 GN=Lin7b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 1 1 1 PRT sp|Q9Z2I9|SUCB1_MOUSE Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Sucla2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 152-UNIMOD:4,158-UNIMOD:4,430-UNIMOD:4 0.05 16.0 2 2 2 PRT sp|P15208|INSR_MOUSE Insulin receptor OS=Mus musculus (Mouse) OX=10090 GN=Insr PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|P18581|CTR2_MOUSE Cationic amino acid transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc7a2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 454-UNIMOD:4 0.04 16.0 2 2 2 PRT sp|Q9DD20|MET7B_MOUSE Methyltransferase-like protein 7B OS=Mus musculus (Mouse) OX=10090 GN=Mettl7b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 96-UNIMOD:4 0.05 16.0 1 1 1 PRT sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus (Mouse) OX=10090 GN=Dnajc5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.08 16.0 2 1 0 PRT sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus (Mouse) OX=10090 GN=Rab11b PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.11 16.0 4 2 0 PRT sp|P29758|OAT_MOUSE Ornithine aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Oat PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.10 16.0 3 3 3 PRT sp|P12970|RL7A_MOUSE 60S ribosomal protein L7a OS=Mus musculus (Mouse) OX=10090 GN=Rpl7a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 1 1 1 PRT sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus (Mouse) OX=10090 GN=Rhoc PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 107-UNIMOD:4 0.08 16.0 2 1 0 PRT sp|P21278|GNA11_MOUSE Guanine nucleotide-binding protein subunit alpha-11 OS=Mus musculus (Mouse) OX=10090 GN=Gna11 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.12 16.0 5 4 3 PRT sp|P62897|CYC_MOUSE Cytochrome c, somatic OS=Mus musculus (Mouse) OX=10090 GN=Cycs PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.11 16.0 1 1 1 PRT sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Actr2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|P48776|T23O_MOUSE Tryptophan 2,3-dioxygenase OS=Mus musculus (Mouse) OX=10090 GN=Tdo2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.11 16.0 4 4 4 PRT sp|Q9EQH2|ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Erap1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Txnl1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q9CZS1|AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Aldh1b1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 16.0 null 0.05 16.0 2 2 2 PRT sp|P47753|CAZA1_MOUSE F-actin-capping protein subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Capza1 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus (Mouse) OX=10090 GN=Slc25a13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q63961|EGLN_MOUSE Endoglin OS=Mus musculus (Mouse) OX=10090 GN=Eng PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|P62196|PRS8_MOUSE 26S proteasome regulatory subunit 8 OS=Mus musculus (Mouse) OX=10090 GN=Psmc5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|O70325|GPX4_MOUSE Phospholipid hydroperoxide glutathione peroxidase OS=Mus musculus (Mouse) OX=10090 GN=Gpx4 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 102-UNIMOD:4 0.06 16.0 1 1 1 PRT sp|Q8BTY1|KAT1_MOUSE Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus (Mouse) OX=10090 GN=Kyat1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT tr|A0A1B0GRG8|A0A1B0GRG8_MOUSE Predicted gene 5678 OS=Mus musculus (Mouse) OX=10090 GN=Gm5678 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 226-UNIMOD:4,227-UNIMOD:4 0.11 16.0 2 2 2 PRT sp|Q99PT1|GDIR1_MOUSE Rho GDP-dissociation inhibitor 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgdia PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.08 16.0 1 1 1 PRT sp|Q99L20|GSTT3_MOUSE Glutathione S-transferase theta-3 OS=Mus musculus (Mouse) OX=10090 GN=Gstt3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.07 16.0 1 1 1 PRT sp|P63024|VAMP3_MOUSE Vesicle-associated membrane protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Vamp3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.24 16.0 1 1 1 PRT sp|Q4LDG0|S27A5_MOUSE Bile acyl-CoA synthetase OS=Mus musculus (Mouse) OX=10090 GN=Slc27a5 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 152-UNIMOD:4,198-UNIMOD:4 0.05 16.0 3 3 3 PRT sp|P40237|CD82_MOUSE CD82 antigen OS=Mus musculus (Mouse) OX=10090 GN=Cd82 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.09 16.0 2 2 2 PRT sp|A3KMP2|TTC38_MOUSE Tetratricopeptide repeat protein 38 OS=Mus musculus (Mouse) OX=10090 GN=Ttc38 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q6ZQ38|CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cand1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 2 2 2 PRT sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pcca PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 2 2 2 PRT sp|Q91YY5|SO1A5_MOUSE Solute carrier organic anion transporter family member 1A5 OS=Mus musculus (Mouse) OX=10090 GN=Slco1a5 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 575-UNIMOD:4 0.07 16.0 4 4 4 PRT sp|P26040|EZRI_MOUSE Ezrin OS=Mus musculus (Mouse) OX=10090 GN=Ezr PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 3 3 3 PRT sp|Q00897|A1AT4_MOUSE Alpha-1-antitrypsin 1-4 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1d PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus (Mouse) OX=10090 GN=Ppp2cb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q07797|LG3BP_MOUSE Galectin-3-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Lgals3bp PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus (Mouse) OX=10090 GN=Ces1c PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|P52840|ST1A1_MOUSE Sulfotransferase 1A1 OS=Mus musculus (Mouse) OX=10090 GN=Sult1a1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.10 16.0 2 2 2 PRT sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Dbt PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q9QXK3|COPG2_MOUSE Coatomer subunit gamma-2 OS=Mus musculus (Mouse) OX=10090 GN=Copg2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|P62082|RS7_MOUSE 40S ribosomal protein S7 OS=Mus musculus (Mouse) OX=10090 GN=Rps7 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.07 16.0 1 1 1 PRT sp|Q9R1P1|PSB3_MOUSE Proteasome subunit beta type-3 OS=Mus musculus (Mouse) OX=10090 GN=Psmb3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.17 16.0 2 2 2 PRT sp|Q91VR2|ATPG_MOUSE ATP synthase subunit gamma, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5f1c PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.12 16.0 3 3 3 PRT sp|Q8BGQ7|SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Aars1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 947-UNIMOD:4 0.02 16.0 1 1 1 PRT sp|Q9DCS2|MTL26_MOUSE Methyltransferase-like 26 OS=Mus musculus (Mouse) OX=10090 GN=Mettl26 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.17 16.0 2 2 2 PRT sp|P01898|HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain OS=Mus musculus (Mouse) OX=10090 GN=H2-Q10 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|P50396|GDIA_MOUSE Rab GDP dissociation inhibitor alpha OS=Mus musculus (Mouse) OX=10090 GN=Gdi1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q9DBB8|DHDH_MOUSE Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Dhdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|P47791|GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gsr PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q3UPL0|SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus (Mouse) OX=10090 GN=Sec31a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 16.0 null 0.03 16.0 2 2 2 PRT sp|P99025|GFRP_MOUSE GTP cyclohydrolase 1 feedback regulatory protein OS=Mus musculus (Mouse) OX=10090 GN=Gchfr PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 0.13 16.0 1 1 1 PRT sp|Q8VED5|K2C79_MOUSE Keratin, type II cytoskeletal 79 OS=Mus musculus (Mouse) OX=10090 GN=Krt79 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q99KJ8|DCTN2_MOUSE Dynactin subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Dctn2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q8BIH0|SP130_MOUSE Histone deacetylase complex subunit SAP130 OS=Mus musculus (Mouse) OX=10090 GN=Sap130 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 938-UNIMOD:35 0.01 16.0 1 1 1 PRT sp|Q8CFC7|CLASR_MOUSE CLK4-associating serine/arginine rich protein OS=Mus musculus (Mouse) OX=10090 GN=Clasrp PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 null 0.01 16.0 1 1 1 PRT sp|Q8R2Q8|BST2_MOUSE Bone marrow stromal antigen 2 OS=Mus musculus (Mouse) OX=10090 GN=Bst2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 1 1 1 PRT sp|P70174|HRH1_MOUSE Histamine H1 receptor OS=Mus musculus (Mouse) OX=10090 GN=Hrh1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 1 1 1 PRT sp|Q9CQR2|RS21_MOUSE 40S ribosomal protein S21 OS=Mus musculus (Mouse) OX=10090 GN=Rps21 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.10 15.0 1 1 1 PRT sp|P21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Gnaq PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.08 15.0 2 2 2 PRT sp|Q62283|TSN7_MOUSE Tetraspanin-7 OS=Mus musculus (Mouse) OX=10090 GN=Tspan7 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|P06795|MDR1B_MOUSE ATP-dependent translocase ABCB1 OS=Mus musculus (Mouse) OX=10090 GN=Abcb1b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 430-UNIMOD:4,1225-UNIMOD:4 0.03 15.0 4 4 4 PRT sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b12 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|O70443|GNAZ_MOUSE Guanine nucleotide-binding protein G(z) subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Gnaz PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT tr|A2AV72|A2AV72_MOUSE Lipocln_cytosolic_FA-bd_dom domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Mup6 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 155-UNIMOD:4 0.09 15.0 2 2 2 PRT sp|O35129|PHB2_MOUSE Prohibitin-2 OS=Mus musculus (Mouse) OX=10090 GN=Phb2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P26350|PTMA_MOUSE Prothymosin alpha OS=Mus musculus (Mouse) OX=10090 GN=Ptma PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.13 15.0 1 1 1 PRT tr|E9Q3M9|E9Q3M9_MOUSE DUF4592 domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=2010300C02Rik PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 2 1 0 PRT sp|P62702|RS4X_MOUSE 40S ribosomal protein S4, X isoform OS=Mus musculus (Mouse) OX=10090 GN=Rps4x PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q8CI94|PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus (Mouse) OX=10090 GN=Pygb PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 2 2 2 PRT sp|Q60766|IRGM1_MOUSE Immunity-related GTPase family M protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Irgm1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 86-UNIMOD:4 0.03 15.0 1 1 1 PRT sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus (Mouse) OX=10090 GN=Flna PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|P08101|FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus (Mouse) OX=10090 GN=Fcgr2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q99PL5|RRBP1_MOUSE Ribosome-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Rrbp1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|P97352|S10AD_MOUSE Protein S100-A13 OS=Mus musculus (Mouse) OX=10090 GN=S100a13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.21 15.0 2 2 2 PRT sp|P26883|FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus (Mouse) OX=10090 GN=Fkbp1a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 15.0 null 0.13 15.0 1 1 1 PRT sp|O09131|GSTO1_MOUSE Glutathione S-transferase omega-1 OS=Mus musculus (Mouse) OX=10090 GN=Gsto1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.06 15.0 1 1 1 PRT sp|P21981|TGM2_MOUSE Protein-glutamine gamma-glutamyltransferase 2 OS=Mus musculus (Mouse) OX=10090 GN=Tgm2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 15.0 null 370-UNIMOD:4,371-UNIMOD:4,2-UNIMOD:1 0.06 15.0 3 3 3 PRT sp|P97364|SPS2_MOUSE Selenide, water dikinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Sephs2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|Q68FL4|SAHH3_MOUSE Putative adenosylhomocysteinase 3 OS=Mus musculus (Mouse) OX=10090 GN=Ahcyl2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 3 2 1 PRT sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus (Mouse) OX=10090 GN=Slc38a4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 2 2 2 PRT sp|Q91X34|BAAT_MOUSE Bile acid-CoA:amino acid N-acyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Baat PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|Q9CPW4|ARPC5_MOUSE Actin-related protein 2/3 complex subunit 5 OS=Mus musculus (Mouse) OX=10090 GN=Arpc5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.09 15.0 1 1 1 PRT sp|Q6IFX2|K1C42_MOUSE Keratin, type I cytoskeletal 42 OS=Mus musculus (Mouse) OX=10090 GN=Krt42 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q06185|ATP5I_MOUSE ATP synthase subunit e, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5me PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.18 15.0 2 1 0 PRT sp|P97821|CATC_MOUSE Dipeptidyl peptidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ctsc PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q8BG67|EFR3A_MOUSE Protein EFR3 homolog A OS=Mus musculus (Mouse) OX=10090 GN=Efr3a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 2 2 2 PRT sp|P22599|A1AT2_MOUSE Alpha-1-antitrypsin 1-2 OS=Mus musculus (Mouse) OX=10090 GN=Serpina1b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.06 15.0 2 2 2 PRT sp|P24721|ASGR2_MOUSE Asialoglycoprotein receptor 2 OS=Mus musculus (Mouse) OX=10090 GN=Asgr2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 5-UNIMOD:4 0.15 15.0 2 2 2 PRT tr|D3Z298|D3Z298_MOUSE Carboxylic ester hydrolase OS=Mus musculus (Mouse) OX=10090 GN=Ces1h PE=3 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q9JHI5|IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ivd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|P11688|ITA5_MOUSE Integrin alpha-5 OS=Mus musculus (Mouse) OX=10090 GN=Itga5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Prkcsh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT tr|F6RWR5|F6RWR5_MOUSE Glutathione S-transferase pi 3 OS=Mus musculus (Mouse) OX=10090 GN=Gstp3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.06 15.0 1 1 1 PRT sp|A2A974|CP4CB_MOUSE Cytochrome P450 4A12B OS=Mus musculus (Mouse) OX=10090 GN=Cyp4a12b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|P31651|S6A12_MOUSE Sodium- and chloride-dependent betaine transporter OS=Mus musculus (Mouse) OX=10090 GN=Slc6a12 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 2 1 0 PRT sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus (Mouse) OX=10090 GN=Stab2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P10852|4F2_MOUSE 4F2 cell-surface antigen heavy chain OS=Mus musculus (Mouse) OX=10090 GN=Slc3a2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|P14429|HA17_MOUSE H-2 class I histocompatibility antigen, Q7 alpha chain OS=Mus musculus (Mouse) OX=10090 GN=H2-Q7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q9CQ60|6PGL_MOUSE 6-phosphogluconolactonase OS=Mus musculus (Mouse) OX=10090 GN=Pgls PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.07 15.0 1 1 1 PRT tr|E9Q007|E9Q007_MOUSE 3Beta_HSD domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm4450 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q99J39|DCMC_MOUSE Malonyl-CoA decarboxylase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Mlycd PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.07 15.0 2 2 2 PRT sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Eci2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P62960|YBOX1_MOUSE Y-box-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ybx1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.11 15.0 2 2 2 PRT sp|Q9CWZ7|SNAG_MOUSE Gamma-soluble NSF attachment protein OS=Mus musculus (Mouse) OX=10090 GN=Napg PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|Q9JLI6|SCLY_MOUSE Selenocysteine lyase OS=Mus musculus (Mouse) OX=10090 GN=Scly PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Bdh1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 115-UNIMOD:4 0.08 15.0 2 2 2 PRT sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 158-UNIMOD:4 0.09 15.0 2 2 2 PRT sp|O08997|ATOX1_MOUSE Copper transport protein ATOX1 OS=Mus musculus (Mouse) OX=10090 GN=Atox1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.21 15.0 2 1 0 PRT sp|Q08481|PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus (Mouse) OX=10090 GN=Pecam1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|P47754|CAZA2_MOUSE F-actin-capping protein subunit alpha-2 OS=Mus musculus (Mouse) OX=10090 GN=Capza2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 15.0 null 2-UNIMOD:1 0.10 15.0 2 2 2 PRT sp|Q8BJU2|TSN9_MOUSE Tetraspanin-9 OS=Mus musculus (Mouse) OX=10090 GN=Tspan9 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.11 15.0 2 2 2 PRT sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus (Mouse) OX=10090 GN=Cbr4 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.07 15.0 1 1 1 PRT sp|P62858|RS28_MOUSE 40S ribosomal protein S28 OS=Mus musculus (Mouse) OX=10090 GN=Rps28 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.25 15.0 1 1 1 PRT sp|Q9QXD1|ACOX2_MOUSE Peroxisomal acyl-coenzyme A oxidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Acox2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|P28665|MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus (Mouse) OX=10090 GN=Mug1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q9JM76|ARPC3_MOUSE Actin-related protein 2/3 complex subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Arpc3 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.07 15.0 1 1 1 PRT sp|O70362|PHLD_MOUSE Phosphatidylinositol-glycan-specific phospholipase D OS=Mus musculus (Mouse) OX=10090 GN=Gpld1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q8CC86|PNCB_MOUSE Nicotinate phosphoribosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Naprt PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|Q8BGS1|E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Epb41l5 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|P85094|ISC2A_MOUSE Isochorismatase domain-containing protein 2A OS=Mus musculus (Mouse) OX=10090 GN=Isoc2a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.09 15.0 2 1 0 PRT sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus (Mouse) OX=10090 GN=Cask PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|Q5F285|TM256_MOUSE Transmembrane protein 256 OS=Mus musculus (Mouse) OX=10090 GN=Tmem256 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.26 15.0 1 1 1 PRT sp|Q91WN4|KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus (Mouse) OX=10090 GN=Kmo PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q5XJY5|COPD_MOUSE Coatomer subunit delta OS=Mus musculus (Mouse) OX=10090 GN=Arcn1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus (Mouse) OX=10090 GN=Mgll PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 208-UNIMOD:4 0.05 15.0 1 1 1 PRT sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus (Mouse) OX=10090 GN=Txndc5 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|Q9WUM4|COR1C_MOUSE Coronin-1C OS=Mus musculus (Mouse) OX=10090 GN=Coro1c PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P42208|SEPT2_MOUSE Septin-2 OS=Mus musculus (Mouse) OX=10090 GN=Septin2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.05 15.0 1 1 1 PRT sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus (Mouse) OX=10090 GN=Psmb4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.14 15.0 2 2 2 PRT sp|Q9DCK3|TSN4_MOUSE Tetraspanin-4 OS=Mus musculus (Mouse) OX=10090 GN=Tspan4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.11 15.0 1 1 1 PRT sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Mctp2 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus (Mouse) OX=10090 GN=Acsl6 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus (Mouse) OX=10090 GN=Atp1a4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT tr|A0A0R4J090|A0A0R4J090_MOUSE Isoform of P11609, Antigen-presenting glycoprotein CD1d1 OS=Mus musculus (Mouse) OX=10090 GN=Cd1d1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 15.0 null 204-UNIMOD:28 0.06 15.0 1 1 1 PRT sp|P43006|EAA2_MOUSE Excitatory amino acid transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc1a2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus (Mouse) OX=10090 GN=Myl12b PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.13 15.0 2 2 2 PRT sp|P47962|RL5_MOUSE 60S ribosomal protein L5 OS=Mus musculus (Mouse) OX=10090 GN=Rpl5 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.05 15.0 1 1 1 PRT sp|Q9R1P0|PSA4_MOUSE Proteasome subunit alpha type-4 OS=Mus musculus (Mouse) OX=10090 GN=Psma4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.08 15.0 3 3 3 PRT sp|Q9R111|GUAD_MOUSE Guanine deaminase OS=Mus musculus (Mouse) OX=10090 GN=Gda PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.03 15.0 1 1 1 PRT sp|Q9JJF6|EFCC1_MOUSE EF-hand and coiled-coil domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Efcc1 PE=2 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 502-UNIMOD:35 0.02 15.0 1 1 1 PRT sp|Q8BMA5|NPAT_MOUSE Protein NPAT OS=Mus musculus (Mouse) OX=10090 GN=Npat PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|P49135|ERCC3_MOUSE General transcription and DNA repair factor IIH helicase subunit XPB OS=Mus musculus (Mouse) OX=10090 GN=Ercc3 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 277-UNIMOD:35 0.01 15.0 1 1 1 PRT sp|Q69Z23|DYH17_MOUSE Dynein heavy chain 17, axonemal OS=Mus musculus (Mouse) OX=10090 GN=Dnah17 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.00 15.0 1 1 1 PRT sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus (Mouse) OX=10090 GN=Vars1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q64514|TPP2_MOUSE Tripeptidyl-peptidase 2 OS=Mus musculus (Mouse) OX=10090 GN=Tpp2 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 2 2 2 PRT sp|Q9CZY3|UB2V1_MOUSE Ubiquitin-conjugating enzyme E2 variant 1 OS=Mus musculus (Mouse) OX=10090 GN=Ube2v1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.13 14.0 2 2 2 PRT sp|Q4PZA2|ECE1_MOUSE Endothelin-converting enzyme 1 OS=Mus musculus (Mouse) OX=10090 GN=Ece1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|E0CYC6|NAT8B_MOUSE Putative N-acetyltransferase 8B OS=Mus musculus (Mouse) OX=10090 GN=Nat8b-ps PE=5 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT sp|Q9Z0S1|BPNT1_MOUSE 3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus (Mouse) OX=10090 GN=Bpnt1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|P84091|AP2M1_MOUSE AP-2 complex subunit mu OS=Mus musculus (Mouse) OX=10090 GN=Ap2m1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus (Mouse) OX=10090 GN=Slc16a7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus (Mouse) OX=10090 GN=Dnaja2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 143-UNIMOD:4,146-UNIMOD:4 0.03 14.0 1 1 1 PRT sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus (Mouse) OX=10090 GN=Uba1y PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus (Mouse) OX=10090 GN=Psmb7 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT sp|P47911|RL6_MOUSE 60S ribosomal protein L6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl6 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 2 2 2 PRT tr|E9Q453|E9Q453_MOUSE Isoform of P58771, Tropomyosin alpha-1 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|P97823|LYPA1_MOUSE Acyl-protein thioesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Lypla1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 144-UNIMOD:4 0.12 14.0 2 2 2 PRT sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus (Mouse) OX=10090 GN=Slc16a10 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q6ZWN5|RS9_MOUSE 40S ribosomal protein S9 OS=Mus musculus (Mouse) OX=10090 GN=Rps9 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|Q9D172|GAL3A_MOUSE Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Gatd3a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|Q9QZ88|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 OS=Mus musculus (Mouse) OX=10090 GN=Vps29 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 36-UNIMOD:4,41-UNIMOD:4 0.13 14.0 2 2 2 PRT sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus (Mouse) OX=10090 GN=Sptbn1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.00 14.0 1 1 1 PRT sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hsdl2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|O35423|SPYA_MOUSE Serine--pyruvate aminotransferase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Agxt PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 275-UNIMOD:4 0.02 14.0 1 1 1 PRT sp|Q6ZWX6|IF2A_MOUSE Eukaryotic translation initiation factor 2 subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Eif2s1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT sp|Q7TMM9|TBB2A_MOUSE Tubulin beta-2A chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb2a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|Q925F2|ESAM_MOUSE Endothelial cell-selective adhesion molecule OS=Mus musculus (Mouse) OX=10090 GN=Esam PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT sp|P62301|RS13_MOUSE 40S ribosomal protein S13 OS=Mus musculus (Mouse) OX=10090 GN=Rps13 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus (Mouse) OX=10090 GN=Actn1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus (Mouse) OX=10090 GN=Actn3 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT tr|Q3UEP4|Q3UEP4_MOUSE UDP-glucuronosyltransferase OS=Mus musculus (Mouse) OX=10090 GN=Ugt2b36 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q99KR3|LACB2_MOUSE Endoribonuclease LACTB2 OS=Mus musculus (Mouse) OX=10090 GN=Lactb2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 2 2 2 PRT sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Nnt PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q3U2P1|SC24A_MOUSE Protein transport protein Sec24A OS=Mus musculus (Mouse) OX=10090 GN=Sec24a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q9JJF9|SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus (Mouse) OX=10090 GN=Sppl2a PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q9DCD0|6PGD_MOUSE 6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus (Mouse) OX=10090 GN=Pgd PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus (Mouse) OX=10090 GN=Abcd3 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 2 2 2 PRT sp|P67984|RL22_MOUSE 60S ribosomal protein L22 OS=Mus musculus (Mouse) OX=10090 GN=Rpl22 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.11 14.0 1 1 1 PRT sp|Q91X44|GCKR_MOUSE Glucokinase regulatory protein OS=Mus musculus (Mouse) OX=10090 GN=Gckr PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 562-UNIMOD:4 0.02 14.0 1 1 1 PRT sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Etfdh PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 117-UNIMOD:4 0.05 14.0 2 2 2 PRT sp|Q61035|HARS1_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus (Mouse) OX=10090 GN=Hars1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus (Mouse) OX=10090 GN=Tmed9 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|Q3UEG6|AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Agxt2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|O35316|SC6A6_MOUSE Sodium- and chloride-dependent taurine transporter OS=Mus musculus (Mouse) OX=10090 GN=Slc6a6 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 71-UNIMOD:4 0.01 14.0 1 1 1 PRT sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus (Mouse) OX=10090 GN=Rab9a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus (Mouse) OX=10090 GN=Ganab PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q78IK2|ATPMD_MOUSE ATP synthase membrane subunit DAPIT, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Atp5md PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.19 14.0 1 1 1 PRT sp|Q60597|ODO1_MOUSE 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Ogdh PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q8K157|GALM_MOUSE Aldose 1-epimerase OS=Mus musculus (Mouse) OX=10090 GN=Galm PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus (Mouse) OX=10090 GN=Rab2a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 1 1 1 PRT sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus (Mouse) OX=10090 GN=Cyp3a11 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ola1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus (Mouse) OX=10090 GN=Maob PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 26-UNIMOD:4 0.03 14.0 1 1 1 PRT sp|Q9Z2Y8|PLPHP_MOUSE Pyridoxal phosphate homeostasis protein OS=Mus musculus (Mouse) OX=10090 GN=Plpbp PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|P14115|RL27A_MOUSE 60S ribosomal protein L27a OS=Mus musculus (Mouse) OX=10090 GN=Rpl27a PE=1 SV=5 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 1 1 1 PRT sp|P70387|HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Hfe PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Echdc3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|P04939|MUP3_MOUSE Major urinary protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Mup3 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 1 1 1 PRT sp|O35593|PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus (Mouse) OX=10090 GN=Psmd14 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 2 1 0 PRT sp|Q99J99|THTM_MOUSE 3-mercaptopyruvate sulfurtransferase OS=Mus musculus (Mouse) OX=10090 GN=Mpst PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Snd1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 OS=Mus musculus (Mouse) OX=10090 GN=Gna13 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.09 14.0 2 2 2 PRT sp|Q9CWS0|DDAH1_MOUSE N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus (Mouse) OX=10090 GN=Ddah1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q9EQH3|VPS35_MOUSE Vacuolar protein sorting-associated protein 35 OS=Mus musculus (Mouse) OX=10090 GN=Vps35 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|P01872|IGHM_MOUSE Immunoglobulin heavy constant mu OS=Mus musculus (Mouse) OX=10090 GN=Ighm PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.04 14.0 1 1 1 PRT tr|A0A1B0GR60|A0A1B0GR60_MOUSE Isoform of P29391, Ferritin OS=Mus musculus (Mouse) OX=10090 GN=Ftl1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 104-UNIMOD:4 0.11 14.0 1 1 1 PRT tr|A0A1Y7VKY1|A0A1Y7VKY1_MOUSE Ribosomal protein S18, pseudogene 5 OS=Mus musculus (Mouse) OX=10090 GN=Rps18-ps5 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q9D8E6|RL4_MOUSE 60S ribosomal protein L4 OS=Mus musculus (Mouse) OX=10090 GN=Rpl4 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|Q61133|GSTT2_MOUSE Glutathione S-transferase theta-2 OS=Mus musculus (Mouse) OX=10090 GN=Gstt2 PE=1 SV=4 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus (Mouse) OX=10090 GN=Decr2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|Q8K0L2|ENTP8_MOUSE Ectonucleoside triphosphate diphosphohydrolase 8 OS=Mus musculus (Mouse) OX=10090 GN=Entpd8 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|P05214|TBA3_MOUSE Tubulin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba3a PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 347-UNIMOD:4 0.03 14.0 1 1 1 PRT sp|P63028|TCTP_MOUSE Translationally-controlled tumor protein OS=Mus musculus (Mouse) OX=10090 GN=Tpt1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.09 14.0 1 1 1 PRT sp|Q9JHJ3|GLMP_MOUSE Glycosylated lysosomal membrane protein OS=Mus musculus (Mouse) OX=10090 GN=Glmp PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 214-UNIMOD:4 0.05 14.0 1 1 1 PRT sp|Q8BWP5|TTPA_MOUSE Alpha-tocopherol transfer protein OS=Mus musculus (Mouse) OX=10090 GN=Ttpa PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q61147|CERU_MOUSE Ceruloplasmin OS=Mus musculus (Mouse) OX=10090 GN=Cp PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 199-UNIMOD:4 0.01 14.0 1 1 1 PRT sp|Q8CII2|CD123_MOUSE Cell division cycle protein 123 homolog OS=Mus musculus (Mouse) OX=10090 GN=Cdc123 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 2 1 0 PRT sp|Q8CGC4|LS14B_MOUSE Protein LSM14 homolog B OS=Mus musculus (Mouse) OX=10090 GN=Lsm14b PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|P48193|41_MOUSE Protein 4.1 OS=Mus musculus (Mouse) OX=10090 GN=Epb41 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 225-UNIMOD:4 0.02 14.0 1 1 1 PRT sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus (Mouse) OX=10090 GN=Ptprs PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus (Mouse) OX=10090 GN=Rab14 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.07 14.0 1 1 1 PRT sp|Q9CR51|VATG1_MOUSE V-type proton ATPase subunit G 1 OS=Mus musculus (Mouse) OX=10090 GN=Atp6v1g1 PE=1 SV=3 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 2-UNIMOD:1 0.14 14.0 1 1 1 PRT sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus (Mouse) OX=10090 GN=Hsd17b11 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT tr|A0A140LHQ9|A0A140LHQ9_MOUSE Isoform of Q70IV5, Synemin OS=Mus musculus (Mouse) OX=10090 GN=Synm PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 2-UNIMOD:1 0.01 14.0 1 1 1 PRT sp|Q923A2|SPDLY_MOUSE Protein Spindly OS=Mus musculus (Mouse) OX=10090 GN=Spdl1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 0.01 14.0 1 1 1 PRT tr|E9Q166|E9Q166_MOUSE Bromo domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Atad2b PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Adrbk2 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 154-UNIMOD:4 0.03 14.0 1 1 1 PRT sp|O09117|SYPL1_MOUSE Synaptophysin-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Sypl1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 0.03 14.0 1 1 1 PRT tr|A0A087WPC3|A0A087WPC3_MOUSE Cytochrome P450, family 4, subfamily a, polypeptide 29 OS=Mus musculus (Mouse) OX=10090 GN=Cyp4a29 PE=3 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 14.0 null 0.02 14.0 2 1 0 PRT sp|Q8K2Y0|OBI1_MOUSE ORC ubiquitin ligase 1 OS=Mus musculus (Mouse) OX=10090 GN=Obi1 PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 509-UNIMOD:4 0.01 14.0 2 1 0 PRT sp|Q9CR68|UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Uqcrfs1 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus (Mouse) OX=10090 GN=Cbr2 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 156-UNIMOD:35,158-UNIMOD:35 0.04 14.0 1 1 1 PRT sp|Q8VCH8|UBXN4_MOUSE UBX domain-containing protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Ubxn4 PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.02 14.0 1 1 1 PRT sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus (Mouse) OX=10090 GN=Slk PE=1 SV=2 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.01 14.0 1 1 1 PRT sp|Q8K211|COPT1_MOUSE High affinity copper uptake protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc31a1 PE=2 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.10 14.0 1 1 1 PRT sp|Q99LF4|RTCB_MOUSE RNA-splicing ligase RtcB homolog OS=Mus musculus (Mouse) OX=10090 GN=Rtcb PE=1 SV=1 null null userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 14.0 null 468-UNIMOD:35 0.03 14.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM KVADALANAAGHLDDLPGALSALSDLHAHK 1 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 58 ms_run[1]:scan=1.1.3307.2 58.69783 5 2990.582618 2990.557383 K L 62 92 PSM VADALANAAGHLDDLPGALSALSDLHAHK 2 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 53 ms_run[1]:scan=1.1.3379.2 60.72478 5 2862.490618 2862.462420 K L 63 92 PSM YFDSFGDLSSASAIMGNAK 3 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 48 ms_run[1]:scan=1.1.3453.19 62.75607 2 1979.899247 1979.893493 R V 42 61 PSM SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK 4 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 46 35-UNIMOD:4 ms_run[1]:scan=1.1.3429.7 62.07918 5 4082.093618 4082.063025 R V 49 90 PSM KVITAFNDGLNHLDSLK 5 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=1.1.2712.12 41.81738 3 1884.024071 1884.010512 K G 67 84 PSM IADQCPSSLAIQENANALAR 6 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 5-UNIMOD:4 ms_run[1]:scan=1.1.2817.12 44.79638 3 2141.058671 2141.053516 R Y 154 174 PSM FLHDPSATQGFVGCALSSNIQR 7 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 14-UNIMOD:4 ms_run[1]:scan=1.1.2940.13 48.31815 3 2404.164671 2404.159378 R F 255 277 PSM QIHNFISTSTFSQYTVVDDIAVAK 8 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=1.1.3323.21 59.15422 3 2683.361771 2683.349347 K I 137 161 PSM VADALANAAGHLDDLPGALSALSDLHAHK 9 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=1.1.3386.2 60.91185 5 2862.490618 2862.462420 K L 63 92 PSM QFLLAAEAIDDIPFGITSNSGVFSK 10 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=1.1.3794.4 72.44421 3 2639.362271 2639.348284 K Y 173 198 PSM AMGAAQVVVTDLSASR 11 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.2945.15 48.45313 2 1574.807047 1574.808641 K L 194 210 PSM ALPGHLKPFETLLSQNQGGK 12 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.2786.11 43.93798 3 2134.160771 2134.153488 K A 122 142 PSM QVADEGDALVAGGVSQTPSYLSCK 13 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 23-UNIMOD:4 ms_run[1]:scan=1.1.2995.17 49.85406 3 2451.166271 2451.158769 R S 109 133 PSM KVADALANAAGHLDDLPGALSALSDLHAHK 14 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.3300.3 58.50717 5 2990.582618 2990.557383 K L 62 92 PSM MSINAEDVVVGDLVEVK 15 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.3426.4 61.99843 2 1815.928847 1815.928816 K G 178 195 PSM NVQQLAILGAGLMGAGIAQVSVDK 16 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.3769.3 71.74387 3 2352.292271 2352.283516 K G 360 384 PSM VIHDNFGIVEGLMTTVHAITATQK 17 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=1.1.3671.9 68.96201 4 2594.368494 2594.352658 K T 161 185 PSM VCLIGCGFSTGYGSAVK 18 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43 2-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2966.20 49.03417 2 1774.841047 1774.838227 K V 170 187 PSM GVGIISEGNETVEDIAAR 19 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43 ms_run[1]:scan=1.1.2989.20 49.68697 2 1828.919847 1828.916671 K L 620 638 PSM YFDSFGDLSSASAIMGNAK 20 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43 15-UNIMOD:35 ms_run[1]:scan=1.1.3148.21 54.24502 2 1995.891247 1995.888408 R V 42 61 PSM TGLLSGLDIMEVNPTLGK 21 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43 10-UNIMOD:35 ms_run[1]:scan=1.1.3422.7 61.9138 2 1872.987447 1872.986666 K T 267 285 PSM DVGILALEVYFPAQYVDQTDLEK 22 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 43 ms_run[1]:scan=1.1.3845.5 73.84013 3 2625.333671 2625.321401 K F 53 76 PSM CGESPVWEEASQSLLFVDIPSK 23 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 43 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3876.7 74.67498 3 2460.1652 2460.1512 R I 16 38 PSM KYTPEQVAMATVTALHR 24 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=1.1.2863.10 46.10402 3 1915.008371 1914.998567 K T 243 260 PSM TIYISGQVGLDPSSGQLVPGGVVEEAK 25 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=1.1.3383.5 60.8397 3 2699.407871 2699.401777 R Q 30 57 PSM IGVAIGDQILDLSVIK 26 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=1.1.3695.6 69.65577 2 1652.974447 1652.971273 R H 32 48 PSM SGETEDTFIADLVVGLCTGQIK 27 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 42 17-UNIMOD:4 ms_run[1]:scan=1.1.3814.4 72.98573 3 2352.166571 2352.151893 R T 373 395 PSM TYFPHFDVSHGSAQVK 28 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=1.1.2516.11 36.26193 3 1818.879371 1818.868933 K G 42 58 PSM APAAIGPYSQAVQVDR 29 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=1.1.2628.21 39.42568 2 1641.849247 1641.847470 K T 14 30 PSM NTGTEAPDYLATVDVDPK 30 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=1.1.2926.21 47.92764 2 1904.902247 1904.900353 R S 35 53 PSM FEDGDLTLYQSNAILR 31 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=1.1.3237.14 56.74207 2 1853.920847 1853.915943 K H 56 72 PSM IVSNASCTTNCLAPLAK 32 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 7-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.2527.17 36.56303 2 1818.894447 1818.896805 K V 144 161 PSM APAAIGPYSQAVQVDR 33 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.2634.20 39.59877 2 1641.849247 1641.847470 K T 14 30 PSM KVITAFNDGLNHLDSLK 34 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.2719.16 42.01498 3 1884.024071 1884.010512 K G 67 84 PSM VLGTSVESIMATEDR 35 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.2942.9 48.37118 2 1606.784647 1606.787237 K Q 533 548 PSM SYELPDGQVITIGNER 36 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.3137.21 53.925 2 1789.884847 1789.884643 K F 239 255 PSM VLVCGAGPVGMVTLLVAK 37 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 4-UNIMOD:4 ms_run[1]:scan=1.1.3656.17 68.53239 2 1783.012247 1783.009984 K A 176 194 PSM LNAGEVVIGDGGFVFALEK 38 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.3667.21 68.85674 2 1934.017847 1934.014929 R R 17 36 PSM EVAAFAQFGSDLDAATQQLLSR 39 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=1.1.3775.11 71.90853 3 2337.170471 2337.160090 R G 442 464 PSM CGESPVWEEASQSLLFVDIPSK 40 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 40 1-UNIMOD:4 ms_run[1]:scan=1.1.3738.11 70.87825 3 2477.187671 2477.178442 R I 16 38 PSM QVADEGDALVAGGVSQTPSYLSCK 41 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:28,23-UNIMOD:4 ms_run[1]:scan=1.1.3392.3 61.06727 3 2434.1354 2434.1317 R S 109 133 PSM EEEIAALVIDNGSGMCK 42 sp|P63260|ACTG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 40 1-UNIMOD:1,16-UNIMOD:4 ms_run[1]:scan=1.1.3769.5 71.7522 2 1876.8652 1876.8542 M A 2 19 PSM VDNSSLTGESEPQTR 43 sp|Q64436|ATP4A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.2060.20 23.46723 2 1618.745247 1618.743458 K S 222 237 PSM AAATEDATPAALEK 44 sp|O08705|NTCP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.2151.19 26.04322 2 1357.674447 1357.672525 K G 323 337 PSM ANEELAGVVAEVQK 45 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.2775.15 43.62442 2 1455.760047 1455.756923 K N 76 90 PSM AGASIVGVNCHFDPSVSLQTVK 46 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 10-UNIMOD:4 ms_run[1]:scan=1.1.2954.18 48.69827 3 2285.153771 2285.147417 K L 208 230 PSM IEFEGQSVDFVDPNK 47 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3100.20 52.8499 2 1722.811447 1722.810081 K Q 183 198 PSM GNDQVRFELTCYSLAPQIK 48 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 11-UNIMOD:4 ms_run[1]:scan=1.1.3098.10 52.78333 3 2238.118571 2238.110303 K V 122 141 PSM FGANAILGVSLAVCK 49 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 14-UNIMOD:4 ms_run[1]:scan=1.1.3306.5 58.67753 2 1518.818647 1518.822835 K A 106 121 PSM HEIIQTLQMTDGLIPLEIR 50 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 9-UNIMOD:35 ms_run[1]:scan=1.1.3385.7 60.89592 3 2235.200771 2235.193304 R F 236 255 PSM YALNHPDTVEGLVLINIDPNAK 51 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3380.6 60.76335 3 2405.268371 2405.259075 R G 155 177 PSM TFHETLNCCGSNALTTLTTTILR 52 sp|P35762|CD81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.3376.15 60.6524 3 2623.280471 2623.273422 K N 149 172 PSM GQNNPQVCPYNLYAEQLSGSAFTCPR 53 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 8-UNIMOD:4,24-UNIMOD:4 ms_run[1]:scan=1.1.3309.4 58.76498 3 2970.352871 2970.338876 K N 28 54 PSM LTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTK 54 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3394.5 61.11457 4 3405.853294 3405.840875 K A 242 275 PSM YFDSFGDLSSASAIMGNAK 55 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3460.21 62.94568 2 1979.899247 1979.893493 R V 42 61 PSM HEIIQTLQMTDGLIPLEIR 56 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3552.10 65.58317 3 2219.205671 2219.198389 R F 236 255 PSM AERPDGLILGMGGQTALNCGVELFK 57 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 19-UNIMOD:4 ms_run[1]:scan=1.1.3500.11 64.10345 3 2645.337071 2645.330543 K R 498 523 PSM TTSLELFMYLNEVAGK 58 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3731.18 70.68055 2 1814.917847 1814.912438 R H 245 261 PSM TGLLSGLDIMEVNPTLGK 59 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3672.20 68.99924 2 1856.995047 1856.991751 K T 267 285 PSM TGLTTLAQAVQAGYEVTVLVR 60 sp|Q923D2|BLVRB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3769.2 71.73969 3 2189.211371 2189.205583 R D 15 36 PSM EFVEEFIWPAVQSSALYEDR 61 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=1.1.3767.8 71.69366 3 2414.156471 2414.143043 K Y 67 87 PSM AHCLSEVEHDTMPADLPAIAADFVEDQEVCK 62 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 39 3-UNIMOD:4,12-UNIMOD:35,30-UNIMOD:4 ms_run[1]:scan=1.1.3390.5 61.0136 4 3513.569294 3512.553422 K N 311 342 PSM ILGADTSVDLEETGR 63 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2755.21 43.04778 2 1574.780447 1574.778781 R V 59 74 PSM VAPEEHPVLLTEAPLNPK 64 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2714.15 41.87522 3 1953.071471 1953.057128 R A 96 114 PSM VAPEEHPVLLTEAPLNPK 65 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2708.15 41.70813 3 1953.071471 1953.057128 R A 96 114 PSM VSVVLGGDHSLAVGSISGHAR 66 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2564.2 37.59423 4 2017.078494 2017.070487 R V 93 114 PSM KYTPEQVAMATVTALHR 67 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2857.12 45.93315 3 1915.008371 1914.998567 K T 243 260 PSM LGGSAVISLEGKPL 68 sp|P18760|COF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2941.7 48.34167 2 1339.771047 1339.771117 K - 153 167 PSM LGTLEVEDQIEAAR 69 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2858.21 45.96907 2 1542.790047 1542.788952 R Q 592 606 PSM NLEAVETLGSTSTICSDK 70 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 15-UNIMOD:4 ms_run[1]:scan=1.1.2811.16 44.63817 2 1923.912847 1923.909537 K T 350 368 PSM SLGVAAEGLPDQYADGEAAR 71 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.2838.21 45.39058 2 1988.944647 1988.943949 R V 10 30 PSM AERPDGLILGMGGQTALNCGVELFKR 72 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 38 19-UNIMOD:4 ms_run[1]:scan=1.1.3310.5 58.78437 4 2801.4472 2801.4312 K G 498 524 PSM DGSIDLVINLPNNNTK 73 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.3247.16 57.01798 2 1725.892247 1725.889728 R F 1429 1445 PSM VETGVLKPGMVVTFAPVNVTTEVK 74 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.3248.11 57.04087 3 2514.386471 2514.376748 R S 267 291 PSM VADALANAAGHLDDLPGALSALSDLHAHK 75 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.3394.2 61.10705 5 2862.490618 2862.462420 K L 63 92 PSM DLADELALVDVMEDK 76 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.3767.9 71.69534 2 1674.807047 1674.802218 K L 43 58 PSM ACGANLPENFSISQIFSQAMAAR 77 sp|P34914|HYES_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 2-UNIMOD:4 ms_run[1]:scan=1.1.3743.7 71.00928 3 2482.176371 2482.173314 K S 77 100 PSM VIHDNFGIVEGLMTTVHAITATQK 78 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=1.1.3677.6 69.12614 4 2594.368494 2594.352658 K T 161 185 PSM GAAQNIIPASTGAAK 79 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.2256.19 28.99018 2 1368.736247 1368.736128 R A 199 214 PSM AADKDTCFSTEGPNLVTR 80 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 7-UNIMOD:4 ms_run[1]:scan=1.1.2437.17 34.02477 3 1980.928871 1980.921105 K C 585 603 PSM ECCHGDLLECADDRAELAK 81 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2395.20 32.8705 3 2260.960271 2260.951102 K Y 268 287 PSM VIVVGNPANTNCLTASK 82 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 12-UNIMOD:4 ms_run[1]:scan=1.1.2596.21 38.49895 2 1756.917047 1756.914169 K S 126 143 PSM QGAIVAVTGDGVNDSPALK 83 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.2719.21 42.01915 2 1810.945247 1810.942492 R K 698 717 PSM ANATEFGLASGVFTR 84 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3087.14 52.4655 2 1539.765447 1539.768157 R D 827 842 PSM AGSNVMQTFTFYASEDKLENR 85 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3135.19 53.86567 3 2407.116971 2407.111425 R G 66 87 PSM FEDGDLTLYQSNAILR 86 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3250.8 57.10312 2 1853.916847 1853.915943 K H 56 72 PSM KFPLDPLITHVLPFEK 87 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3374.5 60.58678 3 1893.090971 1893.076407 K I 340 356 PSM RLPTLEQPIIPSDYVAIK 88 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3175.6 54.98553 3 2052.167771 2052.161928 K A 1292 1310 PSM SVHITFSSFENVEGLPAFR 89 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3378.4 60.70115 3 2136.071171 2136.064004 R Y 276 295 PSM TFHETLNCCGSNALTTLTTTILR 90 sp|P35762|CD81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.3383.3 60.8347 3 2623.280471 2623.273422 K N 149 172 PSM VAVLGASGGIGQPLSLLLK 91 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3692.16 69.57491 2 1792.077647 1792.082221 K N 27 46 PSM VAVLGASGGIGQPLSLLLK 92 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3691.16 69.54583 2 1792.077647 1792.082221 K N 27 46 PSM TTSLELFMYLNEVAGK 93 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3737.6 70.8497 2 1814.917847 1814.912438 R H 245 261 PSM LFLEQIHVLENSLVLK 94 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=1.1.3644.4 68.20502 2 1894.097047 1894.092785 R F 59 75 PSM SQLVECVPNFSEGNNQEVIDAISR 95 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 37 1-UNIMOD:1,6-UNIMOD:4 ms_run[1]:scan=1.1.3736.5 70.82613 3 2746.2982 2746.2862 M A 2 26 PSM VNADEVGGEALGR 96 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2301.10 30.24273 2 1285.626047 1285.626243 K L 19 32 PSM VNADEVGGEALGR 97 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2308.6 30.43452 2 1285.626047 1285.626243 K L 19 32 PSM VFANPEDCAGFGKGENAK 98 sp|Q91VS7|MGST1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 8-UNIMOD:4 ms_run[1]:scan=1.1.2306.11 30.37895 3 1909.871471 1909.862862 K K 43 61 PSM ASAELALGENNEVLK 99 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2692.21 41.25262 2 1556.807047 1556.804602 K S 108 123 PSM KADIGVAMGIVGSDVSK 100 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2740.7 42.60223 3 1645.880171 1645.870907 K Q 727 744 PSM VDATEESDLAQQYGVR 101 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2742.21 42.6714 2 1779.830247 1779.827522 K G 84 100 PSM ALQASALAAWGGK 102 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2800.11 44.32012 2 1242.672847 1242.672071 R A 305 318 PSM FAVLQTYGDTTHTLVEK 103 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.2783.14 43.8544 3 1921.987871 1921.978543 K I 133 150 PSM NLEAVETLGSTSTICSDK 104 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 15-UNIMOD:4 ms_run[1]:scan=1.1.2805.21 44.46802 2 1923.912847 1923.909537 K T 350 368 PSM GPAVGIDLGTTYSCVGVFQHGK 105 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 14-UNIMOD:4 ms_run[1]:scan=1.1.3069.13 51.94567 3 2262.116471 2262.110303 K V 4 26 PSM VYVDIGSVNTDDLTITPTDTR 106 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3309.3 58.75915 3 2294.139971 2294.127787 R W 220 241 PSM VLLLDEATSALDTESEK 107 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3321.19 59.09495 2 1832.934247 1832.925505 R V 1192 1209 PSM AAVLWELHKPFTIEDIEVAPPK 108 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3312.5 58.83255 4 2502.366094 2502.352248 K A 12 34 PSM VHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLK 109 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 6-UNIMOD:4 ms_run[1]:scan=1.1.3507.8 64.28788 5 4081.100618 4081.073137 R E 114 151 PSM DAFQNAYLELGGLGER 110 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3531.21 64.98122 2 1751.851447 1751.847863 K V 536 552 PSM NLQDINTLEVAGDIQLTHVQT 111 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3452.7 62.71708 3 2321.196371 2321.186304 K - 333 354 PSM SDDHVVSGTLVTPLPAVLGHEGAGIVESVGEGVTCVKPGDK 112 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 35-UNIMOD:4 ms_run[1]:scan=1.1.3436.17 62.27325 5 4082.093618 4082.063025 R V 49 90 PSM LGANSLLDLVVFGR 113 sp|Q8K2B3|SDHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3771.6 71.80247 2 1472.836847 1472.835114 R A 452 466 PSM SETSGSFEDALLAIVK 114 sp|P97429|ANXA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3701.6 69.81692 2 1665.850847 1665.846132 K C 226 242 PSM TTSLELFMYLNEVAGK 115 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 8-UNIMOD:35 ms_run[1]:scan=1.1.3699.5 69.76407 2 1830.911047 1830.907353 R H 245 261 PSM TVMDDFAQFLDTCCK 116 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 13-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3696.8 69.69019 2 1849.773647 1849.768493 K A 570 585 PSM ALMLQGVDLLADAVAVTMGPK 117 sp|P63038|CH60_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3864.10 74.34763 3 2112.134471 2112.132284 R G 38 59 PSM STAISLFYELSENDLNFIK 118 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3799.3 72.56823 3 2203.109171 2203.104866 K Q 72 91 PSM YFDSFGDLSSASAIMGNAK 119 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=1.1.3503.5 64.18552 2 1980.882447 1979.893493 R V 42 61 PSM TDEDKNPVTNPTTQEK 120 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.1865.19 17.97252 3 1815.854771 1815.848651 K Q 296 312 PSM EAAQMDMVNDGVEDLRGK 121 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.2704.16 41.59488 3 1976.907371 1976.893176 R Y 86 104 PSM LPMGMTAENLAAK 122 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.2676.8 40.8062 2 1345.673647 1345.673393 K Y 159 172 PSM APNSPDVLEIEFKK 123 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.2723.8 42.12267 3 1585.839671 1585.835174 K G 216 230 PSM KYTPEQVAMATVTALHR 124 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.2869.10 46.27828 3 1915.008371 1914.998567 K T 243 260 PSM ELGEYGLQAYTEVK 125 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.2940.12 48.31648 2 1598.786847 1598.782804 R T 495 509 PSM RPCFSALTVDETYVPK 126 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 3-UNIMOD:4 ms_run[1]:scan=1.1.2801.15 44.35147 3 1881.936071 1881.929485 R E 509 525 PSM LSQTFPNADFAEITK 127 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3054.10 51.53428 2 1680.836247 1680.835902 R L 243 258 PSM TSACFEPSLDYMVTK 128 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 4-UNIMOD:4 ms_run[1]:scan=1.1.3051.7 51.45042 2 1747.778047 1747.779709 K I 758 773 PSM YFDSFGDLSSASAIMGNAK 129 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 15-UNIMOD:35 ms_run[1]:scan=1.1.3154.16 54.41195 2 1995.891247 1995.888408 R V 42 61 PSM GGSVQVLEDQELTCQPEPLVVK 130 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 14-UNIMOD:4 ms_run[1]:scan=1.1.3138.18 53.95132 3 2424.227471 2424.220641 R G 358 380 PSM KRPIHLSFDVDGLDPAFTPATGTPVLGGLSYR 131 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 35 ms_run[1]:scan=1.1.3348.5 59.84103 5 3396.8082 3396.7822 K E 224 256 PSM PFTIEDIEVAPPK 132 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3178.3 55.06603 2 1454.763447 1454.765697 K A 21 34 PSM GVALPETIEEAENLGR 133 sp|O08966|S22A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3224.15 56.37707 2 1696.864847 1696.863179 K R 519 535 PSM GFGTDEQAIVDVVSNR 134 sp|Q07076|ANXA7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3178.6 55.07605 2 1705.827847 1705.827128 K S 175 191 PSM KFPLDPLITHVLPFEK 135 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3368.5 60.41533 3 1893.090971 1893.076407 K I 340 356 PSM AGEYSVTYDGFNTFTIPK 136 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3331.21 59.38535 2 2008.945447 2008.941824 K T 96 114 PSM GKFPDVPGFSWVTPCISAK 137 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 15-UNIMOD:4 ms_run[1]:scan=1.1.3380.4 60.75751 3 2092.052171 2092.045183 K D 154 173 PSM DHGDLAFVDVPNDSSFQIVK 138 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3324.11 59.17477 3 2202.069971 2202.059313 R N 49 69 PSM AAVLWELHKPFTIEDIEVAPPK 139 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3305.5 58.64985 3 2502.357371 2502.352248 K A 12 34 PSM GSASSALELTEEELATAEAVR 140 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3504.6 64.20396 3 2133.050171 2133.043722 K S 308 329 PSM VEPGSTCAVFGLGGVGLAVIMGCK 141 sp|P28474|ADHX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 7-UNIMOD:4,23-UNIMOD:4 ms_run[1]:scan=1.1.3768.8 71.71712 3 2378.193071 2378.179645 K V 189 213 PSM FGDMQEIIQNFVR 142 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3716.11 70.2342 2 1595.780447 1595.776613 R V 85 98 PSM AFAISGPFNVQFLVK 143 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3693.16 69.60367 2 1636.901047 1636.897714 K G 1233 1248 PSM VNPTVFFDITADDEPLGR 144 sp|P17742|PPIA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 35 ms_run[1]:scan=1.1.3639.9 68.07125 2 2004.9781 2004.9787 M V 2 20 PSM DGPLNMILDDGGDLTNLIHTK 145 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3733.16 70.73756 3 2251.127771 2251.115448 K Y 122 143 PSM TIVAINKDPEAPIFQVADYGIVADLFK 146 sp|Q99LC5|ETFA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=1.1.3771.7 71.8058 3 2946.581771 2946.574262 K V 295 322 PSM ADQLTEEQIAEFK 147 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 35 1-UNIMOD:1 ms_run[1]:scan=1.1.3315.12 58.92002 2 1562.7453 1562.7459 M E 2 15 PSM AEEGIAAGGVMDVNTALQEVLK 148 tr|F7AEH4|F7AEH4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 35 1-UNIMOD:1 ms_run[1]:scan=1.1.3856.7 74.1368 3 2256.1442 2256.1302 M T 2 24 PSM TCVADESAANCDK 149 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.1786.21 15.72818 2 1439.564647 1439.565694 K S 76 89 PSM IGGHGAEYGAEALER 150 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2176.5 26.72723 3 1528.729571 1528.727020 K M 18 33 PSM KSQVFSTAADGQTQVEIK 151 sp|P38647|GRP75_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2331.7 31.07735 3 1935.999671 1935.990171 K V 468 486 PSM VAPLGAELQESAR 152 sp|Q00623|APOA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2497.19 35.7339 2 1339.712447 1339.709579 K Q 142 155 PSM LGGEVSCLVAGTK 153 sp|Q99LC5|ETFA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 7-UNIMOD:4 ms_run[1]:scan=1.1.2565.10 37.62808 2 1289.665247 1289.664937 R C 47 60 PSM ETTIQGLDGLSER 154 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2706.17 41.65318 2 1417.706447 1417.704888 K C 122 135 PSM DGFNPAHVEAGLYGSR 155 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2748.10 42.83598 3 1688.798171 1688.790683 K I 212 228 PSM SHAEDLGNLEGVKPAVLTR 156 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2579.9 38.02362 3 2005.065971 2005.059253 R S 176 195 PSM SHAEDLGNLEGVKPAVLTR 157 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2586.16 38.21193 3 2005.065971 2005.059253 R S 176 195 PSM SIMISGNVLPDATR 158 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2924.18 47.86762 2 1472.766447 1472.765714 K F 238 252 PSM NIAFFSTNCVEGTAR 159 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 9-UNIMOD:4 ms_run[1]:scan=1.1.2934.18 48.15535 2 1685.783847 1685.783155 R G 241 256 PSM IHGQTIPSDGDIFTYTR 160 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.2767.15 43.3918 3 1919.949371 1919.937741 K R 140 157 PSM LGEYGFQNAILVR 161 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3112.11 53.19387 2 1478.788847 1478.788164 K Y 422 435 PSM VALQHNLGLGGAVVVTLYR 162 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3127.9 53.62455 3 1979.136671 1979.131630 K M 386 405 PSM GGSVQVLEDQELTCQPEPLVVK 163 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 14-UNIMOD:4 ms_run[1]:scan=1.1.3136.16 53.89207 3 2424.227471 2424.220641 R G 358 380 PSM HQHVFDETTLNNFMGLGQAAWK 164 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3306.4 58.67503 4 2543.212894 2543.201577 K E 58 80 PSM LNAGEVVIGDGGFVFALEKR 165 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3403.11 61.36583 3 2090.124071 2090.116040 R G 17 37 PSM TPAGLQVLNDYLADK 166 sp|O70251|EF1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3339.6 59.60482 2 1616.842047 1616.840987 K S 8 23 PSM VFANAYLSDLGGCIK 167 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 13-UNIMOD:4 ms_run[1]:scan=1.1.3196.14 55.56698 2 1626.809847 1626.807579 K A 114 129 PSM IGIELTDSPYVVASMR 168 sp|Q9Z2V4|PCKGC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3340.5 59.63346 2 1749.895847 1749.897122 K I 156 172 PSM FEDGDLTLYQSNAILR 169 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3244.20 56.9358 2 1853.920847 1853.915943 K H 56 72 PSM FVVNFQNSFNGNDIAFHFNPR 170 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3426.3 61.9951 3 2483.191571 2483.177077 R F 44 65 PSM TAVDSGIALLTNFQVTK 171 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3553.10 65.61237 3 1776.972671 1776.962165 R L 1455 1472 PSM LGLDFPNLPYLIDGSHK 172 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3593.5 66.72887 3 1898.004971 1897.993799 K I 53 70 PSM YFDSFGDLSSASAIMGNAK 173 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3447.20 62.5843 2 1979.899247 1979.893493 R V 42 61 PSM TGLLSGLDIMEVNPTLGK 174 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3670.18 68.94109 2 1856.995047 1856.991751 K T 267 285 PSM LMITGAAPVSATVLTFLR 175 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3742.6 70.98245 2 1860.057047 1860.054291 R T 431 449 PSM INALTAASEAACLIVSVDETIK 176 sp|P80313|TCPH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 12-UNIMOD:4 ms_run[1]:scan=1.1.3834.8 73.53703 3 2288.208071 2288.193364 R N 500 522 PSM EFVEEFIWPAVQSSALYEDR 177 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=1.1.3761.16 71.5254 3 2414.156471 2414.143043 K Y 67 87 PSM DWSFYILAHTEFTPTETDTYACR 178 sp|P01887|B2MG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 34 22-UNIMOD:4 ms_run[1]:scan=1.1.3695.9 69.66328 3 2823.262271 2823.248647 K V 79 102 PSM LDQGGAPLAGTNK 179 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2004.21 21.89075 2 1240.642247 1240.641165 K E 109 122 PSM GAAQNIIPASTGAAK 180 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2250.20 28.82098 2 1368.736247 1368.736128 R A 199 214 PSM IGGHGAEYGAEALER 181 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2183.9 26.91547 3 1528.729571 1528.727020 K M 18 33 PSM IAQLEEQLDNETK 182 sp|Q8VDD5|MYH9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2508.7 36.0488 2 1529.768247 1529.757317 K E 1816 1829 PSM KYTPEQVAMATVTALHR 183 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 9-UNIMOD:35 ms_run[1]:scan=1.1.2663.14 40.4336 3 1931.000471 1930.993482 K T 243 260 PSM GILAADESVGTMGNR 184 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2595.20 38.46915 2 1489.719047 1489.719492 K L 29 44 PSM EAAQMDMVNDGVEDLRGK 185 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2710.18 41.76678 3 1976.907371 1976.893176 R Y 86 104 PSM KYTPEQVAMATVTALHR 186 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2851.13 45.76207 3 1915.008371 1914.998567 K T 243 260 PSM AFAMTNQILVER 187 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2893.16 46.97715 2 1391.722447 1391.723121 K S 613 625 PSM PFVELETNLPASR 188 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 33 ms_run[1]:scan=1.1.2936.8 48.20708 2 1471.7658 1471.7666 M I 2 15 PSM IPPDSETTLVLVGR 189 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2943.8 48.39577 2 1495.819447 1495.824609 K A 233 247 PSM ALENNMSLDEIVR 190 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2959.16 48.83648 2 1502.741247 1502.739893 K L 857 870 PSM LGTLEVEDQIEAAR 191 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2852.19 45.79648 2 1542.790047 1542.788952 R Q 592 606 PSM SAYALGGLGSGICPNK 192 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 13-UNIMOD:4 ms_run[1]:scan=1.1.2781.20 43.80152 2 1563.772447 1563.771528 R E 588 604 PSM EVFTEQADLSGITEAK 193 tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2910.21 47.46832 2 1736.848047 1736.846860 K K 335 351 PSM MTDSFTEQADQVTADVGK 194 sp|Q8BVI4|DHPR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2854.21 45.85595 2 1941.864647 1941.862587 K L 53 71 PSM TGLSIHEVYGQSETGISSATLR 195 sp|Q91VA0|ACSM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2789.12 44.02413 3 2305.151471 2305.155004 R E 355 377 PSM FLHDPSATQGFVGCALSSNIQR 196 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 14-UNIMOD:4 ms_run[1]:scan=1.1.2947.13 48.50877 3 2404.164671 2404.159378 R F 255 277 PSM VVRNEFTLGEECELETMTGEK 197 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 12-UNIMOD:4 ms_run[1]:scan=1.1.2959.18 48.83815 3 2470.140671 2470.135591 K V 58 79 PSM VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK 198 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.2893.20 46.98048 5 3740.894618 3740.867954 R V 1187 1223 PSM LTGQIFLGGSIVR 199 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3078.14 52.20527 2 1359.788847 1359.787435 R G 345 358 PSM DTIALCTAESIDNLR 200 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 6-UNIMOD:4 ms_run[1]:scan=1.1.3147.19 54.21412 2 1690.820447 1690.819600 R A 192 207 PSM GIHVEIPGAQAESLGPLQVAR 201 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3096.15 52.72918 3 2141.163071 2141.159302 R V 86 107 PSM TLGVDFIDVATK 202 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3198.6 55.61777 2 1277.687047 1277.686718 K V 1270 1282 PSM VVDLMAYMASKE 203 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3206.8 55.84512 2 1355.648847 1355.646510 R - 322 334 PSM LFQTNTELLELTTK 204 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3217.19 56.17563 2 1649.889247 1649.887603 R T 690 704 PSM VALVTASTDGIGFAIAR 205 sp|Q99LB2|DHRS4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3287.18 58.14903 2 1660.908047 1660.914821 K R 35 52 PSM LLYDLADQLHAAVGASR 206 sp|Q99LC5|ETFA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3202.6 55.72997 3 1811.960471 1811.952997 K A 233 250 PSM KFPLDPLITHVLPFEK 207 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3380.3 60.755 3 1893.090971 1893.076407 K I 340 356 PSM VAGLLVLNYSNDYNHWLATK 208 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3400.11 61.28 3 2290.183871 2290.174617 K S 128 148 PSM APVVMGSSEDVQEFLEIYRK 209 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3364.14 60.3079 3 2296.149671 2296.140934 K H 315 335 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 210 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3262.14 57.42202 4 3182.625294 3182.607035 R L 148 178 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 211 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 8-UNIMOD:4 ms_run[1]:scan=1.1.3251.8 57.12752 5 3609.842618 3609.815071 R S 178 213 PSM ALQLGTLFSPAEALK 212 sp|P42125|ECI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3498.7 64.04475 2 1557.877447 1557.876644 R V 192 207 PSM ALPFWNEEIVPQIK 213 sp|Q9DBJ1|PGAM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3568.4 66.05168 2 1682.906647 1682.903193 R E 163 177 PSM VLILGSGGLSIGQAGEFDYSGSQAVK 214 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3481.20 63.5559 3 2552.319971 2552.312233 K A 425 451 PSM GFFVQPTVFSNVTDEMR 215 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3540.20 65.2395 2 1972.942447 1972.935298 K I 379 396 PSM LSDGHFIPILGFGTYAPQEVPK 216 sp|P70694|DHB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3443.13 62.46463 3 2385.243371 2385.236883 R S 10 32 PSM VLILGSGGLSIGQAGEFDYSGSQAVK 217 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3483.19 63.61378 3 2552.319971 2552.312233 K A 425 451 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 218 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 16-UNIMOD:4 ms_run[1]:scan=1.1.3429.11 62.08587 3 2994.401471 2994.392551 K F 396 424 PSM GLVLIAFSQYLQK 219 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3643.4 68.1716 2 1478.853047 1478.849701 K C 45 58 PSM VLELYLDLLSQPCR 220 sp|Q64471|GSTT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 33 13-UNIMOD:4 ms_run[1]:scan=1.1.3702.10 69.8463 2 1717.9128 1717.9068 M A 2 16 PSM GLLPEELTPLILETQK 221 sp|Q99LC5|ETFA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3703.6 69.87483 2 1793.024047 1793.018617 K Q 86 102 PSM WLRDQIGIVEQEPVLFSTTIAENIR 222 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=1.1.3691.21 69.55002 3 2926.562171 2926.555258 R L 493 518 PSM QADAVYFLPITPQFVTEVIK 223 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 33 1-UNIMOD:28 ms_run[1]:scan=1.1.3945.7 76.52554 3 2261.2102 2261.1982 K A 478 498 PSM QVADEGDALVAGGVSQTPSYLSCK 224 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 33 1-UNIMOD:28,23-UNIMOD:4 ms_run[1]:scan=1.1.3399.17 61.25658 3 2434.1354 2434.1317 R S 109 133 PSM AELQEVQITEEKPLLPGQTPETAK 225 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 33 1-UNIMOD:1 ms_run[1]:scan=1.1.3257.13 57.2878 3 2690.4082 2690.4009 M E 2 26 PSM KHHLDGETEEER 226 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.1551.13 9.172566 3 1478.676071 1478.674984 R I 83 95 PSM NTQINNSWGQEER 227 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2192.20 27.17427 2 1574.706647 1574.707347 R S 278 291 PSM HSYTASYNIYDVNKR 228 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2222.18 28.01995 3 1829.875571 1829.869662 R Q 120 135 PSM HVGDLGNVTAGKDGVANVSIEDR 229 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2518.11 36.31137 4 2322.170894 2322.156401 R V 81 104 PSM VPAINVNDSVTK 230 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2371.15 32.18968 2 1255.678647 1255.677216 K S 175 187 PSM QGAIVAVTGDGVNDSPALK 231 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2716.10 41.92633 3 1810.945571 1810.942492 R K 698 717 PSM VAVDAPVSSVALR 232 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2650.18 40.05995 2 1282.725247 1282.724501 R Q 52 65 PSM EAFQEALAAAGDK 233 sp|P10639|THIO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2698.15 41.4201 2 1319.638247 1319.635745 K L 9 22 PSM VGVPTETGALTLNR 234 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2699.18 41.45155 2 1426.779647 1426.777993 R L 77 91 PSM APQVSTPTLVEAAR 235 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2565.13 37.6331 2 1438.777047 1438.777993 K N 439 453 PSM SPDFTNENPLETR 236 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2686.19 41.07907 2 1518.700247 1518.695051 R N 228 241 PSM RPSANCDPYAVTEAIVR 237 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 6-UNIMOD:4 ms_run[1]:scan=1.1.2648.16 40.00065 3 1917.945371 1917.936696 R T 341 358 PSM AYLMSQPLAYHTPDCGK 238 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 15-UNIMOD:4 ms_run[1]:scan=1.1.2635.17 39.62518 3 1950.908471 1950.896805 K Q 242 259 PSM ALQASALAAWGGK 239 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2806.10 44.48713 2 1242.672847 1242.672071 R A 305 318 PSM FADGDVDAVLSR 240 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2787.8 43.96005 2 1263.613647 1263.609531 R A 815 827 PSM ASLQNLLSASQAR 241 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2819.5 44.84195 2 1357.728647 1357.731377 R L 83 96 PSM LGPALATGNVVVMK 242 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2840.16 45.4437 2 1368.779847 1368.779907 K V 198 212 PSM AETFTFHSDICTLPEK 243 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 11-UNIMOD:4 ms_run[1]:scan=1.1.2766.13 43.36092 3 1894.890071 1894.877115 K E 528 544 PSM DFLAGGVAAAISK 244 sp|P51881|ADT2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3119.9 53.3924 2 1218.660447 1218.660838 K T 11 24 PSM VALQHNLGLGGAVVVTLYR 245 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3124.11 53.53878 3 1979.136671 1979.131630 K M 386 405 PSM APNSPDVLEIEFK 246 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3076.14 52.14783 2 1457.741847 1457.740210 K K 216 229 PSM GVVDSEDIPLNLSR 247 sp|Q9CQN1|TRAP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2988.20 49.65792 2 1512.777647 1512.778387 R E 391 405 PSM AVFQANQENLPILK 248 sp|Q8VDN2|AT1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.2992.19 49.77263 2 1583.868847 1583.867142 R R 431 445 PSM TFVQENVYDEFVER 249 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3160.12 54.57398 2 1773.821847 1773.820980 R S 327 341 PSM YQLQSQENFEPFMK 250 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3018.21 50.52128 2 1787.822047 1787.818872 K A 7 21 PSM TVLMNPNIASVQTNEVGLK 251 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3039.11 51.10593 3 2027.079071 2027.072126 K Q 459 478 PSM GHPLGATGLAQCAELCWQLR 252 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 12-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3053.6 51.50153 3 2237.089871 2237.083377 K G 354 374 PSM GTWEKPGGASPMGYDFWYQPR 253 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3155.7 54.4339 3 2429.094971 2429.089902 K H 175 196 PSM DGGQQFTEEFQTLNPMK 254 sp|Q9WVL0|MAAI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3379.10 60.7398 2 1968.901847 1968.888742 K Q 41 58 PSM DFSATDLTEFAAR 255 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3303.8 58.59253 2 1442.667447 1442.667774 K A 26 39 PSM EVAELAECIGSGLIQK 256 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 8-UNIMOD:4 ms_run[1]:scan=1.1.3258.10 57.31328 2 1715.877647 1715.876387 K G 126 142 PSM KFPLDPLITHVLPFEK 257 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3362.7 60.24438 3 1893.090971 1893.076407 K I 340 356 PSM SPWSMDENLMHISYEAGILENPK 258 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 5-UNIMOD:35 ms_run[1]:scan=1.1.3353.19 59.99305 3 2676.227471 2676.219990 K N 177 200 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 259 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 8-UNIMOD:4 ms_run[1]:scan=1.1.3250.4 57.0931 5 3609.842618 3609.815071 R S 178 213 PSM GVDEVTIVNILTNR 260 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3530.14 64.9462 2 1541.843447 1541.841322 K S 50 64 PSM IVFVLCSALNPWNK 261 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 6-UNIMOD:4 ms_run[1]:scan=1.1.3624.19 67.64281 2 1659.886047 1659.880684 K E 67 81 PSM ILLLDEATSALDTESEK 262 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3433.19 62.19272 2 1846.940847 1846.941155 K T 1239 1256 PSM ILLLDEATSALDTESEK 263 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3426.6 62.00512 2 1846.940847 1846.941155 K T 1239 1256 PSM STVNTAVALTLACFGTQR 264 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 13-UNIMOD:4 ms_run[1]:scan=1.1.3413.10 61.65575 3 1908.983171 1908.972747 K E 291 309 PSM NENTFLDLTVQQIEHLNK 265 sp|Q91ZJ5|UGPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3504.7 64.20564 3 2155.096271 2155.090947 R T 134 152 PSM GIAVHPELFSIDNGLLTPTLK 266 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3502.4 64.15207 3 2234.239571 2234.231070 K A 656 677 PSM KPLVIIAEDVDGEALSTLVLNR 267 sp|P63038|CH60_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3581.6 66.39657 3 2364.337571 2364.326427 R L 269 291 PSM TAFDEAIAELDTLSEESYK 268 sp|P63101|1433Z_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3774.5 71.88303 3 2130.993071 2130.984476 K D 194 213 PSM VLVCGAGPVGMVTLLVAK 269 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 4-UNIMOD:4 ms_run[1]:scan=1.1.3662.19 68.70921 2 1783.012247 1783.009984 K A 176 194 PSM QGFIDLPEFPFGLEPR 270 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3772.8 71.83265 2 1860.946247 1860.941036 K V 259 275 PSM VTPGSTCAVFGLGGVGLSVIIGCK 271 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 7-UNIMOD:4,23-UNIMOD:4 ms_run[1]:scan=1.1.3732.16 70.70852 3 2348.233271 2348.223225 K A 190 214 PSM YNTFGEALKQPDGIAVVGIFLK 272 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3647.7 68.28307 3 2379.290171 2379.283834 K I 127 149 PSM FRENVQDVLPTLPNPDDYFLLR 273 sp|Q99J08|S14L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3681.16 69.24955 3 2660.371871 2660.359852 K W 19 41 PSM VPPETIDSVIVGNVMQSSSDAAYLAR 274 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=1.1.3676.20 69.1099 3 2718.363671 2718.353446 K H 46 72 PSM DCVGPEVENACANPAAGTVILLENLR 275 sp|P09411|PGK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 32 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.3743.8 71.01178 3 2781.351971 2781.342564 K F 98 124 PSM DDDIAALVVDNGSGMCK 276 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 32 1-UNIMOD:1,16-UNIMOD:4 ms_run[1]:scan=1.1.3626.19 67.70235 2 1820.7987 1820.7915 M A 2 19 PSM HLWNVDVQGSK 277 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2306.12 30.38062 2 1281.655447 1281.646585 R A 33 44 PSM VNADEVGGEALGR 278 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2315.19 30.62943 2 1285.626047 1285.626243 K L 19 32 PSM ASGPGAAAQIQEVK 279 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2144.18 25.84078 2 1325.692647 1325.693929 K E 762 776 PSM TYFPHFDVSHGSAQVK 280 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2506.11 35.98508 4 1818.878494 1818.868933 K G 42 58 PSM VAVVAGYGDVGK 281 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2366.14 32.04603 2 1133.608647 1133.608074 K G 215 227 PSM VLQATVVAVGSGGK 282 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2399.20 32.98207 2 1284.740247 1284.740151 K G 41 55 PSM RPSANCDPYAVTEAIVR 283 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 6-UNIMOD:4 ms_run[1]:scan=1.1.2641.17 39.79903 3 1917.945371 1917.936696 R T 341 358 PSM ILGADTSVDLEETGR 284 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2749.21 42.87415 2 1574.780447 1574.778781 R V 59 74 PSM NYDYILSTGCAPPGK 285 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 10-UNIMOD:4 ms_run[1]:scan=1.1.2746.19 42.78558 2 1654.767647 1654.766108 R N 177 192 PSM DGFNPAHVEAGLYGSR 286 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2754.9 43.00872 3 1688.798171 1688.790683 K I 212 228 PSM AGGLATTGDKDILDIVPTEIHQK 287 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2962.5 48.9114 4 2391.274094 2391.264555 K A 292 315 PSM FLASVSTVLTSK 288 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2900.10 47.17502 2 1251.708647 1251.707454 K Y 129 141 PSM SFENSLGINVPR 289 sp|Q91ZJ5|UGPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2880.12 46.59558 2 1331.684447 1331.683364 K S 378 390 PSM IPPDSETTLVLVGR 290 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2936.9 48.20958 2 1495.819447 1495.824609 K A 233 247 PSM VAGHPDVVINNAAGNFISPSER 291 sp|Q9CQ62|DECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2766.19 43.36592 3 2263.140971 2263.134544 K L 134 156 PSM VVLAAADLGTEAGVQR 292 sp|Q64105|SPRE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2757.21 43.10597 2 1568.852247 1568.852221 K L 64 80 PSM MSLQPNEICVIQR 293 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 9-UNIMOD:4 ms_run[1]:scan=1.1.2880.18 46.6006 2 1586.793447 1586.790883 K G 172 185 PSM VLNVGDIGGNETVTLR 294 sp|Q9JLF6|TGM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2966.18 49.0325 2 1655.883447 1655.884249 K Q 737 753 PSM NIAFFSTNCVEGTAR 295 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 9-UNIMOD:4 ms_run[1]:scan=1.1.2928.20 47.98455 2 1685.783847 1685.783155 R G 241 256 PSM AAVSGLWGKVNADEVGGEALGR 296 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2946.7 48.47012 3 2155.118471 2155.102181 K L 10 32 PSM RVIISAPSADAPMFVMGVNHEK 297 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2875.11 46.44983 4 2368.214894 2368.203157 K Y 116 138 PSM GVGIISEGNETVEDIAAR 298 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2992.10 49.76513 3 1828.921871 1828.916671 K L 620 638 PSM ATGYPLAFIAAK 299 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3063.5 51.76842 2 1221.676047 1221.675760 K I 729 741 PSM LGEYGFQNAILVR 300 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3118.15 53.3687 2 1478.788847 1478.788164 K Y 422 435 PSM FELTCYSLAPQIK 301 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 5-UNIMOD:4 ms_run[1]:scan=1.1.3169.15 54.82224 2 1568.793447 1568.790866 R V 128 141 PSM SYELPDGQVITIGNER 302 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3143.21 54.09882 2 1789.884847 1789.884643 K F 239 255 PSM FAAEHTIFASNTSSLQITNIANATTR 303 sp|Q61425|HCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3133.20 53.80867 3 2778.396971 2778.393672 K Q 137 163 PSM DISSAVQANPALTELSLR 304 sp|Q91VI7|RINI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3381.4 60.7935 2 1883.979247 1883.995256 K T 42 60 PSM GSFVLLDGETFEVK 305 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3367.16 60.39585 2 1539.782647 1539.782075 K G 161 175 PSM MSINAEDVVVGDLVEVK 306 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 1-UNIMOD:35 ms_run[1]:scan=1.1.3288.20 58.17932 2 1831.927247 1831.923731 K G 178 195 PSM LIALSIDSVEDHLAWSK 307 sp|O08709|PRDX6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3378.2 60.69781 3 1896.006671 1895.999279 K D 68 85 PSM GKFPDVPGFSWVTPCISAK 308 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 15-UNIMOD:4 ms_run[1]:scan=1.1.3374.9 60.59012 3 2092.052171 2092.045183 K D 154 173 PSM PGGLLLGDEAPNFEANTTIGR 309 tr|Q6GT24|Q6GT24_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 31 ms_run[1]:scan=1.1.3279.12 57.90923 3 2143.0792 2141.0752 M I 2 23 PSM EAAEAIEAEGATAPLTELLHSR 310 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3287.13 58.14487 3 2278.152671 2278.144105 K N 626 648 PSM VETGVLKPGMVVTFAPVNVTTEVK 311 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3255.12 57.23235 3 2514.386471 2514.376748 R S 267 291 PSM SLFSSAENEPPVPLVGNWRPPQPVK 312 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3365.19 60.34083 3 2744.439071 2744.428600 R G 227 252 PSM KVADALANAAGHLDDLPGALSALSDLHAHK 313 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3314.5 58.88682 5 2990.582618 2990.557383 K L 62 92 PSM GFFVQPTVFSNVTDEMR 314 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3538.7 65.17146 3 1972.945571 1972.935298 K I 379 396 PSM ASYISSAQLDQPDPGAVAAAAIFR 315 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3548.15 65.47017 3 2418.225971 2418.217939 R A 544 568 PSM DNFHGLAIFLDTYPNDETTER 316 sp|Q9DBH5|LMAN2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3509.5 64.34012 3 2467.149071 2467.129183 K V 154 175 PSM DGETFQLMGLYGREPDLSSDIK 317 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3412.16 61.63173 3 2470.175771 2470.168605 K E 129 151 PSM LNPNFLVDFGKEPLGPALAHELR 318 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3439.7 62.34803 4 2546.379294 2546.364544 K Y 438 461 PSM AHCLSEVEHDTMPADLPAIAADFVEDQEVCK 319 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 3-UNIMOD:4,30-UNIMOD:4 ms_run[1]:scan=1.1.3535.20 65.09628 4 3496.584894 3496.558507 K N 311 342 PSM GLVLIAFSQYLQK 320 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3650.7 68.35519 2 1478.853047 1478.849701 K C 45 58 PSM DCGTDVLDLWTLMQK 321 sp|Q9DB29|IAH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 2-UNIMOD:4 ms_run[1]:scan=1.1.3815.10 73.02167 2 1793.833047 1793.832807 R D 172 187 PSM GLFHGAIMQSGVALLPDLISDTSEVVYK 322 sp|Q8QZR3|EST2A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3746.16 71.09383 3 2959.544171 2959.536496 K T 244 272 PSM VNPTVFFDITADDEPLGR 323 sp|P17742|PPIA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 31 ms_run[1]:scan=1.1.3635.5 67.95673 3 2004.9912 2004.9792 M V 2 20 PSM GAGVTLNVLEMTADDLENALK 324 tr|B2RT14|B2RT14_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3820.12 73.14933 3 2173.101671 2173.093650 R T 404 425 PSM HFDSAYLYQIEEEVGQAIR 325 tr|Q91WT7|Q91WT7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3695.5 69.65327 3 2267.098571 2267.085862 R S 48 67 PSM DMDLIDVNEAFAPQFLSVQK 326 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.3781.16 72.07405 3 2279.125571 2279.114385 K A 313 333 PSM AGVLSQADYLNLVQCETLEDLK 327 sp|P51863|VA0D1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 15-UNIMOD:4 ms_run[1]:scan=1.1.3683.12 69.30531 3 2478.239771 2478.231206 K L 25 47 PSM LCYVALDFEQEMATAASSSSLEK 328 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 2-UNIMOD:4 ms_run[1]:scan=1.1.3673.14 69.02192 3 2549.176571 2549.166557 K S 216 239 PSM CCAEANPPACYGTVLAEFQPLVEEPK 329 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3650.20 68.36604 3 2949.347171 2949.334702 K N 384 410 PSM VNQIGSVTESIQACK 330 sp|P21550|ENOB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 14-UNIMOD:4 ms_run[1]:scan=1.1.2574.20 37.88887 2 1632.813847 1632.814121 K L 344 359 PSM SKDIVLVAYSALGSHR 331 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=1.1.2776.7 43.64622 3 1714.944371 1714.936619 R E 208 224 PSM AGKPVLHYFDGR 332 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 31 1-UNIMOD:1 ms_run[1]:scan=1.1.2578.3 37.98495 3 1400.7227 1400.7196 M G 2 14 PSM HVGDLGNVTAGK 333 sp|P08228|SODC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.1947.19 20.28027 2 1166.604047 1166.604386 R D 81 93 PSM VIGSGCNLDSAR 334 sp|P00342|LDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 6-UNIMOD:4 ms_run[1]:scan=1.1.2064.18 23.57817 2 1247.592047 1247.592835 R F 158 170 PSM KLDEAVAEAHLGK 335 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2082.12 24.07253 3 1379.743571 1379.740879 K L 389 402 PSM AAGCDFNNVVK 336 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 4-UNIMOD:4 ms_run[1]:scan=1.1.2213.16 27.7592 2 1193.550447 1193.549907 K T 68 79 PSM TFVSGACDASIK 337 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 7-UNIMOD:4 ms_run[1]:scan=1.1.2269.19 29.36247 2 1254.590647 1254.591438 R L 198 210 PSM AAATEDATPAALEK 338 sp|O08705|NTCP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2157.18 26.20848 2 1357.674447 1357.672525 K G 323 337 PSM FEEGGYVVCNTK 339 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 9-UNIMOD:4 ms_run[1]:scan=1.1.2326.21 30.94445 2 1401.625647 1401.623466 R Q 65 77 PSM IIAEGANGPTTPEADK 340 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2149.21 25.98753 2 1582.784247 1582.783866 K I 400 416 PSM INGEWHTIILASDKR 341 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2519.3 36.33208 4 1751.938494 1751.931868 K E 34 49 PSM TYFPHFDVSHGSAQVK 342 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2513.6 36.17159 4 1818.878494 1818.868933 K G 42 58 PSM AADKDTCFSTEGPNLVTR 343 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 7-UNIMOD:4 ms_run[1]:scan=1.1.2443.18 34.19615 3 1980.928871 1980.921105 K C 585 603 PSM AGQITNEALSNIR 344 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2486.19 35.41857 2 1385.726847 1385.726292 K T 936 949 PSM ADIVENQVMDTR 345 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2449.20 34.36678 2 1389.657647 1389.655829 R M 97 109 PSM GLNSDSVTEETLR 346 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2397.20 32.92617 2 1419.685047 1419.684152 K K 893 906 PSM IRADIVENQVMDTR 347 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2519.17 36.3471 2 1658.842047 1658.841004 R M 95 109 PSM AGLEQGSDAGYLAESQK 348 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2424.13 33.66907 2 1722.810247 1722.806058 K F 310 327 PSM TCEWIHDSSLSASCK 349 sp|Q61207|SAP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 2-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.2365.15 32.01847 3 1779.761771 1779.755620 K E 93 108 PSM RLTGFHETSNINDFSAGVANR 350 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2507.18 36.01932 4 2305.131694 2305.119956 R G 299 320 PSM HVGDLGNVTAGKDGVANVSIEDR 351 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2515.15 36.23647 3 2322.173471 2322.156401 R V 81 104 PSM AGAVAEEALGAIR 352 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2679.4 40.87793 2 1226.667647 1226.661900 K T 249 262 PSM KYTPEQVAMATVTALHR 353 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 9-UNIMOD:35 ms_run[1]:scan=1.1.2657.14 40.25891 3 1931.000471 1930.993482 K T 243 260 PSM VGVPTETGALTLNR 354 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2693.17 41.27817 2 1426.779647 1426.777993 R L 77 91 PSM APQVSTPTLVEAAR 355 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2559.18 37.46597 2 1438.777047 1438.777993 K N 439 453 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 356 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2620.21 39.19327 4 2932.415294 2932.399368 K L 176 205 PSM AEAEAQAEELSFPR 357 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2669.20 40.61275 2 1546.728647 1546.726351 R S 929 943 PSM NYDYILSTGCAPPGK 358 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 10-UNIMOD:4 ms_run[1]:scan=1.1.2752.20 42.9599 2 1654.767647 1654.766108 R N 177 192 PSM ALNDHHVYLEGTLLKPNMVTAGHACTK 359 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 25-UNIMOD:4 ms_run[1]:scan=1.1.2554.13 37.31775 5 2989.509618 2989.490232 K K 216 243 PSM VAAGVLCELAQDK 360 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 7-UNIMOD:4 ms_run[1]:scan=1.1.2800.16 44.32428 2 1372.701647 1372.702051 R E 613 626 PSM KLNCQVIGASVDSHFCHLAWINTPK 361 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2909.17 47.43593 4 2894.444494 2894.431989 K K 68 93 PSM VITAFNDGLNHLDSLK 362 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2945.5 48.44145 3 1755.924371 1755.915549 K G 68 84 PSM IYELAAGGTAVGTGLNTR 363 sp|P97807|FUMH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2805.18 44.46552 2 1762.923447 1762.921363 R I 266 284 PSM FYDPCEGMVTLDGHDIR 364 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 5-UNIMOD:4 ms_run[1]:scan=1.1.2942.5 48.36368 3 2023.883471 2023.876797 R S 471 488 PSM VVDSLQLTGTKPVATPVDWK 365 sp|O08709|PRDX6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2942.7 48.36702 3 2153.175671 2153.173221 R K 163 183 PSM DFLAGGVAAAISK 366 sp|P51881|ADT2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3125.7 53.56455 2 1218.660447 1218.660838 K T 11 24 PSM VQIAVANAQELLQR 367 sp|P62075|TIM13_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3008.19 50.22687 2 1551.875247 1551.873290 K M 28 42 PSM LYATTSLYSDWDK 368 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2987.17 49.62657 2 1561.732447 1561.730040 R Q 399 412 PSM IIPGFMCQGGDFTR 369 sp|P17742|PPIA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 7-UNIMOD:4 ms_run[1]:scan=1.1.3051.6 51.44792 2 1597.737647 1597.738119 R H 56 70 PSM ILATPPQEDAPSVDIANIR 370 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3059.11 51.66272 3 2019.068471 2019.063670 K M 284 303 PSM FTASAGIQVVGDDLTVTNPK 371 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3108.9 53.07505 3 2032.052771 2032.047686 K R 307 327 PSM TLGVDFIDVATK 372 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3204.5 55.78575 2 1277.687047 1277.686718 K V 1270 1282 PSM AERPDGLILGMGGQTALNCGVELFKR 373 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 30 19-UNIMOD:4 ms_run[1]:scan=1.1.3317.10 58.97392 4 2801.4472 2801.4312 K G 498 524 PSM GSFVLLDGETFEVK 374 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3361.13 60.22045 2 1539.782647 1539.782075 K G 161 175 PSM IAPSFAVESMEDALK 375 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3352.16 59.96213 2 1606.793247 1606.791260 K A 561 576 PSM LQNQLQTDLSVIPVINR 376 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3378.11 60.71283 2 1950.094247 1950.089825 K A 641 658 PSM RLPTLEQPIIPSDYVAIK 377 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3182.5 55.17012 3 2052.167771 2052.161928 K A 1292 1310 PSM SVTELNGDTITNTMTLGDIVYKR 378 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3264.18 57.48035 3 2540.285171 2540.279219 K V 100 123 PSM GLGGVNVEELFGISK 379 sp|Q9Z2V4|PCKGC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3573.6 66.18117 2 1517.808247 1517.808959 K E 568 583 PSM SLRPGVAIADFVIFPPR 380 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3454.3 62.77062 3 1854.054971 1854.051589 K W 305 322 PSM DLYANTVLSGGTTMYPGIADR 381 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3418.14 61.80333 3 2214.068171 2214.062684 K M 292 313 PSM HEIIQTLQMTDGLIPLEIR 382 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3546.9 65.40646 3 2219.205671 2219.198389 R F 236 255 PSM VLILGSGGLSIGQAGEFDYSGSQAVK 383 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3477.17 63.43645 3 2552.319971 2552.312233 K A 425 451 PSM GEFQILLDALDK 384 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3698.2 69.72884 2 1360.723647 1360.723832 K I 154 166 PSM ISVSDLINGIASLK 385 sp|Q61735|CD47_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3775.8 71.90353 2 1428.820247 1428.818795 K M 86 100 PSM IISQEILNLIELR 386 sp|Q9QZ85|IIGP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3744.6 71.02955 2 1552.925047 1552.918844 K M 33 46 PSM ADQELLMYSHDNIICGITSVAFSR 387 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 15-UNIMOD:4 ms_run[1]:scan=1.1.3646.7 68.25623 3 2739.314471 2739.299637 R S 257 281 PSM LFLEQIHVLENSLVLK 388 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3646.2 68.24371 3 1894.098071 1894.092785 R F 59 75 PSM ALDYLAIGVHELAAISER 389 sp|P35492|HUTH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3692.5 69.56575 3 1940.039771 1940.036727 K R 452 470 PSM VLLASPDLQEAVEEVLPTLKK 390 sp|O35488|S27A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3702.7 69.8413 3 2291.310971 2291.298815 K D 154 175 PSM KHLEINPDHPIVETLR 391 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.2334.9 31.15237 4 1910.047294 1910.037396 K Q 624 640 PSM AGKPVLHYFDGR 392 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 30 1-UNIMOD:1 ms_run[1]:scan=1.1.2585.4 38.17552 3 1400.7227 1400.7196 M G 2 14 PSM AHVLAASVEQATENFLEK 393 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=1.1.3089.9 52.5197 3 1955.994971 1955.995256 K G 58 76 PSM LVNADGEAVYCK 394 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 11-UNIMOD:4 ms_run[1]:scan=1.1.2181.14 26.86988 2 1337.628247 1337.628552 K F 222 234 PSM GGSHTIQVISGCEVGSDGR 395 sp|P01901|HA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 12-UNIMOD:4 ms_run[1]:scan=1.1.2274.17 29.5033 3 1914.890471 1914.885388 K L 111 130 PSM VSHVSTGGGASLELLEGK 396 sp|P09041|PGK2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2550.15 37.20477 3 1739.907071 1739.905378 K I 389 407 PSM GQNQPVLNITNR 397 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2349.20 31.57533 2 1352.717047 1352.716061 R Q 317 329 PSM ATIECEQPQPDLYR 398 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:4 ms_run[1]:scan=1.1.2495.21 35.67867 2 1718.794847 1718.793385 R F 207 221 PSM TYFPHFDVSHGSAQVK 399 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2506.21 35.99343 2 1818.870247 1818.868933 K G 42 58 PSM IYVVDVGSEPR 400 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2579.6 38.01862 2 1232.640447 1232.640102 R A 104 115 PSM VLSSMTDAVLAR 401 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2741.11 42.63422 2 1261.670647 1261.670022 R V 130 142 PSM HALIIYDDLSK 402 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2589.14 38.29323 2 1286.688647 1286.687053 K Q 306 317 PSM EHALLAYTLGVK 403 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2707.13 41.67815 2 1313.735447 1313.734337 R Q 135 147 PSM MLLEYTDSSYDEK 404 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2738.21 42.55647 2 1592.694047 1592.691605 R R 19 32 PSM DTCFSTEGPNLVTR 405 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:4 ms_run[1]:scan=1.1.2729.18 42.29811 2 1595.728247 1595.724971 K C 589 603 PSM VLGTSVESIMATEDR 406 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 10-UNIMOD:35 ms_run[1]:scan=1.1.2575.21 37.91843 2 1622.784447 1622.782152 K Q 533 548 PSM VIVVGNPANTNCLTASK 407 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 12-UNIMOD:4 ms_run[1]:scan=1.1.2590.21 38.32707 2 1756.917047 1756.914169 K S 126 143 PSM RPAIFTYHDVGLNYK 408 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2597.9 38.51802 3 1792.932671 1792.926054 K S 62 77 PSM VADIGLAAWGR 409 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2940.5 48.30647 2 1127.606647 1127.608743 K K 9 20 PSM QITINDLPVGR 410 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2823.7 44.95115 2 1224.682247 1224.682636 R S 141 152 PSM MAEDLILYGTK 411 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2879.12 46.56658 2 1252.640447 1252.637325 R E 256 267 PSM KLNCQVIGASVDSHFCHLAWINTPK 412 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2908.16 47.40608 4 2894.444494 2894.431989 K K 68 93 PSM ANEELAGVVAEVQK 413 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2781.17 43.79902 2 1455.760047 1455.756923 K N 76 90 PSM ANEELAGVVAEVQK 414 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2769.17 43.45187 2 1455.760047 1455.756923 K N 76 90 PSM SIMISGNVLPDATR 415 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:35 ms_run[1]:scan=1.1.2803.19 44.41033 2 1488.761247 1488.760629 K F 238 252 PSM VPTPNVSVVDLTCR 416 sp|P16858|G3P_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 13-UNIMOD:4 ms_run[1]:scan=1.1.2928.18 47.98288 2 1555.803447 1555.802828 R L 233 247 PSM AMGAAQVVVTDLSASR 417 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2939.7 48.28615 2 1574.807047 1574.808641 K L 194 210 PSM GTTITSVLPKPALVASR 418 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2809.9 44.57267 3 1710.007571 1710.003970 K V 403 420 PSM EAAQMDMVNDGVEDLR 419 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2875.20 46.45735 2 1791.779047 1791.776749 R G 86 102 PSM VLVGANFEEVAFDEKK 420 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2909.10 47.43008 3 1793.924471 1793.919966 K N 373 389 PSM GDHYLCDVVWATEER 421 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 6-UNIMOD:4 ms_run[1]:scan=1.1.2936.2 48.19707 3 1848.816071 1848.810098 R I 290 305 PSM RPCFSALTVDETYVPK 422 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:4 ms_run[1]:scan=1.1.2807.14 44.51912 3 1881.936071 1881.929485 R E 509 525 PSM ENPTTFMGHYLHEVAR 423 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2794.10 44.15085 3 1900.895171 1900.889017 K R 153 169 PSM NTGTEAPDYLATVDVDPK 424 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2920.21 47.75492 2 1904.902247 1904.900353 R S 35 53 PSM FAVLQTYGDTTHTLVEK 425 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2777.15 43.68152 3 1921.987871 1921.978543 K I 133 150 PSM AGAPPGLFNVVQGGAATGQFLCHHR 426 sp|Q9JLJ2|AL9A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 22-UNIMOD:4 ms_run[1]:scan=1.1.3033.11 50.9334 4 2561.279294 2561.270995 K E 199 224 PSM DPSGGPVSLDFVK 427 sp|Q99LB7|SARDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3041.14 51.16677 2 1316.662247 1316.661232 R N 873 886 PSM DDGSWEVIEGYR 428 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3113.14 53.22515 2 1424.620847 1424.620824 R A 125 137 PSM APNSPDVLEIEFK 429 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3070.17 51.97787 2 1457.741847 1457.740210 K K 216 229 PSM DFDPAINEYLQR 430 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3163.16 54.65199 2 1479.700247 1479.699408 K K 219 231 PSM ADIGVAMGIVGSDVSK 431 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3051.5 51.4454 2 1517.773247 1517.775944 K Q 728 744 PSM FELTCYSLAPQIK 432 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:4 ms_run[1]:scan=1.1.3163.17 54.65282 2 1568.793447 1568.790866 R V 128 141 PSM LGVLGFFSTGDQHAR 433 tr|Q6PDB7|Q6PDB7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3040.4 51.12937 3 1603.811171 1603.810690 R G 176 191 PSM GGNASNSCTVLSLLGAR 434 sp|P97328|KHK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 8-UNIMOD:4 ms_run[1]:scan=1.1.3143.19 54.09715 2 1675.828847 1675.831168 R C 40 57 PSM LSQTFPNADFAEITK 435 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3061.19 51.72429 2 1680.836247 1680.835902 R L 243 258 PSM LISWYDNEYGYSNR 436 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2978.19 49.37187 2 1778.792247 1778.790014 K V 308 322 PSM SYELPDGQVITIGNER 437 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3131.20 53.75057 2 1789.884847 1789.884643 K F 239 255 PSM DGPNALTPPPTTPEWVK 438 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3056.10 51.5898 2 1818.917047 1818.915215 R F 65 82 PSM HNQLPLVIEFTEQTAPK 439 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3112.6 53.1897 3 1964.042771 1964.036727 K I 233 250 PSM IFNNGADLSGITEENAPLK 440 sp|P07758|A1AT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3029.12 50.83115 2 2001.995447 2002.000735 R L 329 348 PSM GIHVEIPGAQAESLGPLQVAR 441 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3090.16 52.55455 3 2141.163071 2141.159302 R V 86 107 PSM VWTSGQVEEYDLDADDINSR 442 sp|Q02013|AQP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3019.18 50.54805 3 2311.029371 2311.024050 K V 244 264 PSM DGTVTAGNASGVSDGAGAVIIASEDAVKK 443 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3019.21 50.55055 3 2659.335971 2659.330068 K H 242 271 PSM HQHVFDETTLNNFMGLGQAAWK 444 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3310.3 58.77935 4 2543.212894 2543.201577 K E 58 80 PSM AGSIADEVLSSIR 445 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3295.11 58.37157 2 1316.692847 1316.693595 K T 277 290 PSM PPYTIVYFPVR 446 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 ms_run[1]:scan=1.1.3225.8 56.40032 2 1350.7347 1350.7331 M G 2 13 PSM PPYTIVYFPVR 447 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 ms_run[1]:scan=1.1.3231.7 56.56807 2 1350.7347 1350.7331 M G 2 13 PSM WLLAAAGVEFEEK 448 tr|E9Q6L7|E9Q6L7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3333.9 59.43358 2 1461.752047 1461.750381 R F 21 34 PSM LMFNDFLSSSSDK 449 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3228.13 56.49127 2 1489.678247 1489.675896 R Q 315 328 PSM APVVMGSSEDVQEFLEIYRK 450 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:35 ms_run[1]:scan=1.1.3209.13 55.93598 3 2312.140871 2312.135849 K H 315 335 PSM TLVYGGIFLYPANK 451 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3350.8 59.89931 2 1554.845647 1554.844616 R K 256 270 PSM VEIEAIAVQGPFIKA 452 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3339.5 59.60232 2 1583.891247 1583.892294 R - 121 136 PSM SSFICNTLQPGCNSVCYDHFFPISHVR 453 sp|P28230|CXB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3174.10 54.9669 4 3241.464894 3241.453195 K L 49 76 PSM TPIGSFLGSLASQPATK 454 sp|Q8QZT1|THIL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3291.18 58.26225 2 1673.900047 1673.898836 R L 47 64 PSM TGVAGGLWDVLSCEEK 455 sp|Q61830|MRC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 13-UNIMOD:4 ms_run[1]:scan=1.1.3393.13 61.0892 2 1719.813247 1719.813786 K A 605 621 PSM MQLIMLCYNPDFEK 456 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3302.10 58.57648 2 1816.823447 1816.819800 R Q 109 123 PSM KFPLDPLITHVLPFEK 457 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3389.2 60.97425 3 1893.090971 1893.076407 K I 340 356 PSM INAWNSPTLPIYEPGLK 458 sp|O70475|UGDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3342.6 59.6907 2 1912.006847 1912.009450 R E 42 59 PSM ACGDSTLTQITAGLDPVGR 459 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 2-UNIMOD:4 ms_run[1]:scan=1.1.3252.10 57.15683 2 1930.942447 1930.941841 K I 24 43 PSM EAPFTHFDPSCLFPACR 460 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 11-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3358.7 60.1283 3 2050.909871 2050.902953 K D 172 189 PSM GHYTEGAELVDSVLDVVRK 461 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3228.10 56.48877 3 2086.076171 2086.069484 K E 104 123 PSM VLGTSVESIMATEDRQLFSDK 462 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3303.10 58.59503 3 2325.162371 2325.152227 K L 533 554 PSM SLDLDSIIAEVK 463 tr|A0A2R8VHP3|A0A2R8VHP3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3570.4 66.1051 2 1301.712247 1301.707848 R A 277 289 PSM KDGSASGTTLLEALDCILPPTRPTDK 464 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 16-UNIMOD:4 ms_run[1]:scan=1.1.3456.2 62.82549 4 2755.4212 2755.4052 R P 219 245 PSM LNAGEVVIGDGGFVFALEKR 465 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3411.12 61.59917 3 2090.124071 2090.116040 R G 17 37 PSM IVFVLCSALNPWNK 466 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 6-UNIMOD:4 ms_run[1]:scan=1.1.3630.20 67.82204 2 1659.886047 1659.880684 K E 67 81 PSM KLDILSNDLVINMLK 467 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3522.5 64.70335 3 1727.994671 1727.985543 K S 73 88 PSM LLYECNPIAYVMEK 468 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:4 ms_run[1]:scan=1.1.3428.12 62.05553 2 1741.845847 1741.841915 R A 278 292 PSM MSINAEDVVVGDLVEVK 469 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3419.20 61.83678 2 1815.928847 1815.928816 K G 178 195 PSM AIAELGIYPAVDPLDSTSR 470 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3452.19 62.7271 2 1987.027647 1987.026222 R I 388 407 PSM GTVLLADNVIVPGTPDFLAYVR 471 sp|O88587|COMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3772.5 71.82515 3 2329.272671 2329.268184 K G 206 228 PSM VIEACALLPDLEMLPGGDMAEIGEK 472 sp|Q8VI47|MRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:4 ms_run[1]:scan=1.1.3772.7 71.83015 3 2670.292871 2670.295463 R G 731 756 PSM DIDLSPVTIGFGSIPR 473 sp|Q05421|CP2E1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3705.6 69.92865 2 1685.903247 1685.898836 K E 468 484 PSM EGGLGPLNIPLLADVTK 474 sp|Q61171|PRDX2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3737.5 70.84637 2 1705.960847 1705.961437 K S 93 110 PSM TTSLELFMYLNEVAGK 475 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3730.5 70.63997 3 1814.920871 1814.912438 R H 245 261 PSM ILLLDMATSALDNESEAK 476 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3689.20 69.49017 2 1932.977647 1932.971409 K V 579 597 PSM TVLGVPEVLLGILPGAGGTQR 477 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3785.11 72.18549 3 2046.190271 2046.183726 K L 167 188 PSM LSENNIQTIFAVTEEFQPVYK 478 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3744.8 71.0329 3 2469.256571 2469.242757 K E 326 347 PSM SSPAQPAVPAPLADLK 479 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1 ms_run[1]:scan=1.1.3348.15 59.84938 2 1602.8587 1602.8612 M I 2 18 PSM CGGDIAFHLNPR 480 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2923.11 47.83283 2 1338.6115 1338.6134 R F 258 270 PSM DGGIPADPNNIFLSTGASDAIVTMLK 481 sp|Q8QZR5|ALAT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3812.5 72.9415 3 2617.325771 2616.310519 R L 144 170 PSM SRDDSQLNGDPSALLNPSK 482 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.2659.18 40.32047 3 2013.969971 2012.976312 K E 137 156 PSM SHIGVVPQDTVLFNDTIANNIR 483 sp|Q9DC29|ABCB6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=1.1.3196.12 55.5653 3 2422.267271 2422.260472 R Y 664 686 PSM ATESSPLTTHVLDTASGLPAQGLCLR 484 sp|Q9CRB3|HIUH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1,24-UNIMOD:4 ms_run[1]:scan=1.1.3519.18 64.62669 3 2736.3902 2736.3752 M L 2 28 PSM SAGGAVPPPPNPAVSFPAPR 485 sp|Q8BI08|MAL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 29 1-UNIMOD:1 ms_run[1]:scan=1.1.3289.8 58.19752 3 1926.9968 1926.9947 M V 2 22 PSM NIIHGSDSVESAEK 486 sp|Q01768|NDKB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.1936.15 19.97568 3 1484.713271 1484.710701 R E 115 129 PSM TDEDKNPVTNPTTQEK 487 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.1871.19 18.1426 3 1815.854771 1815.848651 K Q 296 312 PSM RPQPEEGATYEGIQKK 488 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 28 ms_run[1]:scan=1.1.1851.21 17.57717 3 1829.9276 1829.9267 R E 191 207 PSM ADNSATGFGTGTR 489 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.1942.21 20.14433 2 1253.561847 1253.563643 K A 922 935 PSM MDSTANEVEAVK 490 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2118.20 25.09215 2 1292.591847 1292.591832 K V 427 439 PSM AQSELSGAADEAAR 491 sp|Q9D3D9|ATPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2036.21 22.7899 2 1374.638847 1374.637536 K A 137 151 PSM KQTALAELVK 492 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2166.15 26.45313 2 1099.659247 1099.660110 K H 549 559 PSM AVAGDASESALLK 493 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2337.13 31.24073 2 1230.647847 1230.645582 R C 446 459 PSM GAEVLSYSEAASK 494 sp|Q923B6|STEA4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2317.20 30.6878 2 1310.636047 1310.635411 R S 61 74 PSM TASLTSAASIDGSR 495 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2293.19 30.02422 2 1335.664447 1335.663023 R S 330 344 PSM TASLTSAASIDGSR 496 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2286.15 29.82937 2 1335.664447 1335.663023 R S 330 344 PSM NQVAVVTGGGTGIGK 497 sp|Q99MZ7|PECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2257.20 29.01907 2 1356.736047 1356.736128 K A 18 33 PSM ADIVENQVMDTR 498 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 9-UNIMOD:35 ms_run[1]:scan=1.1.2184.17 26.95093 2 1405.653847 1405.650744 R M 97 109 PSM GGSHTIQVISGCEVGSDGR 499 sp|P01901|HA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 12-UNIMOD:4 ms_run[1]:scan=1.1.2268.20 29.33445 3 1914.890471 1914.885388 K L 111 130 PSM HGSWGSGLDMHTKPWIR 500 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2502.7 35.86712 4 1963.957294 1963.947535 K A 328 345 PSM THINIVVIGHVDSGK 501 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2370.11 32.15787 3 1587.879671 1587.873290 K S 6 21 PSM AVAGDASESALLK 502 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2343.15 31.409 2 1230.647847 1230.645582 R C 446 459 PSM VILHLKEDQTEYLEER 503 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2528.18 36.58838 3 2014.038671 2014.037121 K R 186 202 PSM VILHLKEDQTEYLEER 504 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2521.10 36.40137 3 2014.038671 2014.037121 K R 186 202 PSM ADIVENQVMDTR 505 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2443.21 34.19865 2 1389.657647 1389.655829 R M 97 109 PSM AQGSVALSVTQDPAR 506 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2366.21 32.05187 2 1498.776247 1498.773970 R K 267 282 PSM GILAADESVGTMGNR 507 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 12-UNIMOD:35 ms_run[1]:scan=1.1.2361.20 31.90998 2 1505.716847 1505.714407 K L 29 44 PSM THINIVVIGHVDSGK 508 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2363.12 31.95942 3 1587.879671 1587.873290 K S 6 21 PSM KPEEVDDEVFYSPR 509 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2461.20 34.70737 2 1708.798047 1708.794431 R S 307 321 PSM HQGSLYSLFPDHSVK 510 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2544.13 37.03365 3 1713.851171 1713.847470 R K 130 145 PSM MLLEYTDSSYDEKR 511 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2510.15 36.09787 3 1748.801171 1748.792716 R Y 19 33 PSM GCITIIGGGDTATCCAK 512 sp|P09411|PGK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.2513.21 36.1841 2 1753.778247 1753.779726 R W 366 383 PSM APAAIGPYSQAVQVDR 513 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2625.10 39.32967 3 1641.851171 1641.847470 K T 14 30 PSM IMDPNIVGNEHYDVAR 514 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2601.17 38.64062 3 1841.878871 1841.873032 R G 407 423 PSM ENIIDLSNANR 515 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2591.14 38.34947 2 1257.633447 1257.631329 R C 165 176 PSM RHPDYSVSLLLR 516 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2552.10 37.25772 3 1454.802071 1454.799397 R L 361 373 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 517 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2626.16 39.36362 4 2932.415294 2932.399368 K L 176 205 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 518 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2638.19 39.7139 4 2932.415294 2932.399368 K L 176 205 PSM SPDFTNENPLETR 519 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2692.20 41.25178 2 1518.700247 1518.695051 R N 228 241 PSM AEAEAQAEELSFPR 520 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2663.21 40.43945 2 1546.728647 1546.726351 R S 929 943 PSM ELGATECINPQDYSK 521 sp|P00329|ADH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.2578.12 37.99998 2 1723.774447 1723.772316 K P 235 250 PSM YIGGCCGFEPYHIR 522 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2610.21 38.90505 2 1727.756647 1727.754832 R A 295 309 PSM HNHQGFGAGNFNSLFK 523 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2572.14 37.82605 3 1773.838571 1773.833551 R A 354 370 PSM QGAIVAVTGDGVNDSPALK 524 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2712.21 41.82488 2 1810.945247 1810.942492 R K 698 717 PSM AGPWTPEAAVEHPEAVR 525 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2581.10 38.0717 3 1815.897071 1815.890397 K Q 41 58 PSM EIEIDYTGTEPSSPCNK 526 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 15-UNIMOD:4 ms_run[1]:scan=1.1.2639.21 39.74453 2 1938.853047 1938.851688 R C 77 94 PSM HDPSLQPWSASYDPGSAK 527 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2628.16 39.42152 3 1941.892271 1941.885706 K T 40 58 PSM SRDDSQLNGDPSALLNPSK 528 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2615.12 39.04117 3 2012.982971 2012.976312 K E 137 156 PSM ELVEPLTPSGEAPNQAHLR 529 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2577.18 37.97055 3 2057.059271 2057.054168 R I 689 708 PSM FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR 530 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2697.20 41.39555 5 3697.683618 3697.651690 K E 40 74 PSM SPGASLLPVLTK 531 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2959.8 48.8298 2 1181.700047 1181.701974 K A 511 523 PSM HNVMVSTEWAAPNVFK 532 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2925.13 47.89219 3 1828.900271 1828.893040 R D 196 212 PSM FLASVSTVLTSK 533 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2906.9 47.3428 2 1251.708647 1251.707454 K Y 129 141 PSM AFAMTNQILVER 534 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2899.13 47.14897 2 1391.722447 1391.723121 K S 613 625 PSM GTEFLAAPSSYYK 535 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2790.10 44.0478 2 1432.685847 1432.687447 R L 285 298 PSM FVTVQTISGTGALR 536 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2801.17 44.35313 2 1448.799447 1448.798728 R V 126 140 PSM GVVDSDDLPLNVSR 537 sp|P08113|ENPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2858.17 45.96572 2 1484.746247 1484.747087 K E 435 449 PSM VCYEGQPVGEFIR 538 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.2815.3 44.74583 2 1552.734447 1552.734414 K C 328 341 PSM YVTLIYTNYENGK 539 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2826.19 45.04455 2 1576.776647 1576.777324 K N 104 117 PSM VLGTSVESIMATEDR 540 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2935.19 48.1835 2 1606.784647 1606.787237 K Q 533 548 PSM ICDQISDAVLDAHLK 541 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.2828.8 45.09143 3 1696.850771 1696.845421 K Q 34 49 PSM EFGASECISPQDFSK 542 sp|P28474|ADHX_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.2816.9 44.77282 2 1700.730847 1700.735202 K S 234 249 PSM AHMVTLDYTVQVPGTGR 543 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2800.9 44.31845 3 1843.931471 1843.925068 K D 214 231 PSM AHMVTLDYTVQVPGTGR 544 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2806.9 44.4863 3 1843.931471 1843.925068 K D 214 231 PSM TCLLNETGDEPFQYKN 545 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 2-UNIMOD:4 ms_run[1]:scan=1.1.2880.21 46.6031 2 1927.866247 1927.862193 R - 358 374 PSM YGLSAHPITPQMFGYAGK 546 sp|P32020|NLTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2941.6 48.33917 3 1936.954871 1936.950554 K E 151 169 PSM RAEDGSVIDYELIDQDAR 547 sp|P07356|ANXA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2855.17 45.881 3 2063.985671 2063.975977 R E 179 197 PSM HNDDEQYAWESSAGGSFTVR 548 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2761.18 43.21953 3 2254.961471 2254.951553 K T 154 174 PSM AGGLATTGDKDILDIVPTEIHQK 549 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2963.18 48.94983 3 2391.269771 2391.264555 K A 292 315 PSM AGSNVMQTFTFYASEDKLENR 550 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 6-UNIMOD:35 ms_run[1]:scan=1.1.2852.20 45.79732 3 2423.114171 2423.106340 R G 66 87 PSM DAGTIAGLNVLR 551 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3041.12 51.1651 2 1198.665447 1198.666986 K I 160 172 PSM VAFTGSTEVGHLIQVAAGSSNLKR 552 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3075.6 52.1126 4 2441.312894 2441.302672 K V 260 284 PSM LYVDVGYVDLR 553 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3164.7 54.67235 2 1310.687847 1310.687053 K S 228 239 PSM TVLMNPNIASVQTNEVGLK 554 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3045.15 51.28395 3 2027.079071 2027.072126 K Q 459 478 PSM EGLYITEEIYK 555 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2978.13 49.36685 2 1356.681447 1356.681299 R T 256 267 PSM EGLYITEEIYK 556 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2984.9 49.53337 2 1356.681447 1356.681299 R T 256 267 PSM AEMQQILQGLDK 557 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3020.10 50.57055 2 1372.701247 1372.702051 K V 58 70 PSM PFTIEDIEVAPPK 558 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3171.9 54.87427 2 1454.763447 1454.765697 K A 21 34 PSM ADIGVAMGIVGSDVSK 559 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3045.16 51.28478 2 1517.773247 1517.775944 K Q 728 744 PSM LRPTDVPETYYSFNYEALAK 560 sp|P06802|ENPP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3158.7 54.51742 3 2376.168671 2376.163778 R N 439 459 PSM VSHALAEGLGVIACIGEK 561 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 14-UNIMOD:4 ms_run[1]:scan=1.1.3078.10 52.20193 3 1822.966571 1822.961119 K L 164 182 PSM YFAGTMAEETAPAVLER 562 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3003.21 50.08268 2 1854.882247 1854.882200 R H 113 130 PSM AANEAGYFNEEMAPIEVK 563 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3041.21 51.1726 2 1981.911647 1981.909143 K T 192 210 PSM VIISAPSADAPMFVMGVNHEK 564 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3099.14 52.81573 3 2212.105571 2212.102046 R Y 117 138 PSM HAAYVLLTGPASSDVPGLVSVTK 565 sp|Q8C0Z1|F234A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3157.9 54.4895 3 2281.236371 2281.231798 R H 494 517 PSM VWTSGQVEEYDLDADDINSR 566 sp|Q02013|AQP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3025.12 50.71387 3 2311.029371 2311.024050 K V 244 264 PSM VETGVLKPGMVVTFAPVNVTTEVK 567 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 10-UNIMOD:35 ms_run[1]:scan=1.1.3109.20 53.11368 3 2530.379171 2530.371663 R S 267 291 PSM IALGIPLPEIK 568 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3380.2 60.7525 2 1162.733047 1162.732546 K N 741 752 PSM DLGEAALNEYLR 569 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3233.9 56.62415 2 1362.679447 1362.677945 K I 883 895 PSM VMEETFSYLLGR 570 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3320.13 59.06137 2 1443.706847 1443.706802 K K 211 223 PSM TLFSSQIEELNLPK 571 tr|A0A0R4J0I1|A0A0R4J0I1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3281.16 57.9715 2 1617.862847 1617.861388 K F 301 315 PSM IIVIMDSYGSDLVER 572 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3249.9 57.07365 2 1708.871847 1708.870573 K G 224 239 PSM SLSGVYMNSMLTQIER 573 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3320.21 59.06805 2 1827.887647 1827.885905 K Q 34 50 PSM LTQLGTFEDHFLSLQR 574 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3211.8 55.99018 3 1903.986971 1903.979212 R M 38 54 PSM LTQLGTFEDHFLSLQR 575 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3217.8 56.16645 3 1903.986971 1903.979212 R M 38 54 PSM EAAEAIEAEGATAPLTELLHSR 576 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3288.12 58.17263 3 2278.152671 2278.144105 K N 626 648 PSM ILVTHGIHFLPQVDEIVVLGK 577 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3338.3 59.5677 4 2326.353294 2326.341289 R G 814 835 PSM KRPIHLSFDVDGLDPAFTPATGTPVLGGLSYR 578 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 28 ms_run[1]:scan=1.1.3348.16 59.85022 4 3396.8042 3396.7822 K E 224 256 PSM LQVELDSVTGLLSQSDSK 579 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3422.8 61.9163 2 1917.976447 1917.989502 K S 1278 1296 PSM VLEDIQLNLFTR 580 sp|Q8CGC7|SYEP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3431.4 62.1282 2 1459.801647 1459.803479 K A 1404 1416 PSM SALTVQFVQGIFVEK 581 sp|P62835|RAP1A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3525.13 64.79833 2 1664.917447 1664.913758 K Y 17 32 PSM SLRPGVAIADFVIFPPR 582 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3448.6 62.60192 3 1854.054971 1854.051589 K W 305 322 PSM TGLLSGLDIMEVNPTLGK 583 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 10-UNIMOD:35 ms_run[1]:scan=1.1.3429.10 62.0842 2 1872.987447 1872.986666 K T 267 285 PSM GHYTEGAELVDSVLDVVR 584 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3431.2 62.12487 3 1957.979771 1957.974521 K K 104 122 PSM KADCTITMADSDLLALMTGK 585 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 4-UNIMOD:4 ms_run[1]:scan=1.1.3553.15 65.61653 3 2154.043871 2154.037063 K M 492 512 PSM FKLGLDFPNLPYLIDGSHK 586 sp|P10649|GSTM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3535.5 65.08376 4 2173.171694 2173.157176 K I 51 70 PSM FAELVYTGFWHSPECEFVR 587 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 15-UNIMOD:4 ms_run[1]:scan=1.1.3421.7 61.88935 3 2373.095471 2373.088839 K H 317 336 PSM LNPNFLVDFGKEPLGPALAHELR 588 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3434.7 62.21008 4 2546.379294 2546.364544 K Y 438 461 PSM SPWSMDENLMHISYEAGILENPK 589 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3536.19 65.12442 3 2660.238971 2660.225075 K N 177 200 PSM SFIAILDNLLTENR 590 sp|P11714|CP2D9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3815.8 73.01667 2 1617.864447 1617.872622 K T 249 263 PSM AGQDLLLVTSEACVLLDGQDLEPR 591 sp|Q8C0Z1|F234A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 13-UNIMOD:4 ms_run[1]:scan=1.1.3767.10 71.697 3 2611.302671 2611.316333 K W 341 365 PSM QADIVAALTLEVLK 592 sp|P35492|HUTH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3743.5 71.00426 2 1482.870247 1482.865745 R G 329 343 PSM GMPFELCFLVQR 593 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 7-UNIMOD:4 ms_run[1]:scan=1.1.3642.6 68.14813 2 1495.735047 1495.731577 K S 95 107 PSM GLGTDEDAIIGILAYR 594 sp|P97429|ANXA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3681.13 69.24705 2 1675.881247 1675.878101 K N 29 45 PSM TLGGILAPVYYGALIDR 595 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3689.16 69.48683 2 1791.002447 1790.993071 R T 577 594 PSM VNPTVFFDITADDEPLGR 596 sp|P17742|PPIA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 28 ms_run[1]:scan=1.1.3638.2 68.03205 3 2004.9912 2004.9792 M V 2 20 PSM LVQIEYALAAVAGGAPSVGIK 597 sp|P49722|PSA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3697.6 69.70865 3 2026.149371 2026.146277 K A 19 40 PSM AVIGDHGDEIFSVFGSPFLK 598 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3663.8 68.72923 3 2134.080971 2134.073506 K D 461 481 PSM QAADMILLDDNFASIVTGVEEGR 599 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3796.8 72.49258 3 2463.208271 2463.195155 K L 734 757 PSM LQQELDDLLVDLDHQR 600 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.3378.3 60.69948 3 1948.992971 1948.985420 R Q 1418 1434 PSM HTGPGILSMANAGPNTNGSQFFICTAK 601 sp|P17742|PPIA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 24-UNIMOD:4 ms_run[1]:scan=1.1.3229.20 56.52442 3 2791.321571 2790.321769 K T 92 119 PSM YPIEHGIITNWDDMEK 602 sp|P62737|ACTA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2872.14 46.36717 3 1959.914171 1959.903664 K I 71 87 PSM VNNASLIGLGYTQTLRPGVK 603 sp|Q60931|VDAC3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=1.1.2875.17 46.45485 3 2101.172771 2100.169138 K L 237 257 PSM VNEAACDIAR 604 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 6-UNIMOD:4 ms_run[1]:scan=1.1.1938.17 20.0316 2 1117.517847 1117.518607 K Q 99 109 PSM TCVADESAANCDK 605 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.1780.21 15.5611 2 1439.564647 1439.565694 K S 76 89 PSM KPMVLGHEAAGTVTK 606 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.1874.20 18.22878 3 1537.831871 1537.828648 K V 64 79 PSM VIEASEIQAK 607 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2097.17 24.49482 2 1086.593047 1086.592090 K C 121 131 PSM TEQGPQVDETQFKK 608 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2045.19 23.04085 3 1633.804871 1633.794765 R I 358 372 PSM LDQGGAPLAGTNK 609 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2010.20 22.05697 2 1240.642247 1240.641165 K E 109 122 PSM KLDEAVAEAHLGK 610 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2075.11 23.87705 3 1379.743571 1379.740879 K L 389 402 PSM RAVAGDASESALLK 611 sp|Q8VDN2|AT1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2108.7 24.79457 3 1386.747971 1386.746693 K C 445 459 PSM YMCENQATISSK 612 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.2028.20 22.56487 2 1430.617247 1430.617001 K L 287 299 PSM YMCENQATISSK 613 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.2034.21 22.73377 2 1430.617247 1430.617001 K L 287 299 PSM RFNSANEDNVTQVR 614 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.1963.17 20.72683 3 1648.794671 1648.791746 K T 431 445 PSM ELISNSSDALDK 615 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2306.13 30.3823 2 1290.628447 1290.630326 R I 47 59 PSM AAAEVNQEYGLDPK 616 sp|P97807|FUMH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2329.12 31.02563 2 1503.719247 1503.720538 R I 99 113 PSM ASQRPDVLTTGGGNPIGDK 617 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2276.14 29.56117 2 1881.955447 1881.954454 R L 20 39 PSM TYFPHFDVSHGSAQVK 618 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2520.6 36.36177 4 1818.878494 1818.868933 K G 42 58 PSM THINIVVIGHVDSGK 619 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2376.13 32.3302 3 1587.879671 1587.873290 K S 6 21 PSM KITISDCGQL 620 sp|P17742|PPIA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 7-UNIMOD:4 ms_run[1]:scan=1.1.2417.5 33.47318 2 1133.574647 1133.575060 K - 155 165 PSM VAVVAGYGDVGK 621 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2360.11 31.8745 2 1133.608647 1133.608074 K G 215 227 PSM LGTAAIQGAIEK 622 sp|Q8QZT1|THIL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2441.14 34.13557 2 1170.661647 1170.660838 K A 64 76 PSM QLGGYVATIGTK 623 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2498.19 35.7623 2 1206.661647 1206.660838 R F 65 77 PSM LNIPVNQVNPR 624 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2520.19 36.37262 2 1262.708047 1262.709519 R D 648 659 PSM EGPAPIPAPLEATGSEPTEDAEGHKPK 625 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2505.19 35.9632 4 2724.340494 2724.324255 K L 351 378 PSM VISLSGEHSIIGR 626 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2496.5 35.69377 3 1366.762571 1366.756864 R T 104 117 PSM EISDGDVIISGNR 627 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2492.19 35.59198 2 1373.679447 1373.678673 K N 455 468 PSM VLQEDTLPDLHTK 628 sp|P18572|BASI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2456.7 34.55537 3 1507.792871 1507.788223 K Y 177 190 PSM ITEIYEGTSEIQR 629 sp|Q07417|ACADS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2499.21 35.79239 2 1537.765047 1537.762402 R L 387 400 PSM DLTEDHSSLLLHVK 630 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2549.9 37.17133 3 1605.840671 1605.836236 K Q 114 128 PSM SLNPELGTDADKEQWK 631 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2459.17 34.64898 3 1829.885771 1829.879558 K E 213 229 PSM FRPAEPHFTSDGSSFYK 632 sp|P28843|DPP4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2467.7 34.8648 4 1971.921294 1971.911526 R I 351 368 PSM LGQSDPAPLQHQVDIYQK 633 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2510.18 36.10038 3 2036.038571 2036.032704 R R 187 205 PSM SHAEDLGNLEGVKPAVLTR 634 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2581.4 38.0667 4 2005.068894 2005.059253 R S 176 195 PSM HGGTIPVVPTAEFQDR 635 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2631.12 39.505 3 1722.876071 1722.868933 K I 481 497 PSM VAFITGGGTGLGK 636 sp|Q9CQ62|DECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2620.14 39.18742 2 1176.648447 1176.650273 K A 61 74 PSM VITSGFNALEK 637 sp|Q9WVL0|MAAI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2560.13 37.49053 2 1177.635447 1177.634289 K I 134 145 PSM HLEINPDHSIIETLR 638 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2702.15 41.5361 3 1785.942671 1785.937347 K Q 634 649 PSM IMGTSPLQIDR 639 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2628.15 39.42068 2 1229.645047 1229.643808 K A 1075 1086 PSM RPSANCDPYAVTEAIVR 640 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 6-UNIMOD:4 ms_run[1]:scan=1.1.2642.13 39.8247 3 1917.945371 1917.936696 R T 341 358 PSM EHHTDEFEYDELIVR 641 sp|Q9JLF6|TGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2734.17 42.43807 3 1930.873871 1930.869721 R R 127 142 PSM VGIPVVAVESDPK 642 sp|Q9DBM2|ECHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2747.14 42.8104 2 1308.728047 1308.728917 R Q 317 330 PSM EHALLAYTLGVK 643 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2701.9 41.50215 2 1313.735447 1313.734337 R Q 135 147 PSM EHALLAYTLGVK 644 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2702.19 41.53943 2 1313.735447 1313.734337 R Q 135 147 PSM RAGNVVYGEPIAAGLGTDGR 645 sp|Q9EQF5|DPYS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2598.18 38.55442 3 1972.021271 1972.012637 R Q 263 283 PSM AFAMTNQILVER 646 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 4-UNIMOD:35 ms_run[1]:scan=1.1.2596.18 38.49645 2 1407.716847 1407.718036 K S 613 625 PSM PFETLLSQNQGGK 647 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2624.18 39.30723 2 1417.720447 1417.720144 K A 129 142 PSM TGTAEMSSILEER 648 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2699.17 41.45072 2 1422.667647 1422.666059 K I 46 59 PSM FVIGGPQGDAGVTGR 649 sp|Q91X83|METK1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2583.4 38.12557 2 1429.733247 1429.731377 R K 251 266 PSM GDVTTQVALQPALK 650 sp|P09671|SODM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2655.16 40.20238 2 1439.798647 1439.798394 K F 76 90 PSM VFVTSGLGGMSGAQAK 651 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2641.20 39.80155 2 1508.767047 1508.765714 K A 243 259 PSM NVEAQSTEEMFVK 652 sp|Q61735|CD47_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2557.20 37.41002 2 1510.698647 1510.697359 R W 45 58 PSM TVFVGNHPISGTEPYIAQR 653 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2639.15 39.73952 3 2085.071471 2085.064339 R F 21 40 PSM LVLEVAQHLGESTVR 654 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2788.4 43.98373 3 1649.911571 1649.910070 R T 95 110 PSM SLGQWLQEEK 655 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2759.10 43.15498 2 1216.609847 1216.608802 K V 148 158 PSM ADLINNLGTIAK 656 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2886.9 46.76725 2 1241.698047 1241.697952 K S 101 113 PSM AADTIGYPVMIR 657 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2884.11 46.71058 2 1305.677047 1305.675108 K S 576 588 PSM TQAALVLGSLEAR 658 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2913.13 47.54863 2 1327.744847 1327.745965 K K 527 540 PSM ISIYSNSIEAVAR 659 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2799.19 44.29855 2 1421.749047 1421.751444 R S 225 238 PSM AAVSGLWGKVNADEVGGEALGR 660 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2948.14 48.53002 3 2155.118471 2155.102181 K L 10 32 PSM PFVELETNLPASR 661 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=1.1.2930.16 48.03932 2 1471.7658 1471.7666 M I 2 15 PSM VAPPGLTQIPQIQK 662 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2857.17 45.93733 2 1488.868047 1488.866414 R T 72 86 PSM AMGAAQVVVTDLSASR 663 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2938.7 48.25922 2 1574.807047 1574.808641 K L 194 210 PSM IAPSFAVESMEDALK 664 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 10-UNIMOD:35 ms_run[1]:scan=1.1.2798.19 44.27023 2 1622.787047 1622.786175 K A 561 576 PSM TFVVQGFGNVGLHSMR 665 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2928.12 47.97787 3 1747.886471 1747.882809 K Y 303 319 PSM NPDDITQEEYGEFYK 666 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2865.20 46.1703 2 1846.794647 1846.789740 R S 292 307 PSM KYPLLLDVYAGPCSQK 667 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 13-UNIMOD:4 ms_run[1]:scan=1.1.2957.8 48.77332 3 1850.963171 1850.960057 K A 533 549 PSM GIVVGIKLDQGGAPLAGTNK 668 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2813.3 44.68042 3 1907.082671 1907.084011 K E 102 122 PSM KLMNIEFYDCSCVSGSGFQK 669 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 10-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2929.21 48.0144 3 2369.053571 2369.049025 K G 492 512 PSM LDQGGAPLAGTNKETTIQGLDGLSER 670 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.2838.19 45.38892 3 2640.344171 2640.335488 K C 109 135 PSM ISVAGVTSGNVGYLAHAIHQVTK 671 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3031.4 50.87197 4 2321.260494 2321.249179 R - 408 431 PSM SFEEIAAEFR 672 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3087.6 52.45882 2 1197.565247 1197.566603 K K 490 500 PSM VISTLSVGVDHLALDEIK 673 sp|Q91Z53|GRHPR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3159.2 54.53195 3 1908.060071 1908.056794 R K 77 95 PSM VPTPNVSVVDLTCRLEK 674 sp|P16858|G3P_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 13-UNIMOD:4 ms_run[1]:scan=1.1.2992.14 49.76847 3 1926.029171 1926.024448 R P 233 250 PSM LTGQIFLGGSIVR 675 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3084.12 52.37635 2 1359.788847 1359.787435 R G 345 358 PSM FVEGLPINDFSR 676 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3116.13 53.30968 2 1392.704647 1392.703765 K E 299 311 PSM AERPDGLILGMGGQTALNCGVELFKR 677 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 27 11-UNIMOD:35,19-UNIMOD:4 ms_run[1]:scan=1.1.3161.10 54.59198 4 2817.4319 2817.4260 K G 498 524 PSM EEIFGPVQQIMK 678 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3157.6 54.4845 2 1417.729647 1417.727537 K F 399 411 PSM ANATEFGLASGVFTR 679 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3081.17 52.29383 2 1539.765447 1539.768157 R D 827 842 PSM SAPDFTATAVVDGAFK 680 sp|Q61171|PRDX2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3154.11 54.4036 2 1595.781447 1595.783138 K E 11 27 PSM MTVAHMWFDNQIHEADTTENQSGVSFDK 681 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3003.19 50.08102 4 3237.432094 3237.413163 R T 386 414 PSM TFVQENVYDEFVER 682 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3167.20 54.76905 2 1773.821847 1773.820980 R S 327 341 PSM SLVEASSSGVSVLSLCEK 683 sp|P50580|PA2G4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 16-UNIMOD:4 ms_run[1]:scan=1.1.3053.9 51.50905 2 1850.932047 1850.929545 R G 34 52 PSM KVDFVSGLYTLCGAGDIK 684 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 12-UNIMOD:4 ms_run[1]:scan=1.1.3161.6 54.58865 3 1941.989771 1941.987000 K S 109 127 PSM YVRPGGGFEPNFTLFEK 685 sp|P11352|GPX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3089.9 52.5197 3 1956.979271 1956.973398 K C 96 113 PSM IDNSQVESGSLEDDWDFLPPKK 686 sp|P14211|CALR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3159.9 54.54447 3 2518.206371 2518.186364 K I 186 208 PSM IFGVTTLDIVR 687 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3292.5 58.2798 2 1232.716847 1232.712873 K A 166 177 PSM LGLDSLAPFDPK 688 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3298.6 58.45478 2 1271.676647 1271.676154 R E 307 319 PSM LLVVYPWTQR 689 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3181.3 55.1449 2 1273.719247 1273.718293 R Y 32 42 PSM LLVVYPWTQR 690 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3174.4 54.95688 2 1273.719247 1273.718293 R Y 32 42 PSM ILELFVVTNTK 691 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3244.8 56.92579 2 1275.743047 1275.743839 R Q 291 302 PSM FIDLLPTSLPHAVTCDIK 692 sp|Q64458|CP2CT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 15-UNIMOD:4 ms_run[1]:scan=1.1.3340.2 59.62345 3 2039.086571 2039.076149 R F 358 376 PSM YITPDQLADLYK 693 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3220.11 56.25668 2 1438.736647 1438.734397 R S 270 282 PSM WLLAAAGVEFEEK 694 tr|E9Q6L7|E9Q6L7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3327.14 59.26392 2 1461.752047 1461.750381 R F 21 34 PSM SDYLNTFEFMDK 695 sp|O88844|IDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3291.16 58.26058 2 1508.648847 1508.649347 R L 389 401 PSM LFQTNTELLELTTK 696 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3211.19 55.99937 2 1649.889247 1649.887603 R T 690 704 PSM GFGTDEQAIVDVVSNR 697 sp|Q07076|ANXA7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3185.14 55.26406 2 1705.827847 1705.827128 K S 175 191 PSM VIGNQSLVNELTFSAR 698 sp|O35459|ECH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3176.7 55.01982 2 1746.929447 1746.926448 K K 214 230 PSM RTAVDSGIALLTNFQVTK 699 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3292.7 58.28147 3 1933.070471 1933.063276 R L 1454 1472 PSM LSYYPHCLASFTELVR 700 sp|Q9QXF8|GNMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 7-UNIMOD:4 ms_run[1]:scan=1.1.3222.10 56.31438 3 1954.967171 1954.961119 R A 241 257 PSM KQEYVVIQAAEDLAATSGDSVYR 701 sp|P16406|AMPE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3343.8 59.71277 3 2512.252271 2512.244548 K L 157 180 PSM LCYVALDFEQEMATAASSSSLEK 702 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 2-UNIMOD:4,12-UNIMOD:35 ms_run[1]:scan=1.1.3244.17 56.9333 3 2565.172571 2565.161472 K S 216 239 PSM SLFSSAENEPPVPLVGNWRPPQPVK 703 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3359.18 60.16672 3 2744.439071 2744.428600 R G 227 252 PSM GLVVLGFPCNQFGHQENGKNEEILNSLK 704 sp|P11352|GPX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 9-UNIMOD:4 ms_run[1]:scan=1.1.3179.10 55.0945 4 3140.590494 3140.571319 R Y 68 96 PSM DLDVAVLVGSMPR 705 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3593.6 66.7297 2 1370.721447 1370.722786 K R 80 93 PSM AVFVDLEPTVIDEIR 706 sp|P68368|TBA4A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3558.18 65.76373 2 1714.918047 1714.914152 R N 65 80 PSM KLDILSNDLVINMLK 707 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3523.17 64.74284 2 1727.989847 1727.985543 K S 73 88 PSM GGCEAIVDTGTSLLVGPVEEVK 708 sp|P18242|CATD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.3415.10 61.71355 3 2229.123071 2229.119865 K E 286 308 PSM AVEIVAQEMMTDLPSTFEEK 709 sp|P32020|NLTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3577.6 66.28909 3 2267.081171 2267.070137 K S 251 271 PSM AERPDGLILGMGGQTALNCGVELFK 710 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 19-UNIMOD:4 ms_run[1]:scan=1.1.3494.21 63.94007 3 2645.337071 2645.330543 K R 498 523 PSM DLAILLGMLDPVEK 711 sp|O08709|PRDX6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3860.2 74.2438 2 1525.846447 1525.842567 R D 109 123 PSM GKLPPGPTPLPIIGNFLQIDVK 712 sp|Q64458|CP2CT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3699.3 69.75905 3 2313.350471 2313.346040 R N 27 49 PSM VAEQTPLTALYVANLIK 713 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3655.21 68.50687 2 1843.047247 1843.045501 K E 212 229 PSM GKLPPGPTPLPIIGNFLQIDVK 714 sp|Q64458|CP2CT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=1.1.3698.6 69.73552 3 2313.350471 2313.346040 R N 27 49 PSM LCYVALDFEQEMATAASSSSLEK 715 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 2-UNIMOD:4 ms_run[1]:scan=1.1.3667.16 68.85255 3 2549.176571 2549.166557 K S 216 239 PSM TACQEYTVTEFQPLYYVAESFNDAK 716 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:4 ms_run[1]:scan=1.1.3773.4 71.85948 3 2973.355871 2973.337856 K E 372 397 PSM QGAIVAVTGDGVNDSPALK 717 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 27 1-UNIMOD:28 ms_run[1]:scan=1.1.3213.20 56.05895 2 1793.9167 1793.9154 R K 708 727 PSM ATSASSHLNK 718 sp|P15105|GLNA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 27 1-UNIMOD:1 ms_run[1]:scan=1.1.1784.19 15.6714 2 1056.5178 1056.5195 M G 2 12 PSM TASSVLLHTGQK 719 sp|Q9JII6|AK1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 27 1-UNIMOD:1 ms_run[1]:scan=1.1.2462.18 34.73352 2 1283.6922 1282.6872 M M 2 14 PSM GLGTDEDSLIEIICSR 720 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 27 14-UNIMOD:4 ms_run[1]:scan=1.1.3572.7 66.16275 2 1776.854647 1776.856380 K T 120 136 PSM IGASTQAAQR 721 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.1669.19 12.4605 2 1001.526847 1001.525407 K L 527 537 PSM KSEHSSEGELAK 722 sp|P18572|BASI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.1549.21 9.124683 2 1300.624247 1300.625909 K L 228 240 PSM IQHGHTIISVAHR 723 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.1753.18 14.78918 3 1467.806771 1467.805879 K L 604 617 PSM VSQEHPVVLTK 724 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.1881.9 18.41593 3 1235.689571 1235.687387 R F 1158 1169 PSM RPQPEEGATYEGIQKK 725 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=1.1.1845.21 17.40687 3 1829.9276 1829.9267 R E 191 207 PSM AGFAGDDAPR 726 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.1949.15 20.33173 2 975.441047 975.441009 K A 19 29 PSM MDSTANEVEAVK 727 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2112.21 24.92085 2 1292.591847 1292.591832 K V 427 439 PSM TGEPDEEEGTFR 728 sp|Q9Z239|PLM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2094.17 24.4165 2 1365.567847 1365.568454 R S 70 82 PSM TGEPDEEEGTFR 729 sp|Q9Z239|PLM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2101.21 24.60858 2 1365.567847 1365.568454 R S 70 82 PSM SVTEQGAELSNEER 730 sp|P63101|1433Z_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2085.21 24.16512 2 1547.719447 1547.706344 K N 28 42 PSM AIAEELAPER 731 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2292.12 29.99085 2 1097.573047 1097.571688 R G 309 319 PSM VVAGVAAALAHK 732 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2206.3 27.55112 3 1105.659671 1105.660778 K Y 134 146 PSM AYGENIGYSEK 733 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2148.18 25.95625 2 1229.556047 1229.556432 K D 279 290 PSM VNADEVGGEALGR 734 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2321.20 30.80333 2 1285.626047 1285.626243 K L 19 32 PSM AAATEDATPAALEK 735 sp|O08705|NTCP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2145.21 25.87227 2 1357.674447 1357.672525 K G 323 337 PSM TEQGPQVDETQFK 736 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2261.21 29.13343 2 1505.702647 1505.699802 R K 358 371 PSM IGGHGAEYGAEALER 737 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2170.12 26.56423 3 1528.729571 1528.727020 K M 18 33 PSM IIAEGANGPTTPEADK 738 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2143.21 25.81425 2 1582.784247 1582.783866 K I 400 416 PSM SVGEVMAIGR 739 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2433.11 33.9092 2 1017.527047 1017.527715 K T 794 804 PSM AAYQVAALPR 740 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2413.12 33.3645 2 1058.587447 1058.587279 R G 108 118 PSM AAYQVAALPR 741 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2420.7 33.55145 2 1058.587447 1058.587279 R G 108 118 PSM AGDLGVDLTSK 742 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2432.11 33.88162 2 1074.555447 1074.555704 K V 211 222 PSM VPAIYGVDTR 743 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2492.9 35.58365 2 1089.583447 1089.581859 K M 158 168 PSM LVQEVTDFAK 744 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2543.11 37.00367 2 1148.608447 1148.607740 K T 66 76 PSM IVTSEEVIIR 745 sp|P97300|NPTN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2508.4 36.03962 2 1157.666647 1157.665589 R E 150 160 PSM LVEEAIQCAEK 746 sp|Q8BH95|ECHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 8-UNIMOD:4 ms_run[1]:scan=1.1.2368.20 32.10798 2 1288.634447 1288.633303 K I 218 229 PSM GATQQILDEAER 747 sp|P80314|TCPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2448.17 34.33628 2 1329.653247 1329.652458 R S 377 389 PSM YNPNVLPVQCTGK 748 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 10-UNIMOD:4 ms_run[1]:scan=1.1.2488.20 35.47758 2 1488.740247 1488.739499 K R 205 218 PSM QSQSQDVLVLEDSK 749 sp|Q8VI47|MRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2530.17 36.64253 2 1574.779847 1574.778781 K K 278 292 PSM IRADIVENQVMDTR 750 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2526.5 36.52607 3 1658.845271 1658.841004 R M 95 109 PSM EAAQMDMVNDGVEDLRGK 751 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:35 ms_run[1]:scan=1.1.2479.19 35.21755 3 1992.897071 1992.888091 R Y 86 104 PSM ECCHGDLLECADDRAELAK 752 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 2-UNIMOD:4,3-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2392.15 32.78217 4 2260.963694 2260.951102 K Y 268 287 PSM ILLLGAGESGK 753 sp|P27600|GNA12_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2648.7 39.99313 2 1056.618447 1056.617910 K S 58 69 PSM LVQAFQFTDK 754 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2726.14 42.21167 2 1195.625247 1195.623724 R H 159 169 PSM VLGSGAFGTVYK 755 sp|P70424|ERBB2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2643.17 39.85702 2 1197.640647 1197.639374 K G 726 738 PSM LSMTNDPLEAAR 756 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2645.17 39.91477 2 1316.642447 1316.639451 K G 244 256 PSM AFAMTNQILVER 757 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 4-UNIMOD:35 ms_run[1]:scan=1.1.2602.19 38.67125 2 1407.716847 1407.718036 K S 613 625 PSM LQAFQGYQVTMK 758 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2750.14 42.89718 2 1412.713647 1412.712222 R T 278 290 PSM FVIGGPQGDAGVTGR 759 sp|Q91X83|METK1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2590.18 38.32455 2 1429.733247 1429.731377 R K 251 266 PSM TTPSYVAFTDTER 760 sp|P16627|HS71L_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2618.19 39.13357 2 1486.695847 1486.693989 R L 39 52 PSM GILAADESVGTMGNR 761 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2589.19 38.2974 2 1489.719047 1489.719492 K L 29 44 PSM ASAELALGENNEVLK 762 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2686.20 41.0799 2 1556.807047 1556.804602 K S 108 123 PSM FLGVAEQLHNEGFK 763 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2740.6 42.6014 3 1587.810071 1587.804542 R L 1374 1388 PSM FLGVAEQLHNEGFK 764 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2734.9 42.4314 3 1587.810071 1587.804542 R L 1374 1388 PSM VLGTSVESIMATEDR 765 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 10-UNIMOD:35 ms_run[1]:scan=1.1.2562.21 37.55397 2 1622.782647 1622.782152 K Q 533 548 PSM LVQDVANNTNEEAGDGTTTATVLAR 766 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2664.21 40.46837 3 2559.250571 2559.241253 K S 97 122 PSM AVFQANQENLPILKR 767 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2719.12 42.01165 3 1739.974571 1739.968253 R A 431 446 PSM FKVDLSPYPTISHINK 768 sp|Q9WVL0|MAAI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2752.15 42.95572 3 1858.003871 1857.998885 R E 176 192 PSM QATVGDVNTDRPGLLDLK 769 sp|P31786|ACBP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2726.16 42.21333 3 1911.014771 1911.006155 K G 34 52 PSM WSSCNIFSTQDHAAAAIAK 770 sp|P50247|SAHH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 4-UNIMOD:4 ms_run[1]:scan=1.1.2741.15 42.63755 3 2076.975971 2076.968724 R A 76 95 PSM FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR 771 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2698.18 41.4226 5 3697.683618 3697.651690 K E 40 74 PSM GAGAFGYFEVTHDITR 772 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2954.10 48.69158 3 1739.829971 1739.826734 K Y 78 94 PSM AAIGDTLVQDIR 773 sp|Q9CXN7|PBLD2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2843.12 45.52717 2 1270.688047 1270.688115 K Y 142 154 PSM LCLTGQWEAAQELQHR 774 sp|Q9DCU9|HOGA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 2-UNIMOD:4 ms_run[1]:scan=1.1.2846.14 45.61648 3 1938.942671 1938.937030 R L 250 266 PSM ARDCLIPMGITSENVAER 775 sp|Q8VCH0|THIKB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 4-UNIMOD:4 ms_run[1]:scan=1.1.2802.17 44.38092 3 2030.998571 2030.987745 K F 174 192 PSM VVDLMAYMASKE 776 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:35 ms_run[1]:scan=1.1.2829.15 45.12565 2 1371.642847 1371.641425 R - 322 334 PSM FVTVQTISGTGALR 777 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2807.18 44.52245 2 1448.799447 1448.798728 R V 126 140 PSM VIPLFSPQCGECR 778 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 9-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2875.19 46.45652 2 1561.740847 1561.738119 K I 90 103 PSM IINEPTAAAIAYGLDKK 779 sp|P17156|HSP72_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2827.9 45.06413 3 1786.986971 1786.982900 R G 173 190 PSM LYGPTNFSPIINHVAR 780 sp|Q8BT60|CPNE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2908.10 47.40107 3 1797.953171 1797.952603 R F 391 407 PSM HNVMVSTEWAAPNVFK 781 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2931.12 48.06503 3 1828.900271 1828.893040 R D 196 212 PSM HLEGLLPVGVPTTDTQR 782 sp|Q9DCP2|S38A3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2883.10 46.68078 3 1831.982471 1831.979212 K T 18 35 PSM ENPTTFMGHYLHEVAR 783 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2800.13 44.32178 3 1900.895171 1900.889017 K R 153 169 PSM YLGTQPEPDIVGLDSGHIR 784 sp|P52196|THTR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2865.14 46.1653 3 2066.044871 2066.043269 R G 188 207 PSM TQDPAKAPNSPDVLEIEFK 785 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2889.14 46.8588 3 2098.063871 2098.058250 K K 210 229 PSM IADQCPSSLAIQENANALAR 786 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:4 ms_run[1]:scan=1.1.2810.15 44.60602 3 2141.058671 2141.053516 R Y 154 174 PSM RIQEITEQLDITTSEYEK 787 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2837.17 45.35826 3 2195.103071 2195.095758 K E 370 388 PSM YVTLIYTNYENGKNDYVK 788 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2772.18 43.54025 3 2196.082271 2196.073900 K A 104 122 PSM VAGHPDVVINNAAGNFISPSER 789 sp|Q9CQ62|DECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.2760.19 43.1913 3 2263.140971 2263.134544 K L 134 156 PSM VVRNEFTLGEECELETMTGEK 790 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 12-UNIMOD:4 ms_run[1]:scan=1.1.2952.21 48.64523 3 2470.140671 2470.135591 K V 58 79 PSM KYFDQVDISNGLDWSLDHK 791 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3111.7 53.16148 4 2279.092094 2279.085862 K I 145 164 PSM SLEIIGAPFSK 792 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3024.5 50.68072 2 1160.642447 1160.644125 K G 7 18 PSM LYFEELSLER 793 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3161.7 54.58949 2 1297.656447 1297.655418 K I 1030 1040 PSM GPVGLAIDFPESK 794 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3057.5 51.60927 2 1328.694247 1328.697617 K L 1744 1757 PSM LIEVANLACSISNNEEGVK 795 sp|P26231|CTNA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 9-UNIMOD:4 ms_run[1]:scan=1.1.3145.14 54.15155 3 2059.026671 2059.025570 K L 430 449 PSM TVQGAFFGVPVYK 796 sp|Q61838|PZP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3124.14 53.5413 2 1411.747847 1411.749987 K D 625 638 PSM EHINLGCDVDFDIAGPSIR 797 sp|Q60932|VDAC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.3173.13 54.93475 3 2127.007571 2127.005503 R G 134 153 PSM VAIAVAINQAIASGK 798 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3074.9 52.0862 2 1424.833847 1424.835114 R I 520 535 PSM IHFPLATYAPVISAEK 799 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3090.6 52.5462 3 1755.957371 1755.955957 R A 265 281 PSM SGNSVTLLVLDGDSYEK 800 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3124.21 53.54713 2 1795.883047 1795.883974 K A 78 95 PSM LQDQAAETIEALHAAGLK 801 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3001.9 50.01468 3 1877.988371 1877.984691 K V 652 670 PSM HNQLPLVIEFTEQTAPK 802 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3118.8 53.36285 3 1964.042771 1964.036727 K I 233 250 PSM YFDSFGDLSSASAIMGNAK 803 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 15-UNIMOD:35 ms_run[1]:scan=1.1.3142.21 54.06948 2 1995.891247 1995.888408 R V 42 61 PSM ELHLLGVQVQQFQDVATR 804 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3169.10 54.81807 3 2080.114571 2080.106538 R L 1835 1853 PSM AVLDVAETGTEAAAATGVIGGIRK 805 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3104.19 52.96612 3 2269.231871 2269.227775 K A 361 385 PSM HAAYVLLTGPASSDVPGLVSVTK 806 sp|Q8C0Z1|F234A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3164.14 54.67818 3 2281.236371 2281.231798 R H 494 517 PSM ADVSQELEEALAESR 807 sp|Q3T9X0|GTR9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3348.2 59.83853 3 1645.784471 1645.779509 K V 261 276 PSM IALGIPLPEIK 808 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3387.2 60.9395 2 1162.733047 1162.732546 K N 741 752 PSM YTPEQVAMATVTALHR 809 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3200.3 55.67138 3 1786.909271 1786.903604 K T 244 260 PSM PMILGYWNVR 810 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=1.1.3249.5 57.06613 2 1247.6495 1247.6480 M G 2 12 PSM TLGVDFIDVATK 811 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3210.7 55.96018 2 1277.687047 1277.686718 K V 1270 1282 PSM EESFGPIMIISR 812 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3284.9 58.05377 2 1377.697447 1377.696237 K F 803 815 PSM DMTSEELDDILR 813 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3364.12 60.30623 2 1435.651447 1435.650075 K Y 672 684 PSM TLVYGGIFLYPANK 814 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3343.5 59.70775 2 1554.845647 1554.844616 R K 256 270 PSM AAAIVGCIGVIAEVDK 815 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.3185.11 55.25905 2 1584.861247 1584.854529 K A 259 275 PSM VYFDLQIGDESVGR 816 sp|P24369|PPIB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3240.11 56.81883 2 1596.779247 1596.778387 K V 46 60 PSM YALNHPDTVEGLVLINIDPNAK 817 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3374.14 60.59428 3 2405.268371 2405.259075 R G 155 177 PSM ADVSQELEEALAESR 818 sp|Q3T9X0|GTR9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3351.16 59.93395 2 1645.785447 1645.779509 K V 261 276 PSM TGEGFLCVFAINNTK 819 sp|P32883|RASK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 7-UNIMOD:4 ms_run[1]:scan=1.1.3390.4 61.00943 2 1669.811647 1669.813392 R S 74 89 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 820 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 8-UNIMOD:4 ms_run[1]:scan=1.1.3248.14 57.04587 4 3609.836494 3609.815071 R S 178 213 PSM AVCMLSNTTAIAEAWAR 821 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 3-UNIMOD:4 ms_run[1]:scan=1.1.3343.3 59.70442 3 1863.902771 1863.897139 R L 374 391 PSM AISFVGSNQAGEYIFER 822 sp|Q9EQ20|MMSA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3220.20 56.2642 2 1886.915647 1886.916277 K G 256 273 PSM HGLTTGATLISDQWLLTTAK 823 sp|Q61646|HPT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3244.12 56.92912 3 2126.143871 2126.137169 R N 124 144 PSM SVHITFSSFENVEGLPAFR 824 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3385.5 60.8909 3 2136.071171 2136.064004 R Y 276 295 PSM ILLDQGQTHSVETPYGSVTFTVYGTPK 825 sp|Q9QYG0|NDRG2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3312.15 58.8459 3 2937.486371 2937.476004 R P 33 60 PSM LICCDILDVLDK 826 sp|P62259|1433E_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 3-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.3520.11 64.64985 2 1475.737247 1475.736388 K H 95 107 PSM ENTLNQLVGAAFGAAGQR 827 sp|Q9EQ20|MMSA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3503.2 64.173 3 1815.930071 1815.922760 K C 299 317 PSM ILPNVPEVEDSTDFFK 828 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3417.21 61.78036 2 1848.915847 1848.914546 R S 334 350 PSM SLRPGVAIADFVIFPPR 829 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3442.5 62.43008 3 1854.054971 1854.051589 K W 305 322 PSM SLRPGVAIADFVIFPPR 830 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3461.7 62.96172 3 1854.057971 1854.051589 K W 305 322 PSM LSVGLEDEQDLLEDLDR 831 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3613.21 67.32017 2 1957.951847 1957.948031 R A 375 392 PSM FLSQPFQVAEVFTGHMGK 832 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3411.10 61.5975 3 2022.010871 2022.003318 R L 463 481 PSM HEIIQTLQMTDGLIPLEIR 833 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3558.9 65.75622 3 2219.205671 2219.198389 R F 236 255 PSM WGEAGAEYVVESTGVFTTMEK 834 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3545.14 65.38133 3 2290.055171 2290.046365 K A 85 106 PSM RPIHLSFDVDGLDPAFTPATGTPVLGGLSYR 835 sp|Q61176|ARGI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3538.15 65.17815 4 3268.711694 3268.688063 K E 225 256 PSM SIFSAVLDELK 836 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3701.3 69.81107 2 1220.667247 1220.665255 R V 1090 1101 PSM ILLANFLAQTEALMK 837 sp|P06745|G6PI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3779.17 72.01933 2 1674.940447 1674.937864 K G 424 439 PSM NVFDEAILAALEPPEPK 838 sp|P60766|CDC42_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3767.6 71.69033 3 1851.968471 1851.961831 K K 167 184 PSM QGFIDLPEFPFGLEPR 839 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3779.20 72.02184 2 1860.946247 1860.941036 K V 259 275 PSM VTPGSTCAVFGLGGVGLSVIIGCK 840 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 7-UNIMOD:4,23-UNIMOD:4 ms_run[1]:scan=1.1.3738.10 70.87659 3 2348.233271 2348.223225 K A 190 214 PSM EQGYDVIAYLANIGQKEDFEEAR 841 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=1.1.3645.5 68.23186 3 2657.268671 2657.260926 K K 26 49 PSM QAGNNQPFTLDDVQYMIFHTPFCK 842 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:28,23-UNIMOD:4 ms_run[1]:scan=1.1.3814.7 72.99492 3 2853.2959 2853.2885 K M 283 307 PSM SELEQLRQEAEQLR 843 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:1 ms_run[1]:scan=1.1.3315.18 58.92503 2 1769.8936 1769.8903 M N 2 16 PSM SELEQLRQEAEQLR 844 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:1 ms_run[1]:scan=1.1.3308.9 58.73808 2 1769.8936 1769.8903 M N 2 16 PSM ASGVAVSDGVIK 845 sp|P18760|COF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 26 1-UNIMOD:1 ms_run[1]:scan=1.1.2776.7 43.64622 2 1143.6149 1143.6130 M V 2 14 PSM VNEAACDIAR 846 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 6-UNIMOD:4 ms_run[1]:scan=1.1.1932.20 19.86853 2 1117.517847 1117.518607 K Q 99 109 PSM TASTNSIAQAR 847 sp|Q9DAS9|GBG12_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.1774.21 15.38948 2 1118.566647 1118.568000 K R 5 16 PSM DSYVGDEAQSK 848 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.1879.20 18.36878 2 1197.515047 1197.514961 K R 51 62 PSM DGASEEETNLSK 849 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.1912.21 19.30402 2 1278.558647 1278.557555 K M 481 493 PSM HGGPADEERHVGDLGNVTAGK 850 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2061.18 23.49408 4 2115.016494 2115.009343 K D 72 93 PSM KVFIEDVSK 851 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2077.19 23.93867 2 1063.591847 1063.591361 K E 58 67 PSM VLEDNSALDR 852 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2107.16 24.77348 2 1130.557247 1130.556767 R M 487 497 PSM TAHIVLEDGTK 853 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.1948.11 20.30108 3 1182.624371 1182.624452 K M 45 56 PSM LATDAAQVQGATGTR 854 sp|P21440|MDR3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2115.21 25.00697 2 1458.743047 1458.742670 R L 814 829 PSM HQGSLYSLFPDHSVKK 855 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2309.6 30.45233 4 1841.951294 1841.942433 R Y 130 146 PSM TAAYVNAIEK 856 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2190.12 27.11147 2 1078.565647 1078.565875 R V 536 546 PSM LQNLQLQPGK 857 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2288.13 29.8825 2 1137.649847 1137.650607 K A 535 545 PSM CLGLTEAQTR 858 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 1-UNIMOD:4 ms_run[1]:scan=1.1.2189.16 27.08672 2 1147.565247 1147.565558 K E 920 930 PSM ASQRPDVLTTGGGNPIGDK 859 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2275.16 29.52982 3 1881.958571 1881.954454 R L 20 39 PSM EGASEEEINLSK 860 sp|Q8VCC2|EST1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2195.20 27.25843 2 1304.609447 1304.609590 K M 481 493 PSM LSMTNDPLEAAR 861 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:35 ms_run[1]:scan=1.1.2305.16 30.35708 2 1332.635047 1332.634366 K G 244 256 PSM ADIVENQVMDTR 862 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 9-UNIMOD:35 ms_run[1]:scan=1.1.2177.8 26.76408 2 1405.653847 1405.650744 R M 97 109 PSM LLSGEDVGQDEGATR 863 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2248.21 28.76447 2 1545.728047 1545.727080 R A 757 772 PSM GISEETTTGVHNLYK 864 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2287.21 29.8619 2 1647.813047 1647.810415 R M 152 167 PSM EQAGGDATENFEDVGHSTDAR 865 sp|P56395|CYB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2275.19 29.53232 3 2204.925371 2204.920647 R E 53 74 PSM IGGIGTVPVGR 866 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2447.11 34.30333 2 1024.603647 1024.602929 K V 256 267 PSM THINIVVIGHVDSGK 867 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2382.11 32.49938 3 1587.879671 1587.873290 K S 6 21 PSM SAVYIIENAK 868 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2420.9 33.55478 2 1106.596847 1106.597175 K R 123 133 PSM TIAQDYGVLK 869 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2505.13 35.9582 2 1106.598647 1106.597175 R A 111 121 PSM LVQEVTDFAK 870 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2537.12 36.83345 2 1148.608447 1148.607740 K T 66 76 PSM VVDALGNAIDGK 871 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2491.18 35.56256 2 1170.622447 1170.624452 R G 150 162 PSM IMGTSPLQIDR 872 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:35 ms_run[1]:scan=1.1.2421.12 33.58163 2 1245.641047 1245.638723 K A 1075 1086 PSM ELISNASDALDK 873 sp|P08113|ENPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2478.19 35.18865 2 1274.637847 1274.635411 R I 103 115 PSM YVSSLTEEISR 874 sp|Q9D0F3|LMAN1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2526.7 36.53107 2 1282.647247 1282.640496 R R 370 381 PSM GQNQPVLNITNR 875 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2342.19 31.38512 2 1352.717047 1352.716061 R Q 317 329 PSM AGQITNEALSNIR 876 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2480.18 35.24557 2 1385.726847 1385.726292 K T 936 949 PSM GLNSDSVTEETLR 877 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2391.21 32.75933 2 1419.685047 1419.684152 K K 893 906 PSM EVDEQMLNVQNK 878 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2404.20 33.12393 2 1445.683247 1445.682044 K N 325 337 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 879 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 10-UNIMOD:35,11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2456.20 34.56622 4 2948.410094 2948.394283 K L 176 205 PSM NHFTVAQAEAFDK 880 tr|K7N6K9|K7N6K9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2361.11 31.90248 3 1476.703271 1476.699743 K V 256 269 PSM LCAATATILDKPEDR 881 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.2395.13 32.86467 3 1672.853171 1672.845421 R V 23 38 PSM YCQLENAHLVVVTSR 882 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.2548.12 37.14553 3 1787.899871 1787.898853 K D 180 195 PSM TNVSGGAIALGHPLGGSGSR 883 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2373.16 32.2472 3 1806.942971 1806.933659 K I 341 361 PSM ILLLGAGESGK 884 sp|P27600|GNA12_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2654.6 40.16497 2 1056.618447 1056.617910 K S 58 69 PSM ARPFPDGLAEDIDKGEVSAR 885 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=1.1.2711.8 41.78627 4 2142.0812 2142.0702 K Q 606 626 PSM LEVGTETIIDK 886 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2603.14 38.69612 2 1216.654847 1216.655084 R S 127 138 PSM GVLFASGQNLAR 887 sp|Q9CPY7|AMPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2606.17 38.78582 2 1231.666047 1231.667320 K H 189 201 PSM IYVVDVGSEPR 888 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2573.14 37.85489 2 1232.640447 1232.640102 R A 104 115 PSM QVVDSAYEVIK 889 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2578.9 37.99497 2 1249.654047 1249.655418 K L 233 244 PSM FYDPDQGTVMIDGHDSK 890 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2555.17 37.34985 3 1923.831071 1923.830893 R K 1129 1146 PSM LGGEVSCLVAGTK 891 sp|Q99LC5|ETFA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.2559.14 37.46262 2 1289.665247 1289.664937 R C 47 60 PSM VNFVAGAVEPYK 892 tr|Q9JHF5|Q9JHF5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2705.15 41.62271 2 1292.678447 1292.676488 K A 168 180 PSM GNPTVEVDLYTAK 893 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2656.14 40.2298 2 1405.710247 1405.708910 R G 16 29 PSM APNSPDVLEIEFKK 894 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2729.3 42.2856 3 1585.839671 1585.835174 K G 216 230 PSM KADIGVAMGIVGSDVSK 895 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2734.10 42.43223 3 1645.880171 1645.870907 K Q 727 744 PSM RLGTLEVEDQIEAAR 896 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2632.14 39.53567 3 1698.891971 1698.890063 R Q 591 606 PSM HLEINPDHPIVETLR 897 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2570.16 37.77042 3 1781.946971 1781.942433 K Q 625 640 PSM SRDDSQLNGDPSALLNPSK 898 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2609.14 38.87029 3 2012.982971 2012.976312 K E 137 156 PSM ELVEPLTPSGEAPNQAHLR 899 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2571.20 37.80223 3 2057.059271 2057.054168 R I 689 708 PSM LACGVIGIAQ 900 sp|P08228|SODC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.2909.2 47.42342 2 1000.536047 1000.537552 R - 145 155 PSM TPFGAYGGLLK 901 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2949.4 48.54867 2 1122.605647 1122.607346 R D 15 26 PSM IINEPTAAAIAYGLDKR 902 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2864.13 46.13548 3 1814.993471 1814.989048 R E 199 216 PSM ADLINNLGTIAK 903 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2880.9 46.59308 2 1241.698047 1241.697952 K S 101 113 PSM LADMALALESAR 904 sp|Q07417|ACADS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2935.9 48.17517 2 1259.653847 1259.654372 K L 314 326 PSM GAAFLGLGTDSVR 905 sp|Q9DBE0|CSAD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2892.10 46.9429 2 1262.660447 1262.661900 K V 197 210 PSM STPAITLENPDIKYPLR 906 sp|Q9DCN2|NB5R3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2922.13 47.80565 3 1927.037471 1927.041478 R L 30 47 PSM LGGSAVISLEGKPL 907 sp|P18760|COF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2934.11 48.14952 2 1339.771047 1339.771117 K - 153 167 PSM TVLMNPNIASVQTNEVGLK 908 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 4-UNIMOD:35 ms_run[1]:scan=1.1.2883.14 46.68413 3 2043.073871 2043.067041 K Q 459 478 PSM AFAMTNQILVER 909 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2905.12 47.31705 2 1391.722447 1391.723121 K S 613 625 PSM GNDVLVIECNLR 910 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 9-UNIMOD:4 ms_run[1]:scan=1.1.2869.13 46.28078 2 1400.708047 1400.708199 K A 1248 1260 PSM IAVIGAGASGLTCIK 911 sp|P97872|FMO5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 13-UNIMOD:4 ms_run[1]:scan=1.1.2870.15 46.3113 2 1429.794847 1429.796286 R C 6 21 PSM KLNCQVIGASVDSHFCHLAWINTPK 912 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2910.17 47.46497 4 2894.444494 2894.431989 K K 68 93 PSM FRPSFPASSPYVTTVGGTSFK 913 sp|O89023|TPP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2935.15 48.18017 3 2232.129971 2232.121519 K N 373 394 PSM SIMISGNVLPDATR 914 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:35 ms_run[1]:scan=1.1.2809.18 44.58017 2 1488.761247 1488.760629 K F 238 252 PSM ACLGGLPSNAYAAIK 915 sp|Q9R013|CATF_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:4 ms_run[1]:scan=1.1.2839.16 45.41512 2 1504.773047 1504.770799 K N 310 325 PSM VIPLFSPQCGECR 916 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 9-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2869.17 46.28411 2 1561.740847 1561.738119 K I 90 103 PSM AVSIQTGYLIQSTGPK 917 sp|Q9JMD3|STA10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2821.19 44.90627 2 1661.902647 1661.898836 R S 164 180 PSM RIPGGPQMIQLSLDGK 918 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2865.9 46.16113 3 1708.933271 1708.929425 K R 382 398 PSM VITAFNDGLNHLDSLK 919 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2952.10 48.63605 3 1755.924371 1755.915549 K G 68 84 PSM IINEPTAAAIAYGLDKR 920 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2870.12 46.3088 3 1814.993471 1814.989048 R E 199 216 PSM GIVVGIKLDQGGAPLAGTNK 921 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2812.6 44.66017 3 1907.082671 1907.084011 K E 102 122 PSM KACGDSTLTQITAGLDPVGR 922 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.2939.4 48.28115 3 2059.039871 2059.036804 R I 23 43 PSM LCGSGFQSIVSGCQEICSK 923 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 2-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:4 ms_run[1]:scan=1.1.2893.18 46.97882 3 2115.941771 2115.938746 R D 91 110 PSM NHYQAEVFSVNFAESEEAK 924 sp|P07758|A1AT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2806.20 44.49547 3 2198.010071 2197.991627 K K 154 173 PSM SFEEIAAEFR 925 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3093.9 52.63622 2 1197.565247 1197.566603 K K 490 500 PSM LYFEELSLER 926 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3154.4 54.39775 2 1297.656447 1297.655418 K I 1030 1040 PSM IQFHNVKPECLDAYNSLTEAVLPK 927 sp|O55125|NIPS1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 10-UNIMOD:4 ms_run[1]:scan=1.1.3135.11 53.85898 4 2785.414494 2785.410902 K L 74 98 PSM TPWIEFENNYR 928 tr|Q8BGL3|Q8BGL3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3027.18 50.7739 2 1467.680447 1467.678279 R I 75 86 PSM SLEAACLALDVGYR 929 sp|Q8VC28|AK1CD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 6-UNIMOD:4 ms_run[1]:scan=1.1.3143.16 54.09465 2 1536.759847 1536.760629 K H 34 48 PSM ALDIAENEMPGLMR 930 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3123.15 53.51299 2 1558.747447 1558.748349 K M 21 35 PSM IINEPTAAAIAYGLDK 931 sp|P16627|HS71L_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3072.19 52.03685 2 1658.888447 1658.887937 R G 174 190 PSM NVQAEEMVEFSSGLK 932 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2982.20 49.48588 2 1666.788647 1666.787237 R G 89 104 PSM NSGNTLTMEVVEASMK 933 tr|B2RT89|B2RT89_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3054.11 51.53595 2 1709.800647 1709.796422 K N 310 326 PSM IEFEGQSVDFVDPNK 934 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3106.21 53.0265 2 1722.811447 1722.810081 K Q 183 198 PSM IFVEESVYDEFVKR 935 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3130.4 53.70813 3 1758.889271 1758.882852 R S 309 323 PSM VFLTTAEVISQQVSDK 936 sp|P06801|MAOX_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3082.21 52.32597 2 1763.927247 1763.930531 K H 477 493 PSM GVGIISEGNETVEDIAAR 937 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.2983.20 49.51415 2 1828.919847 1828.916671 K L 620 638 PSM EGSVMLQVDVDTVNGGLK 938 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3107.21 53.05572 2 1859.931047 1859.929879 R L 420 438 PSM YVRPGGGFEPNFTLFEK 939 sp|P11352|GPX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3091.10 52.57848 3 1956.979271 1956.973398 K C 96 113 PSM DATNVGDEGGFAPNILENK 940 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3097.21 52.7634 2 1959.919247 1959.917400 K E 203 222 PSM SPIYSHFSETVSGLPVIR 941 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3083.11 52.34647 3 1988.037971 1988.036727 K A 1155 1173 PSM NLQEILIGAVR 942 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3249.4 57.06447 2 1224.719647 1224.719021 R F 139 150 PSM LALDIEIATYR 943 tr|E9Q1Z0|E9Q1Z0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3223.9 56.3428 2 1276.702447 1276.702703 K K 434 445 PSM VVDLMAYMASKE 944 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3212.11 56.02205 2 1355.648847 1355.646510 R - 322 334 PSM DFSATDLTEFAAR 945 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3310.6 58.78687 2 1442.667447 1442.667774 K A 26 39 PSM VMEETFSYLLGR 946 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3313.7 58.86127 2 1443.706847 1443.706802 K K 211 223 PSM WLLAAAGVEFEEK 947 tr|E9Q6L7|E9Q6L7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3346.8 59.78845 2 1461.752047 1461.750381 R F 21 34 PSM SPLIIFADCDLNK 948 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 9-UNIMOD:4 ms_run[1]:scan=1.1.3235.16 56.68475 2 1504.759247 1504.759566 K A 678 691 PSM SLGQWLQEEKVPAIYGVDTR 949 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3301.9 58.54436 3 2288.189771 2288.180097 K M 148 168 PSM AAAIVGCIGVIAEVDK 950 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.3178.4 55.06937 2 1584.861247 1584.854529 K A 259 275 PSM ELLALEVFQVSHPR 951 sp|Q9WVL0|MAAI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3288.2 58.1643 3 1636.900271 1636.893691 K R 192 206 PSM ILCGEGVDQLSLPLR 952 sp|Q8BH00|AL8A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 3-UNIMOD:4 ms_run[1]:scan=1.1.3203.17 55.76733 2 1668.886847 1668.886892 R N 352 367 PSM GIGTDEATIIDIVTHR 953 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3334.6 59.45975 3 1709.899871 1709.894814 K S 378 394 PSM DGSIDLVINLPNNNTK 954 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3254.9 57.20798 2 1725.892247 1725.889728 R F 1429 1445 PSM LGTDESCFNMILATR 955 sp|Q07076|ANXA7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.3218.19 56.2049 2 1726.805047 1726.801842 R S 332 347 PSM LVVVDFSATWCGPCK 956 sp|P10639|THIO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 11-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3318.19 59.00948 2 1737.825847 1737.821849 K M 22 37 PSM LVVVDFSATWCGPCK 957 sp|P10639|THIO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 11-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3311.10 58.81548 2 1737.825847 1737.821849 K M 22 37 PSM FEDGDLTLYQSNAILR 958 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3257.15 57.29113 2 1853.916847 1853.915943 K H 56 72 PSM GFFVQPTVFSNVTDEMR 959 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 16-UNIMOD:35 ms_run[1]:scan=1.1.3340.6 59.6368 2 1988.931447 1988.930213 K I 379 396 PSM ILADSINSEVGILCHALQK 960 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 14-UNIMOD:4 ms_run[1]:scan=1.1.3362.10 60.24688 3 2080.101971 2080.098676 K I 432 451 PSM MGLINKEEVLLPLDNPYGK 961 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3224.9 56.37207 3 2142.147371 2142.139478 K I 272 291 PSM RPFTQNLGLEELGIELDPK 962 sp|O08749|DLDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3336.8 59.5174 3 2168.146871 2168.147734 R G 316 335 PSM DLYANTVLSGGTTMYPGIADR 963 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 14-UNIMOD:35 ms_run[1]:scan=1.1.3245.17 56.96197 3 2230.063871 2230.057599 K M 292 313 PSM QTQTFTTYSDNQPGVLIQVYEGER 964 sp|P17879|HS71B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3305.7 58.65485 3 2773.329071 2773.319504 K A 424 448 PSM IGPALSCGNTVVVKPAEQTPLTALHLASLIK 965 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.3369.17 60.45418 4 3197.807294 3197.784606 K E 180 211 PSM AVSNVIASLIYAR 966 sp|Q8CIM7|CP2DQ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3454.5 62.77563 2 1375.780047 1375.782350 K R 184 197 PSM TWTAADMAALITK 967 sp|P01901|HA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3417.11 61.77203 2 1391.710447 1391.711887 K H 153 166 PSM ANAIAWALAQIPQK 968 sp|P17717|UDB17_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3508.6 64.3098 2 1493.836447 1493.835448 K V 322 336 PSM GVDEVTIVNILTNR 969 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3524.18 64.77305 2 1541.843447 1541.841322 K S 50 64 PSM AVFVDLEPTVIDEVR 970 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3436.19 62.27493 2 1700.898047 1700.898502 R T 65 80 PSM MQLIMLCYNPDFEK 971 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 7-UNIMOD:4 ms_run[1]:scan=1.1.3458.15 62.88957 2 1800.823247 1800.824885 R Q 109 123 PSM SLRPGVAIADFVIFPPR 972 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3473.10 63.31392 3 1854.057971 1854.051589 K W 305 322 PSM LGLDFPNLPYLIDGSHK 973 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3600.12 66.93053 3 1898.004971 1897.993799 K I 53 70 PSM STVNTAVALTLACFGTQR 974 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 13-UNIMOD:4 ms_run[1]:scan=1.1.3419.7 61.82593 3 1908.983171 1908.972747 K E 291 309 PSM SGDAAIVDMVPGKPMCVESFSDYPPLGR 975 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 16-UNIMOD:4 ms_run[1]:scan=1.1.3422.9 61.91882 3 2994.401471 2994.392551 K F 396 424 PSM AADFPQELFSWE 976 tr|Q8BGL3|Q8BGL3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3813.8 72.9657 2 1438.640447 1438.640496 K - 271 283 PSM DFLIPVAWYEDR 977 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3740.7 70.92699 2 1522.749247 1522.745630 R R 226 238 PSM EIPGIYVLSLEIGK 978 sp|O88531|PPT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3698.5 69.73385 2 1529.876447 1529.870496 K N 61 75 PSM EVSVFGAVSELFTR 979 sp|P38060|HMGCL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3763.13 71.58165 2 1539.796247 1539.793309 K K 123 137 PSM DIGDEINVFYTIR 980 sp|Q3V3R4|ITA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3646.4 68.24873 2 1553.771847 1553.772573 K K 977 990 PSM DIQQWEYVPLGPFLGK 981 sp|P35505|FAAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3778.15 71.99177 2 1888.976447 1888.972336 R S 238 254 PSM QAGLAQIAPDLTLVQFVK 982 sp|Q8BXB6|SO2B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3705.7 69.932 2 1911.085647 1911.082949 K V 330 348 PSM LNAGEVVIGDGGFVFALEK 983 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3661.20 68.68085 2 1934.017847 1934.014929 R R 17 36 PSM QADAVYFLPITPQFVTEVIK 984 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3800.9 72.59866 3 2278.232771 2278.224922 K A 478 498 PSM GLAFIQDPDGYWIEILNPNK 985 sp|Q9CPU0|LGUL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3791.2 72.3641 3 2302.166171 2302.163384 K I 160 180 PSM GKLPPGPTPLPIIGNFLQIDVK 986 sp|Q64458|CP2CT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3705.4 69.92281 3 2313.350471 2313.346040 R N 27 49 PSM TLLEGSGLESIINIIHSSLAEPR 987 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3798.7 72.54868 3 2448.329471 2448.322404 R V 2476 2499 PSM AAIYLLDDPLAALDAHVSQQVFK 988 sp|Q9R1S7|MRP6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3718.14 70.29462 3 2497.330271 2497.321676 K Q 769 792 PSM ELGAFGLQVPSELGGLGLSNTQYAR 989 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3717.20 70.27052 3 2576.332271 2576.323467 K L 139 164 PSM AANEAGYFNEEMAPIEVK 990 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3045.13 51.28227 3 1981.905371 1981.909143 K T 192 210 PSM MQLIMLCYNPDFEK 991 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 1-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3250.7 57.1006 2 1816.826247 1816.819800 R Q 109 123 PSM VNTNYRPGLPFSGQVLLVDEK 992 sp|Q61838|PZP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3126.16 53.60128 3 2345.240771 2345.237946 K G 354 375 PSM LADVLEQSLEELAQAESK 993 sp|Q8BH00|AL8A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3746.16 71.09383 2 1972.002247 1972.000067 R D 76 94 PSM SVTELNGDTITNTMTLGDIVYKR 994 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=1.1.3329.17 59.32417 3 2541.272471 2540.279219 K V 100 123 PSM VIVVGNPANTNCLTASK 995 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 25 12-UNIMOD:4 ms_run[1]:scan=1.1.2595.13 38.46332 3 1756.915571 1756.914169 K S 126 143 PSM SADAAAGEPLPR 996 sp|P70441|NHRF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.2522.5 36.425 2 1195.5839 1195.5828 M L 2 14 PSM ASLSLAPVNIFK 997 sp|P80314|TCPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.3771.5 71.79912 2 1301.7362 1300.7382 M A 2 14 PSM QATVGDVNTDRPGLLDLK 998 sp|P31786|ACBP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:28 ms_run[1]:scan=1.1.3080.21 52.2685 2 1893.9805 1893.9791 K G 34 52 PSM AQAPTVIVTQPGFVR 999 sp|Q9JI48|PLAC8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 25 1-UNIMOD:1 ms_run[1]:scan=1.1.3339.7 59.60732 2 1624.8880 1624.8932 M A 2 17 PSM HIGYDDSAK 1000 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1682.14 12.8163 2 1004.453447 1004.456324 K G 90 99 PSM KHGGPADEER 1001 sp|P08228|SODC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1536.18 8.761884 2 1094.510447 1094.510485 K H 71 81 PSM GKDTTEGDTPER 1002 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1551.21 9.179234 2 1304.586247 1304.584438 K T 671 683 PSM AHVTHHSRPEDK 1003 sp|P01901|HA1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1533.6 8.6766 3 1412.692571 1412.690909 K V 208 220 PSM KVSVEPQDSHQDAQPR 1004 sp|Q8BXB6|SO2B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1718.21 13.81538 3 1819.882571 1819.881289 R G 19 35 PSM LSGTGSAGATIR 1005 sp|Q9D0F9|PGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.1900.19 18.95885 2 1089.576447 1089.577836 R L 504 516 PSM ITQSNAILR 1006 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2073.15 23.82548 2 1014.581047 1014.582194 K Y 70 79 PSM VTLTPEEEAR 1007 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2126.15 25.31792 2 1143.577247 1143.577168 K L 306 316 PSM QAASSLQQASLK 1008 sp|P38647|GRP75_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2036.18 22.7874 2 1230.654847 1230.656815 R L 635 647 PSM HVLGVPLDDRK 1009 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2045.9 23.03252 3 1247.700971 1247.698620 R A 44 55 PSM VDNSSLTGESEPQTR 1010 sp|Q64436|ATP4A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2054.21 23.29605 2 1618.745247 1618.743458 K S 222 237 PSM AFEEEQALR 1011 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2226.12 28.13025 2 1091.524447 1091.524738 K G 370 379 PSM DELHHSGWNTCSSCFGDSTK 1012 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.2283.15 29.74693 4 2323.930494 2323.922244 K S 70 90 PSM QHGIPIPVTPK 1013 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2281.11 29.68902 2 1185.687647 1185.686993 K S 166 177 PSM AIQDAGCQVLK 1014 sp|P40936|INMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 7-UNIMOD:4 ms_run[1]:scan=1.1.2240.18 28.53358 2 1201.612247 1201.612508 K C 225 236 PSM YSTDVSVDEVK 1015 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2304.11 30.3284 2 1240.582047 1240.582313 R A 152 163 PSM SDANTDLIGGSPK 1016 sp|P53986|MOT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2201.20 27.42523 2 1273.613647 1273.615010 K G 220 233 PSM ASDETGFIAVHK 1017 sp|P34914|HYES_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2168.20 26.51357 2 1273.627847 1273.630266 R A 409 421 PSM VNADEVGGEALGR 1018 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2295.17 30.07848 2 1285.626047 1285.626243 K L 19 32 PSM VIMVTGDHPITAK 1019 sp|Q64436|ATP4A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2231.11 28.27303 3 1380.748271 1380.743522 R A 622 635 PSM IWHHTFYNELR 1020 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2305.11 30.34873 3 1514.744471 1514.741882 K V 85 96 PSM IGGHGAEYGAEALER 1021 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2190.11 27.11063 3 1528.729571 1528.727020 K M 18 33 PSM GLNSDSVTEETLRK 1022 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2158.10 26.23557 2 1547.780247 1547.779115 K A 893 907 PSM AMLSTGFKIPQK 1023 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2522.2 36.41498 3 1319.729471 1319.727143 K G 1349 1361 PSM AAVSGLWGK 1024 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2418.6 33.49503 2 887.488447 887.486502 K V 10 19 PSM AAVSGLWGK 1025 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2425.5 33.68275 2 887.488447 887.486502 K V 10 19 PSM AHGGYSVFAGVGER 1026 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2353.8 31.67435 3 1405.674371 1405.673862 K T 226 240 PSM LAANAFLAQR 1027 sp|O70475|UGDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2551.11 37.22995 2 1073.597447 1073.598178 K I 221 231 PSM FIGPSPEVVR 1028 sp|Q05920|PYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2511.4 36.11823 2 1099.604647 1099.602595 R K 138 148 PSM QNLIAEVSTK 1029 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2419.8 33.52782 2 1101.604047 1101.602989 K D 198 208 PSM IATEAIENIR 1030 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2425.13 33.6911 2 1128.615447 1128.613888 K T 892 902 PSM TYFQGSLPAR 1031 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2444.11 34.21857 2 1138.577447 1138.577108 K A 98 108 PSM EITALAPSTMK 1032 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2466.14 34.84227 2 1160.612247 1160.611110 K I 316 327 PSM DGVANVSIEDR 1033 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2349.16 31.572 2 1173.562047 1173.562580 K V 93 104 PSM LLEAAITPQTK 1034 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2432.16 33.88578 2 1183.684247 1183.681239 K L 141 152 PSM IMDPNIVGNEHYDVAR 1035 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 2-UNIMOD:35 ms_run[1]:scan=1.1.2448.14 34.33378 3 1857.877871 1857.867947 R G 407 423 PSM VPAINVNDSVTK 1036 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2365.18 32.02097 2 1255.678647 1255.677216 K S 175 187 PSM VAEEWAQGTFK 1037 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2541.14 36.94963 2 1264.610847 1264.608802 K L 70 81 PSM LLFEGAGSNPGDK 1038 sp|P51863|VA0D1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2480.16 35.24389 2 1303.642247 1303.640831 K T 276 289 PSM VTQPEVDTPLGR 1039 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2416.8 33.44715 2 1310.685847 1310.683030 K V 34 46 PSM GILAADESTGSIAK 1040 tr|A6ZI47|A6ZI47_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2412.20 33.3434 2 1331.697447 1331.693260 K R 29 43 PSM LLNDEDQVVVNK 1041 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2378.18 32.39153 2 1384.722047 1384.719809 K A 159 171 PSM GYDVIAQAQSGTGK 1042 sp|P10630|IF4A2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2355.19 31.73933 2 1393.685447 1393.683758 K T 70 84 PSM QLVCPAEDLPQK 1043 sp|P31649|S6A13_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.2454.18 34.50687 2 1396.704047 1396.702051 R N 566 578 PSM VAGYAAQLEQYQK 1044 sp|Q9DB05|SNAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2539.19 36.89707 2 1467.736847 1467.735794 K A 168 181 PSM SLRNDIGATVHELSR 1045 sp|P16331|PH4H_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2498.12 35.75645 3 1666.879871 1666.875081 K D 97 112 PSM INGEWHTIILASDKR 1046 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2520.17 36.37095 3 1751.936471 1751.931868 K E 34 49 PSM EAAQMDMVNDGVEDLRGK 1047 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 7-UNIMOD:35 ms_run[1]:scan=1.1.2434.19 33.94333 3 1992.896771 1992.888091 R Y 86 104 PSM VVDALGNAIDGKGPIGSK 1048 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2581.8 38.07003 3 1709.933171 1709.931199 R T 150 168 PSM IMGTSPLQIDR 1049 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2622.14 39.24562 2 1229.645047 1229.643808 K A 1075 1086 PSM IVEIPFNSTNK 1050 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2665.15 40.49235 2 1260.673047 1260.671403 K Y 477 488 PSM GQIIKDIEPGSPAEAAGLK 1051 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2638.15 39.71057 3 1893.027671 1893.020743 K N 265 284 PSM STSIIATIGPASR 1052 sp|P53657|KPYR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2630.16 39.47947 2 1272.703647 1272.703765 R S 87 100 PSM DFTPAAQAAFQK 1053 tr|A8DUK4|A8DUK4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2621.15 39.21743 2 1293.635647 1293.635351 K V 122 134 PSM AYLMSQPLAYHTPDCGK 1054 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 15-UNIMOD:4 ms_run[1]:scan=1.1.2641.18 39.79988 3 1950.908471 1950.896805 K Q 242 259 PSM HTTIFEVLPEK 1055 sp|Q921I1|TRFE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2645.16 39.91393 2 1312.704047 1312.702703 K A 226 237 PSM LRGEDGESECVINYVEK 1056 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:4 ms_run[1]:scan=1.1.2559.15 37.46345 3 1995.924371 1995.920771 K A 395 412 PSM YALYDATYETK 1057 sp|P18760|COF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2563.16 37.57813 2 1336.617247 1336.618698 R E 82 93 PSM HFSVEGQLEFR 1058 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2615.13 39.042 2 1347.656847 1347.657149 K A 329 340 PSM CLYASVLTAQPR 1059 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 1-UNIMOD:4 ms_run[1]:scan=1.1.2751.17 42.92853 2 1377.709047 1377.707471 R L 728 740 PSM YYVTIIDAPGHR 1060 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2556.5 37.3686 3 1403.721971 1403.719750 K D 85 97 PSM LTGFHETSNINDFSAGVANR 1061 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2674.9 40.74813 3 2149.028171 2149.018845 R G 300 320 PSM LQAGTVFVNTYNK 1062 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2610.19 38.90339 2 1453.756847 1453.756529 K T 853 866 PSM MLLEYTDSSYDEK 1063 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2732.20 42.38363 2 1592.694047 1592.691605 R R 19 32 PSM DTCFSTEGPNLVTR 1064 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 3-UNIMOD:4 ms_run[1]:scan=1.1.2735.19 42.46855 2 1595.728247 1595.724971 K C 589 603 PSM LGDVYVNDAFGTAHR 1065 sp|P09041|PGK2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2626.9 39.35778 3 1633.790171 1633.784869 K A 157 172 PSM KIIVDTYGGWGAHGGGAFSGK 1066 sp|Q3THS6|METK2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2582.11 38.10615 3 2077.040471 2077.038124 R D 265 286 PSM SGYQQAASEHGLVVIAPDTSPR 1067 sp|Q9R0P3|ESTD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2641.21 39.80238 3 2282.136971 2282.129124 K G 65 87 PSM AVNHVCNPLCSSEGCWGPEPR 1068 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 6-UNIMOD:4,10-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.2660.20 40.35126 3 2425.040771 2425.036169 K D 501 522 PSM FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR 1069 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2699.19 41.45238 5 3697.683618 3697.651690 K E 40 74 PSM FLEEHPGGEEVLREQAGGDATENFEDVGHSTDAR 1070 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2696.20 41.36673 5 3697.683618 3697.651690 K E 40 74 PSM VVDLLAPYAK 1071 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2898.4 47.11262 2 1087.627647 1087.627747 K G 189 199 PSM TSATWFALSR 1072 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2902.5 47.22713 2 1138.575647 1138.577108 K I 414 424 PSM QAFQIGSPWR 1073 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2877.9 46.5059 2 1188.602447 1188.603992 R T 69 79 PSM IINEPTAAAIAYGLDKR 1074 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2863.9 46.10318 3 1814.993471 1814.989048 R E 199 216 PSM IINEPTAAAIAYGLDKR 1075 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2864.12 46.13465 3 1814.993471 1814.989048 R E 199 216 PSM GQTLVVQFTVK 1076 sp|P14211|CALR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2834.10 45.26608 2 1218.696447 1218.697223 K H 88 99 PSM TTIVENVGSVEGLAYHR 1077 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2823.8 44.95198 3 1843.947371 1843.942827 R G 2277 2294 PSM KYPLLLDVYAGPCSQK 1078 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:4 ms_run[1]:scan=1.1.2950.6 48.57762 3 1850.963171 1850.960057 K A 533 549 PSM FLASVSTVLTSK 1079 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2912.12 47.51875 2 1251.708647 1251.707454 K Y 129 141 PSM FLPGFEAPTYK 1080 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2941.4 48.33498 2 1268.642847 1268.644125 R D 156 167 PSM IAATILTSPDLR 1081 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2855.13 45.87765 2 1269.729447 1269.729252 R K 326 338 PSM IDVVVNNAGILR 1082 sp|P51660|DHB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2854.11 45.8476 2 1281.739647 1281.740485 R D 93 105 PSM YLGTQPEPDIVGLDSGHIR 1083 sp|P52196|THTR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2871.14 46.33888 3 2066.044871 2066.043269 R G 188 207 PSM AFAMTNQILVER 1084 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2895.15 47.03456 2 1391.722447 1391.723121 K S 613 625 PSM IADQCPSSLAIQENANALAR 1085 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.2820.10 44.87905 3 2141.058671 2141.053516 R Y 154 174 PSM LTYSTEVFLDGGK 1086 sp|O08601|MTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2941.8 48.34417 2 1428.704247 1428.713661 K G 36 49 PSM VAGMDVELTVEER 1087 sp|P62259|1433E_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2822.20 44.93438 2 1446.702047 1446.702445 K N 30 43 PSM ARFEELNADLFR 1088 sp|P17156|HSP72_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2862.3 46.06928 3 1479.751271 1479.747027 R G 303 315 PSM GLIDEANQDFTNR 1089 sp|E9PV24|FIBA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2761.17 43.2187 2 1491.699647 1491.695386 K I 73 86 PSM HNDDEQYAWESSAGGSFTVR 1090 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2767.20 43.39598 3 2254.961471 2254.951553 K T 154 174 PSM CSGIASAAATAVEVAR 1091 sp|Q91X91|NADC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 1-UNIMOD:4 ms_run[1]:scan=1.1.2774.19 43.5991 2 1532.764847 1532.761691 R S 111 127 PSM LGDVISIQPCPDVK 1092 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:4 ms_run[1]:scan=1.1.2854.19 45.85428 2 1539.796047 1539.796680 R Y 96 110 PSM TPNLSPEEEQLALR 1093 sp|Q8VC12|HUTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2771.20 43.51273 2 1595.817647 1595.815501 R N 33 47 PSM IAPSFAVESMEDALK 1094 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:35 ms_run[1]:scan=1.1.2791.17 44.07825 2 1622.787047 1622.786175 K A 561 576 PSM QVIDCQLADVNNLGK 1095 sp|Q9CPY7|AMPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.2820.11 44.88072 2 1685.843647 1685.840670 R Y 441 456 PSM TITLEVEPSDTIENVK 1096 tr|A0A0A6YW67|A0A0A6YW67_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2959.19 48.83898 2 1786.918047 1786.920025 K A 12 28 PSM DIAFEVEDCDHIVQK 1097 sp|P49429|HPPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 9-UNIMOD:4 ms_run[1]:scan=1.1.2792.15 44.10542 2 1816.831647 1816.830165 K A 95 110 PSM SIYGEKFEDENFILK 1098 sp|P17742|PPIA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2955.7 48.71684 3 1830.906371 1830.903981 R H 77 92 PSM AIAEELAPERGFLPPASEK 1099 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2846.17 45.61898 3 2024.061671 2024.057856 R H 309 328 PSM FLHDPSATQGFVGCALSSNIQR 1100 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 14-UNIMOD:4 ms_run[1]:scan=1.1.2933.19 48.12877 3 2404.164671 2404.159378 R F 255 277 PSM AGLILFGNDDR 1101 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2992.9 49.7643 2 1189.608047 1189.609137 K M 275 286 PSM AIGLPEDLIQK 1102 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2969.10 49.1092 2 1195.678047 1195.681239 K G 21 32 PSM AIGLPEDLIQK 1103 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2975.10 49.27767 2 1195.678047 1195.681239 K G 21 32 PSM DLQILAEFHEK 1104 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2987.11 49.62155 2 1341.692047 1341.692866 K T 145 156 PSM ILGLAIESQDAGIK 1105 sp|O09044|SNP23_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3014.12 50.39685 2 1426.802047 1426.803145 R T 27 41 PSM TWTAADMAAQITR 1106 sp|P01897|HA1L_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3008.15 50.22353 2 1434.688847 1434.692549 K R 156 169 PSM VNLLSFTGSTQVGK 1107 sp|Q9DBF1|AL7A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3027.17 50.77307 2 1449.781047 1449.782744 R E 267 281 PSM VGLELIASENFASR 1108 sp|P50431|GLYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3159.5 54.53697 2 1504.788847 1504.788558 R A 40 54 PSM VVLDDKDYFLFR 1109 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3118.4 53.35952 3 1528.795571 1528.792580 K D 81 93 PSM LTLLEVGCGTGANFK 1110 tr|G3X9G9|G3X9G9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.3050.4 51.42185 2 1578.805847 1578.807579 K F 72 87 PSM AVLVDLEPGTMDSVR 1111 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3066.16 51.8624 2 1600.812247 1600.813058 R S 63 78 PSM MSPEEFTEIMNQR 1112 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3157.10 54.49117 2 1610.707047 1610.706878 R E 455 468 PSM MSPEEFTEIMNQR 1113 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3150.18 54.30077 2 1610.707047 1610.706878 R E 455 468 PSM ALSAIAELLTSEHER 1114 sp|P30999|CTND1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3086.4 52.42805 3 1638.857771 1638.857700 K V 711 726 PSM AAVEEGIVLGGGCALLR 1115 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:4 ms_run[1]:scan=1.1.3170.18 54.85328 2 1683.898847 1683.897791 R C 430 447 PSM ETTDTDTADQVIASFK 1116 sp|P57780|ACTN4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3049.13 51.39822 2 1740.803247 1740.805390 R V 839 855 PSM IHLISMQSTIPYALR 1117 sp|Q8VCM7|FIBG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3077.4 52.1682 3 1741.959071 1741.954912 K I 258 273 PSM VCLIGCGFSTGYGSAVK 1118 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 2-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2972.18 49.19952 2 1774.841047 1774.838227 K V 170 187 PSM YQLQSQENFEPFMK 1119 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3012.21 50.34575 2 1787.822047 1787.818872 K A 7 21 PSM AINPENGFFGVAPGTSVK 1120 sp|Q9Z2V4|PCKGC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3056.9 51.5873 2 1803.911247 1803.915549 R T 325 343 PSM VLDSGAPIKIPVGPETLGR 1121 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3016.11 50.4546 3 1918.093871 1918.088763 K I 125 144 PSM GQSFSVWIICEGHCFK 1122 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3152.5 54.34778 3 1953.889871 1953.886574 R V 301 317 PSM HNQLPLVIEFTEQTAPK 1123 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3124.10 53.53795 3 1964.042771 1964.036727 K I 233 250 PSM ATEIGGILVNTPEDPNLSK 1124 sp|P34914|HYES_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3093.21 52.64622 2 1967.019047 1967.021136 K I 421 440 PSM LIVDEAINEDNSVVSLSQPK 1125 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3157.8 54.48783 3 2169.125171 2169.116494 R M 26 46 PSM AVLDVAETGTEAAAATGVIGGIRK 1126 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3098.15 52.7875 3 2269.231871 2269.227775 K A 361 385 PSM QFYDQALQQAVMDDDANNAK 1127 sp|P35762|CD81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3100.16 52.84655 3 2284.010771 2284.006625 K A 125 145 PSM TAACLAAGNTVVIKPAQVTPLTALK 1128 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 4-UNIMOD:4 ms_run[1]:scan=1.1.3049.12 51.39653 3 2507.419571 2507.414531 K F 584 609 PSM AYHEQLSVAEITNACFEPANQMVK 1129 sp|P05213|TBA1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 15-UNIMOD:4 ms_run[1]:scan=1.1.3076.21 52.15367 3 2749.292171 2749.283987 K C 281 305 PSM LALDIEITTYR 1130 sp|P11679|K2C8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3174.6 54.96022 2 1306.714847 1306.713267 K K 388 399 PSM PPYTIVYFPVR 1131 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=1.1.3238.5 56.75767 2 1350.7347 1350.7331 M G 2 13 PSM DLDVAVLVGSMPR 1132 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:35 ms_run[1]:scan=1.1.3232.2 56.59195 2 1386.719847 1386.717701 K R 80 93 PSM DMTSEELDDILR 1133 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 2-UNIMOD:35 ms_run[1]:scan=1.1.3179.9 55.09283 2 1451.641047 1451.644990 K Y 672 684 PSM VFVPTGYSAFPSEILHAPEK 1134 sp|Q9D379|HYEP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3254.6 57.20213 3 2188.128671 2188.120457 K W 392 412 PSM LIPPFHAASAQLTSLVDADAR 1135 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3263.9 57.44533 3 2192.165771 2192.158967 R A 394 415 PSM WLLAAAGVEFEEK 1136 tr|E9Q6L7|E9Q6L7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3339.4 59.59982 2 1461.752047 1461.750381 R F 21 34 PSM LLAAGLQCSALLLR 1137 sp|Q9DBE0|CSAD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.3264.11 57.4745 2 1497.870847 1497.870119 K D 306 320 PSM SPLIIFADCDLNK 1138 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 9-UNIMOD:4 ms_run[1]:scan=1.1.3228.14 56.4921 2 1504.759247 1504.759566 K A 678 691 PSM GTMLGKIEFEGQSVDFVDPNK 1139 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3205.14 55.82168 3 2310.126071 2310.120199 K Q 177 198 PSM VEIEAIAVQGPFIKA 1140 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3336.14 59.52242 2 1583.891247 1583.892294 R - 121 136 PSM SHIGVVPQDTVLFNDTIANNIR 1141 sp|Q9DC29|ABCB6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3198.17 55.62695 3 2422.267271 2422.260472 R Y 664 686 PSM GAGTDEGCLIEILASR 1142 sp|P97429|ANXA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 8-UNIMOD:4 ms_run[1]:scan=1.1.3401.16 61.31277 2 1660.811047 1660.809035 K T 101 117 PSM LLGNMIVIVLGHHLGK 1143 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3312.2 58.83005 4 1713.018494 1713.012367 R D 106 122 PSM VIGNQSLVNELTFSAR 1144 sp|O35459|ECH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3183.6 55.20692 2 1746.929447 1746.926448 K K 214 230 PSM QDVDVWLWQQEGSSK 1145 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3209.21 55.94265 2 1803.844847 1803.842778 R V 224 239 PSM PGGASPMGYDFWYQPR 1146 sp|Q63836|SBP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3253.8 57.18363 2 1827.807247 1827.803890 K H 180 196 PSM MSINAEDVVVGDLVEVK 1147 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 1-UNIMOD:35 ms_run[1]:scan=1.1.3282.20 58.0043 2 1831.927247 1831.923731 K G 178 195 PSM ILFIFIDSDHTDNQR 1148 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3207.8 55.87387 3 1832.912471 1832.905713 K I 288 303 PSM TVMDDFAQFLDTCCK 1149 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 3-UNIMOD:35,13-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3314.12 58.8985 2 1865.763047 1865.763408 K A 570 585 PSM EAPFTHFDPSCLFPACR 1150 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3364.9 60.30373 3 2050.909871 2050.902953 K D 172 189 PSM GSSHQVEYEILFPGCVLR 1151 tr|Q5SQ27|Q5SQ27_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 15-UNIMOD:4 ms_run[1]:scan=1.1.3184.2 55.22297 3 2090.035871 2090.025511 R W 288 306 PSM LGQSVTTIPTVGFNVETVTYK 1152 sp|P62331|ARF6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3341.8 59.6587 3 2253.193271 2253.189265 K N 35 56 PSM HVDTAYAYQVEEEIGQAIQSK 1153 sp|Q8VC28|AK1CD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3372.15 60.53819 3 2378.145371 2378.139020 R I 48 69 PSM LTLYDIAHTPGVAADLSHIETR 1154 sp|P08249|MDHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3276.3 57.8135 4 2392.248094 2392.238674 R A 53 75 PSM SAYALGGLGSGICPNKETLIDLGTK 1155 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:4 ms_run[1]:scan=1.1.3206.16 55.8518 3 2534.312171 2534.305040 R A 588 613 PSM SPWSMDENLMHISYEAGILENPK 1156 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:35 ms_run[1]:scan=1.1.3365.17 60.33917 3 2676.225971 2676.219990 K N 177 200 PSM QTQTFTTYSDNQPGVLIQVYEGER 1157 sp|P17879|HS71B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3312.14 58.84423 3 2773.329071 2773.319504 K A 424 448 PSM VSDAISTQYPVVDHEFDAVVVGAGGAGLR 1158 sp|Q8K2B3|SDHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3394.7 61.12123 3 2928.474371 2928.461751 K A 47 76 PSM AFLTLAEDILR 1159 sp|P61027|RAB10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3622.9 67.5751 2 1260.709247 1260.707788 K K 162 173 PSM IPAFGSIPIEFR 1160 sp|Q00519|XDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3427.6 62.02702 2 1345.736847 1345.739423 K V 1232 1244 PSM GIDYEIVPINLIK 1161 sp|Q9WVL0|MAAI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3555.14 65.67374 2 1485.846847 1485.844282 K D 28 41 PSM LVSDEMVVELIEK 1162 sp|Q9WTP6|KAD2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3453.6 62.74355 2 1502.791247 1502.790197 K N 73 86 PSM VINVNLIGTFNVIR 1163 sp|O08756|HCD2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3532.16 65.00623 2 1570.922647 1570.919512 R L 117 131 PSM SLNSEMDNILANLR 1164 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3559.15 65.79052 2 1588.789247 1588.787906 K L 647 661 PSM EFADSLGVPFLETSAK 1165 sp|Q9D1G1|RAB1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3509.7 64.3468 2 1709.851447 1709.851218 K N 138 154 PSM LLYECNPIAYVMEK 1166 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.3435.18 62.24667 2 1741.845847 1741.841915 R A 278 292 PSM SLRPGVAIADFVIFPPR 1167 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3467.9 63.13735 3 1854.057971 1854.051589 K W 305 322 PSM AYGAGLLSSFGELQYCLSDKPK 1168 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 16-UNIMOD:4 ms_run[1]:scan=1.1.3423.6 61.9407 3 2403.185171 2403.178048 K L 342 364 PSM IASVTDIPEEFHVSLLTPTPNPK 1169 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3427.8 62.03202 3 2504.323871 2504.316256 K A 1234 1257 PSM ITGTNAEVMPAQWEFQIGPCEGIR 1170 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 20-UNIMOD:4 ms_run[1]:scan=1.1.3505.14 64.23911 3 2703.288671 2703.278507 K M 190 214 PSM SSRPVFDWKDPLILEEQLTADEK 1171 sp|Q60759|GCDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=1.1.3431.7 62.13488 3 2715.3862 2715.3752 K L 43 66 PSM LMASLLPIQLFPK 1172 tr|Q8BGL3|Q8BGL3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3738.8 70.87325 2 1469.871247 1469.867994 R S 95 108 PSM MGISVLEALGDGEFIK 1173 sp|Q9Z2V4|PCKGC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3717.17 70.268 2 1677.864047 1677.864759 R C 176 192 PSM GLGTDEDSILNLLTSR 1174 sp|P48036|ANXA5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3714.16 70.17995 2 1702.878047 1702.873744 K S 28 44 PSM MNWTGLYTLLSGVNR 1175 sp|P28230|CXB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3751.21 71.23598 2 1723.879047 1723.871576 - H 1 16 PSM TLGGILAPVYYGALIDR 1176 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3695.8 69.66077 2 1791.002447 1790.993071 R T 577 594 PSM TGLLSGLDIMEVNPTLGK 1177 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3679.20 69.19452 2 1856.995047 1856.991751 K T 267 285 PSM MVNVFLGIPFAQAPLGPLR 1178 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 1-UNIMOD:35 ms_run[1]:scan=1.1.3770.5 71.76891 3 2055.141371 2055.133939 R F 59 78 PSM GIGETPIVPLGVSYIDDFAK 1179 sp|Q9JJL3|SO1B2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3725.9 70.4955 3 2090.100671 2090.093573 R E 177 197 PSM SDVLNALEEVIENPFYKK 1180 sp|P17717|UDB17_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3738.6 70.8699 3 2107.085171 2107.083737 K N 424 442 PSM IETELRDICNDVLSLLEK 1181 sp|P63101|1433Z_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 9-UNIMOD:4 ms_run[1]:scan=1.1.3752.17 71.26168 3 2159.123471 2159.114385 K F 86 104 PSM ALLELQLEPEELYQTFQR 1182 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3733.14 70.7359 3 2219.152871 2219.147400 R I 163 181 PSM ELEAVCQDVLSLLDNYLIK 1183 sp|P61982|1433G_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 6-UNIMOD:4 ms_run[1]:scan=1.1.3891.14 75.08022 3 2234.156171 2234.150436 K N 92 111 PSM NMITGTSQADCAVLIVAAGVGEFEAGISK 1184 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:4 ms_run[1]:scan=1.1.3825.21 73.29622 3 2908.454471 2908.431045 K N 101 130 PSM TTSLELFMYLNEVAGK 1185 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 8-UNIMOD:35 ms_run[1]:scan=1.1.3701.3 69.81107 3 1830.916871 1830.907353 R H 245 261 PSM THINIVVIGHVDSGK 1186 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2370.21 32.16622 2 1587.871047 1587.873290 K S 6 21 PSM MLLEYTDSSYDEK 1187 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 1-UNIMOD:35 ms_run[1]:scan=1.1.2563.21 37.5823 2 1608.683247 1608.686520 R R 19 32 PSM SSIKVECVLR 1188 sp|Q64374|RGN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1,7-UNIMOD:4 ms_run[1]:scan=1.1.2675.5 40.77017 2 1231.6597 1231.6589 M E 2 12 PSM QPDGIAVVGIFLK 1189 sp|P16015|CAH3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:28 ms_run[1]:scan=1.1.3855.17 74.10788 2 1338.7567 1338.7542 K I 136 149 PSM IVSNASCTTNCLAPLAK 1190 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 7-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.2528.14 36.58422 3 1819.893971 1818.896805 K V 144 161 PSM CGGDIAFHLNPR 1191 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2917.11 47.66135 2 1338.6115 1338.6134 R F 258 270 PSM TASSVLLHTGQK 1192 sp|Q9JII6|AK1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.2456.18 34.56453 2 1283.6922 1282.6872 M M 2 14 PSM FAQLCEEHGILRENIIDLSNANR 1193 sp|A2BIM8|MUP18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 5-UNIMOD:4 ms_run[1]:scan=1.1.2978.13 49.36685 4 2711.360894 2711.344947 R C 153 176 PSM VVLAYEPVWAIGTGK 1194 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.3372.17 60.53985 2 1601.882647 1601.881730 K T 211 226 PSM AVAAAAVAAPAGGGGAR 1195 sp|Q99L88|SNTB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.2740.18 42.6114 2 1378.7317 1378.7312 M A 2 19 PSM ASGVQVADEVCR 1196 sp|Q9R0P5|DEST_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1,11-UNIMOD:4 ms_run[1]:scan=1.1.2692.14 41.24678 2 1331.6163 1331.6134 M I 2 14 PSM AMNYSAKDEVDGGPAGPPGGAAK 1197 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 24 1-UNIMOD:1 ms_run[1]:scan=1.1.2551.21 37.23829 3 2201.0093 2201.0054 M T 2 25 PSM IQIWDTAGQER 1198 sp|Q8K386|RAB15_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=1.1.2657.15 40.25975 2 1315.652647 1315.652064 R Y 59 70 PSM NGLVYMKYDTPFIFAEVNSDK 1199 sp|Q9JLF6|TGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 24 6-UNIMOD:35 ms_run[1]:scan=1.1.3307.5 58.70785 3 2465.189771 2466.177714 K V 481 502 PSM AGAVNPTVK 1200 sp|P28843|DPP4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1722.14 13.92275 2 855.477847 855.481417 K F 253 262 PSM KAEAQIAAK 1201 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1575.11 9.835716 2 928.531047 928.534181 R N 82 91 PSM QEYDESGPSIVHRK 1202 sp|P60710|ACTB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1895.13 18.81155 4 1643.791294 1643.790349 K C 360 374 PSM ALSTQGSSVGR 1203 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1773.20 15.35988 2 1061.545847 1061.546536 K K 89 100 PSM CCSGSLVER 1204 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.1831.19 17.00528 2 1066.452847 1066.453564 K R 500 509 PSM VGGTSDVEVNEK 1205 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1882.20 18.453 2 1232.586847 1232.588461 K K 406 418 PSM VSQEHPVVLTK 1206 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1887.10 18.58443 3 1235.689571 1235.687387 R F 1158 1169 PSM DSYVGDEAQSKR 1207 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1769.15 15.24117 3 1353.616571 1353.616073 K G 51 63 PSM YMCENQATISSK 1208 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:35,3-UNIMOD:4 ms_run[1]:scan=1.1.1878.21 18.34157 2 1446.611447 1446.611916 K L 287 299 PSM EIQNVGDQAQENR 1209 sp|O70570|PIGR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1923.21 19.61135 2 1499.698047 1499.696448 R A 615 628 PSM ATDVMIAGK 1210 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2023.8 22.41318 2 904.469247 904.468803 R V 206 215 PSM RVTLELGGK 1211 sp|O35945|AL1A7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2017.14 22.2475 2 971.575047 971.576380 K S 265 274 PSM KVFIEDVSK 1212 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2070.14 23.74113 2 1063.591847 1063.591361 K E 58 67 PSM NQAPPGLYTK 1213 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2068.16 23.68702 2 1087.565647 1087.566209 K T 200 210 PSM AISQSGVVISK 1214 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2118.15 25.08798 2 1087.624047 1087.623724 R I 254 265 PSM NEEGTWSVEK 1215 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2128.18 25.37785 2 1177.526247 1177.525132 K V 280 290 PSM LDQGGAPLAGTNK 1216 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1998.20 21.72028 2 1240.642247 1240.641165 K E 109 122 PSM EPMTVSSDQMAK 1217 sp|P16015|CAH3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2116.20 25.03487 2 1322.586847 1322.584638 K L 213 225 PSM HGSWGSGLDMHTK 1218 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2018.15 22.27647 3 1411.634171 1411.630283 K P 328 341 PSM VDNSSLTGESEPQTR 1219 sp|Q64436|ATP4A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2066.20 23.63515 2 1618.745247 1618.743458 K S 222 237 PSM SFGSAVLTR 1220 sp|Q02013|AQP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2340.10 31.32227 2 936.502447 936.502881 R N 196 205 PSM MCHPSVDGFTPR 1221 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.2276.5 29.54782 3 1402.612571 1402.612190 R L 815 827 PSM DGGGDVAFVK 1222 sp|Q921I1|TRFE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2273.8 29.46827 2 963.466247 963.466161 K H 216 226 PSM VGAFTVVCK 1223 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 8-UNIMOD:4 ms_run[1]:scan=1.1.2341.6 31.34667 2 979.515847 979.516088 R D 288 297 PSM APEEILAEK 1224 tr|D3Z5G7|D3Z5G7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2179.13 26.81115 2 998.527647 998.528427 K S 332 341 PSM HLFTGPALSK 1225 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2200.15 27.39347 2 1069.591247 1069.592030 K H 48 58 PSM HLFTGPALSK 1226 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2206.14 27.56028 2 1069.591247 1069.592030 K H 48 58 PSM LIIVEGCQR 1227 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.2307.10 30.40177 2 1086.586247 1086.585565 K Q 689 698 PSM LRVDPVNFK 1228 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2326.3 30.92943 3 1086.620471 1086.618579 K L 92 101 PSM TPQIQVYSR 1229 sp|P01887|B2MG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2238.12 28.47207 2 1090.576847 1090.577108 K H 24 33 PSM SEINVEGPPR 1230 sp|P18572|BASI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2155.15 26.15097 2 1096.551647 1096.551287 R I 213 223 PSM AIAEELAPER 1231 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2285.12 29.79933 2 1097.573047 1097.571688 R G 309 319 PSM VMIGESIDEK 1232 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2320.15 30.77022 2 1119.548247 1119.548176 K R 1282 1292 PSM VMIGESIDEK 1233 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:35 ms_run[1]:scan=1.1.2204.16 27.5057 2 1135.542047 1135.543091 K R 1282 1292 PSM ATAVMPDGQFK 1234 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2332.13 31.10047 2 1163.565247 1163.564495 K D 17 28 PSM VYIGGEDYEK 1235 sp|P40936|INMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2266.12 29.27022 2 1171.540047 1171.539720 K E 5 15 PSM AVENSSTAIGIR 1236 sp|O70435|PSA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2168.19 26.51273 2 1216.639447 1216.641165 K C 30 42 PSM LPAKPEVSSDEDVQYR 1237 sp|Q8BMS1|ECHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2240.19 28.53443 3 1831.897571 1831.895208 R V 661 677 PSM FLTNNNSAIDK 1238 sp|P00186|CP1A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2158.8 26.23223 2 1235.612047 1235.614616 R T 430 441 PSM YLECSALTQR 1239 sp|P60764|RAC3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4 ms_run[1]:scan=1.1.2317.18 30.68613 2 1239.592447 1239.591772 K G 154 164 PSM YSTDVSVDEVK 1240 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2311.18 30.51672 2 1240.582047 1240.582313 R A 152 163 PSM SKFDNLYGCR 1241 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.2142.21 25.78532 2 1258.576847 1258.576457 K E 187 197 PSM VLEACSIACNK 1242 sp|P50431|GLYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.2184.16 26.94927 2 1263.593447 1263.595143 K N 370 381 PSM DLGLAQDSATSTK 1243 sp|Q99L13|3HIDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2266.17 29.27438 2 1305.638847 1305.641225 K T 284 297 PSM TASLTSAASIDGSR 1244 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2299.20 30.19463 2 1335.664447 1335.663023 R S 330 344 PSM LVNADGEAVYCK 1245 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:4 ms_run[1]:scan=1.1.2188.19 27.06105 2 1337.628247 1337.628552 K F 222 234 PSM IVREPWVEQDK 1246 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2208.13 27.61548 3 1397.730971 1397.730314 K F 117 128 PSM MCHPSVDGFTPR 1247 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.2276.4 29.54698 3 1402.612571 1402.612190 R L 815 827 PSM ADFAQACQDAGVR 1248 sp|Q05920|PYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.2270.21 29.39288 2 1407.621247 1407.620112 R F 125 138 PSM STGSVVGQQPFGGAR 1249 sp|Q8CHT0|AL4A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2313.20 30.57377 2 1446.720047 1446.721541 K A 509 524 PSM TCSCLDENYYK 1250 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.2244.20 28.64888 2 1451.569847 1451.569717 K C 415 426 PSM GDGPVQGTIHFEQK 1251 sp|P08228|SODC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2247.11 28.7274 3 1511.740871 1511.736856 K A 11 25 PSM FCECDNFNCDR 1252 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.2238.21 28.47958 2 1535.526647 1535.522783 K S 552 563 PSM GISEETTTGVHNLYK 1253 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2280.17 29.66677 2 1647.813047 1647.810415 R M 152 167 PSM VMLGETNPADSKPGTIR 1254 sp|P15532|NDKA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2293.16 30.02172 3 1784.911271 1784.909084 R G 89 106 PSM THINIVVIGHVDSGK 1255 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2372.4 32.20885 4 1587.878494 1587.873290 K S 6 21 PSM FGPAHALIIAGR 1256 sp|P14246|GTR2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2495.3 35.66365 3 1221.702071 1221.698226 K S 146 158 PSM VGLQVVAVK 1257 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2448.5 34.32627 2 911.580247 911.580403 K A 293 302 PSM LVSSVSDLPK 1258 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2343.7 31.40232 2 1043.585447 1043.586276 K R 438 448 PSM STSIQLLER 1259 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2484.10 35.35325 2 1045.575847 1045.576774 K F 1120 1129 PSM DAGMQLQGYR 1260 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2373.14 32.24553 2 1137.526647 1137.523692 R Y 171 181 PSM KPEEVDDEVFYSPR 1261 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2465.17 34.81647 3 1708.799771 1708.794431 R S 307 321 PSM EITALAPSTMK 1262 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2460.14 34.67443 2 1160.612247 1160.611110 K I 316 327 PSM VLIEGSINSVR 1263 sp|P59999|ARPC4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2525.7 36.50252 2 1185.668647 1185.671737 K V 61 72 PSM AVFPSIVGRPR 1264 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2462.2 34.72017 3 1197.702671 1197.698226 R H 29 40 PSM AVFPSIVGRPR 1265 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2456.2 34.55118 3 1197.702671 1197.698226 R H 29 40 PSM NAGVEGSLIVEK 1266 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2394.19 32.84165 2 1214.651647 1214.650667 K I 482 494 PSM ELISNASDALDK 1267 sp|P08113|ENPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2484.15 35.35743 2 1274.637847 1274.635411 R I 103 115 PSM GHSSVGAPETEAFLQPER 1268 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2496.14 35.70127 3 1910.920571 1910.912255 K S 274 292 PSM EAGIESVNHTEL 1269 sp|Q8VI47|MRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2434.17 33.94167 2 1297.616847 1297.615010 K - 1532 1544 PSM FCETTIGCKDPAQGQLLK 1270 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.2508.6 36.04547 3 2065.005671 2064.997247 K D 161 179 PSM KGGDQTTLLVLDK 1271 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2421.15 33.58665 2 1386.771847 1386.771845 R E 310 323 PSM LQEETLDQQLGR 1272 sp|O35604|NPC1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2457.21 34.5957 2 1428.719247 1428.720872 R I 715 727 PSM AGAGSATLSMAYAGAR 1273 sp|P08249|MDHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2505.21 35.96487 2 1453.693447 1453.698362 K F 242 258 PSM GILAADESVGTMGNR 1274 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:35 ms_run[1]:scan=1.1.2355.21 31.741 2 1505.716847 1505.714407 K L 29 44 PSM ACGPDYYEVEEDGIRK 1275 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.2443.17 34.19532 3 1899.837971 1899.830893 R C 310 326 PSM AIGSASEGAQSSLQEVYHK 1276 sp|Q9Z2U1|PSA5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2378.16 32.38987 3 1960.955471 1960.949034 R S 169 188 PSM MFASFPTTK 1277 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2585.5 38.1772 2 1028.500847 1028.500103 R T 33 42 PSM MFASFPTTK 1278 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2578.4 37.98662 2 1028.500847 1028.500103 R T 33 42 PSM YGLAAAVFTK 1279 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2756.4 43.06262 2 1039.572047 1039.570232 K D 444 454 PSM ASKPGLLASVAAVAAQK 1280 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2743.11 42.69192 3 1580.925371 1580.924992 K T 807 824 PSM APLVLEQGLR 1281 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2648.12 39.9973 2 1094.646847 1094.644794 K G 222 232 PSM EAESIYSLAR 1282 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2554.9 37.31441 2 1137.568047 1137.566603 K F 323 333 PSM SEGGFIWACK 1283 sp|O88844|IDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 9-UNIMOD:4 ms_run[1]:scan=1.1.2724.12 42.15425 2 1153.524447 1153.522630 K N 261 271 PSM VAFITGGGTGLGK 1284 sp|Q9CQ62|DECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2614.12 39.0126 2 1176.648447 1176.650273 K A 61 74 PSM ALADPTVALPAR 1285 sp|Q9JIM1|S29A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2656.9 40.22563 2 1193.669447 1193.676822 K S 62 74 PSM ALADPTVALPAR 1286 sp|Q9JIM1|S29A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2650.12 40.05493 2 1193.669447 1193.676822 K S 62 74 PSM FVGAVDPIMEK 1287 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2709.14 41.73552 2 1204.617647 1204.616196 R F 13 24 PSM HIYLGLPAAVR 1288 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2666.13 40.51954 2 1208.703847 1208.702977 R G 599 610 PSM CAVVDVPFGGAK 1289 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 1-UNIMOD:4 ms_run[1]:scan=1.1.2688.13 41.13078 2 1218.609847 1218.606694 K A 172 184 PSM GGDQTTLLVLDK 1290 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2750.10 42.89383 2 1258.678847 1258.676882 K E 311 323 PSM DITTSVLTVNNK 1291 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2734.18 42.4389 2 1303.699847 1303.698346 K A 202 214 PSM EHALLAYTLGVK 1292 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2713.14 41.84672 2 1313.735447 1313.734337 R Q 135 147 PSM ISENMIPVVAEK 1293 sp|Q8VCT4|CES1D_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2738.15 42.55145 2 1328.702647 1328.700988 K Y 389 401 PSM KLDDFVETGDIR 1294 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2591.7 38.34362 3 1406.708471 1406.704159 R T 391 403 PSM AFAMTNQILVER 1295 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:35 ms_run[1]:scan=1.1.2598.20 38.55608 2 1407.716847 1407.718036 K S 613 625 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 1296 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2614.21 39.02011 4 2932.415294 2932.399368 K L 176 205 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 1297 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2632.20 39.54067 4 2932.415294 2932.399368 K L 176 205 PSM VFVTSGLGGMSGAQAK 1298 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2635.19 39.62685 2 1508.767047 1508.765714 K A 243 259 PSM VIAINVDDPDAANYK 1299 sp|Q9D819|IPYR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2752.19 42.95907 2 1616.805647 1616.804602 K D 156 171 PSM YIGGCCGFEPYHIR 1300 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2616.15 39.07232 3 1727.762471 1727.754832 R A 295 309 PSM VPNSGKEEIEAAVEAAR 1301 sp|Q8BH00|AL8A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2576.7 37.93413 3 1768.896971 1768.895542 K E 39 56 PSM YYVTIIDAPGHRDFIK 1302 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2733.13 42.40628 3 1907.002571 1906.994134 K N 85 101 PSM VAPEEHPVLLTEAPLNPK 1303 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2702.18 41.5386 3 1953.071471 1953.057128 R A 96 114 PSM VSVVLGGDHSLAVGSISGHAR 1304 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2558.10 37.43048 4 2017.078494 2017.070487 R V 93 114 PSM AGESVLVHGASGGVGLATCQIAR 1305 sp|P47199|QOR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 19-UNIMOD:4 ms_run[1]:scan=1.1.2695.16 41.3346 3 2209.131671 2209.127350 R A 148 171 PSM TSRPENAIIYSNNEDFQVGQAK 1306 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2597.20 38.5272 3 2480.198171 2480.193181 R V 472 494 PSM RLQGDVAGALEDLER 1307 sp|Q8VBW8|TTC36_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2864.5 46.1288 3 1640.848571 1640.848198 R A 93 108 PSM TSATWFALSR 1308 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2908.8 47.3994 2 1138.575647 1138.577108 K I 414 424 PSM AFQINTFNLK 1309 sp|P17047|LAMP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2960.7 48.8571 2 1194.637447 1194.639708 R V 347 357 PSM DFANVYVDAVK 1310 sp|Q00623|APOA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2955.9 48.7185 2 1239.612247 1239.613553 K D 36 47 PSM VAGALAEEGMGLEEITKR 1311 sp|Q8VC30|TKFC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2848.9 45.6708 3 1872.966071 1872.961513 K V 163 181 PSM VAGALAEEGMGLEEITKR 1312 sp|Q8VC30|TKFC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2849.13 45.70347 3 1872.966071 1872.961513 K V 163 181 PSM EVGADFTIQVGK 1313 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2781.13 43.79567 2 1262.651047 1262.650667 K E 215 227 PSM AAIGDTLVQDIR 1314 sp|Q9CXN7|PBLD2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2849.15 45.70513 2 1270.688047 1270.688115 K Y 142 154 PSM EGMNIVEAMER 1315 sp|P17742|PPIA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2881.13 46.62545 2 1277.575247 1277.574407 K F 134 145 PSM NSLESYAFNMK 1316 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2800.15 44.32345 2 1302.589447 1302.591438 K A 540 551 PSM FSGWYDADLSPAGHEEAK 1317 sp|Q9DBJ1|PGAM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2759.16 43.15998 3 1978.876271 1978.869721 R R 22 40 PSM GTLSDEHAGVISVLAQQAAR 1318 sp|Q9D1L9|LTOR5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2908.14 47.40442 3 2022.055871 2022.049417 R L 35 55 PSM HAVVNLINYQDDAELATR 1319 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2837.16 45.35743 3 2041.028771 2041.022868 K A 134 152 PSM IAEEFEVELER 1320 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2905.10 47.31538 2 1362.665847 1362.666711 K G 1044 1055 PSM HFIEQGINVCLCQSYAK 1321 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 10-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2769.16 43.45103 3 2065.976471 2065.971367 R N 263 280 PSM IAVIGAGASGLTCIK 1322 sp|P97872|FMO5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 13-UNIMOD:4 ms_run[1]:scan=1.1.2864.19 46.14048 2 1429.794847 1429.796286 R C 6 21 PSM IYGVAVYTGMETK 1323 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2826.13 45.03953 2 1430.705047 1430.711553 K M 257 270 PSM VPTPNVSVVDLTCR 1324 sp|P16858|G3P_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 13-UNIMOD:4 ms_run[1]:scan=1.1.2934.15 48.15285 2 1555.803447 1555.802828 R L 233 247 PSM ITPSYVAFTPEGER 1325 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2787.14 43.97005 2 1565.772047 1565.772573 R L 62 76 PSM AVQMGMSSVFFNKGENCIAAGR 1326 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 17-UNIMOD:4 ms_run[1]:scan=1.1.2946.11 48.47678 3 2373.110471 2373.102791 K L 691 713 PSM GTTVITSLSSVLHDSK 1327 sp|Q64458|CP2CT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2920.3 47.7399 3 1643.875271 1643.873016 K E 384 400 PSM SAAPHPGDIGDFINEGLK 1328 sp|P15116|CADH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2962.7 48.91307 3 1836.903371 1836.900627 R A 824 842 PSM NPDDITQEEYGEFYK 1329 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2859.21 45.99773 2 1846.794647 1846.789740 R S 292 307 PSM FWSVDDTQVHTEYSSLR 1330 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2876.18 46.48438 3 2068.957271 2068.949034 R S 209 226 PSM AAVPSGASTGIYEALELRDNDK 1331 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2962.18 48.92223 3 2276.132471 2276.128455 R T 33 55 PSM TVVVNCNPETVSTDFDECDK 1332 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 6-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.2795.20 44.18667 3 2327.996171 2327.988593 K L 1010 1030 PSM TVVVNCNPETVSTDFDECDK 1333 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 6-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.2788.12 43.99708 3 2327.996171 2327.988593 K L 1010 1030 PSM TLIEILATR 1334 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3066.3 51.85155 2 1028.621847 1028.622996 K T 457 466 PSM INEAFDLLR 1335 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2993.5 49.78948 2 1089.581447 1089.581859 K S 356 365 PSM ILVPALMVTAEK 1336 sp|P34914|HYES_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3173.6 54.9289 2 1283.751647 1283.752295 K D 483 495 PSM GFPTIYFSPANK 1337 sp|P27773|PDIA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3067.10 51.88588 2 1340.674847 1340.676488 K K 449 461 PSM DLGTDSQIFISR 1338 sp|Q61598|GDIB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2995.10 49.84823 2 1350.678647 1350.677945 K A 391 403 PSM LTGQIFLGGSIVR 1339 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3079.12 52.2323 2 1359.788847 1359.787435 R G 345 358 PSM GLFIIDDKGILR 1340 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3133.11 53.80115 2 1358.790847 1358.792186 R Q 129 141 PSM TVDNFVALATGEK 1341 sp|P24369|PPIB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2970.10 49.13707 2 1363.696847 1363.698346 K G 72 85 PSM LFLEQIHVLEK 1342 tr|A2BIN1|A2BIN1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2974.2 49.24257 3 1367.779871 1367.781287 R S 58 69 PSM SLNNQFASFIDK 1343 tr|E9Q0F0|E9Q0F0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3003.13 50.07602 2 1382.682247 1382.683030 R V 111 123 PSM ALAGCDFLTISPK 1344 sp|Q93092|TALDO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.3031.12 50.87865 2 1391.711247 1391.711887 K L 246 259 PSM EEIFGPVQQIMK 1345 sp|O35945|AL1A7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3164.9 54.67402 2 1417.729647 1417.727537 K F 399 411 PSM FLTEELSLDQDR 1346 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2974.14 49.25258 2 1464.712847 1464.709639 K I 84 96 PSM GSFSEQGINEFLR 1347 sp|Q922R8|PDIA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3058.8 51.63383 2 1482.710247 1482.710307 K E 374 387 PSM DSAGVWACCPYLK 1348 sp|P28798|GRN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.2975.19 49.28518 2 1525.670447 1525.669371 K G 532 545 PSM ACVDTALENLSTLK 1349 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4 ms_run[1]:scan=1.1.3026.15 50.74382 2 1533.770047 1533.770859 K M 1221 1235 PSM IPGGPQMIQLSLDGK 1350 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3142.16 54.06532 2 1552.826647 1552.828314 R R 383 398 PSM LYATTSLYSDWDK 1351 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2986.19 49.59948 2 1561.732447 1561.730040 R Q 399 412 PSM LYATTSLYSDWDK 1352 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2993.16 49.79867 2 1561.732447 1561.730040 R Q 399 412 PSM DYLTTYYSFHSGPVAEQEIVK 1353 sp|P40936|INMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3160.11 54.57232 3 2446.175771 2446.169257 K F 20 41 PSM YLAPTILTDVDPNSK 1354 sp|P47740|AL3A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3113.19 53.22932 2 1645.856247 1645.856303 R V 312 327 PSM TIILYDTNLPDVSAK 1355 sp|P97328|KHK_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3151.19 54.32898 2 1661.885047 1661.887603 R D 109 124 PSM TIILYDTNLPDVSAK 1356 sp|P97328|KHK_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3159.8 54.54197 2 1661.885047 1661.887603 R D 109 124 PSM LSQTFPNADFAEITK 1357 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3047.19 51.3454 2 1680.836247 1680.835902 R L 243 258 PSM IHFPLATYAPVISAEK 1358 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3084.6 52.37133 3 1755.957371 1755.955957 R A 265 281 PSM GLVYETSVLDPDEGIR 1359 tr|Q80X68|Q80X68_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3103.20 52.93768 2 1761.875647 1761.878495 K F 77 93 PSM LISWYDNEYGYSNR 1360 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2972.19 49.20035 2 1778.792247 1778.790014 K V 308 322 PSM LISWYDNEYGYSNR 1361 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2971.20 49.17332 2 1778.792247 1778.790014 K V 308 322 PSM RTGAIVDVPVGEELLGR 1362 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3002.8 50.04287 3 1779.987971 1779.984297 K V 133 150 PSM SGIPIVTSPYQIHFTK 1363 sp|P01027|CO3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3023.6 50.65418 3 1786.963271 1786.961771 R T 345 361 PSM GSRVEIEAIAVQGPFIK 1364 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3010.9 50.27711 3 1813.013171 1813.009784 R A 118 135 PSM LLSHCLLVTLASHHPADFTPAVHASLDK 1365 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.2983.7 49.5033 5 3049.601618 3049.580761 K F 101 129 PSM QAGIAQLYGIAGSTNVTGDQVK 1366 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3100.13 52.84405 3 2190.126971 2190.128061 R K 51 73 PSM SREYQLNDSAAYYLNDLER 1367 sp|P08752|GNAI2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3036.13 51.02018 3 2319.079571 2319.076754 R I 144 163 PSM GTMLGKIEFEGQSVDFVDPNK 1368 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 3-UNIMOD:35 ms_run[1]:scan=1.1.3068.17 51.92025 3 2326.117871 2326.115114 K Q 177 198 PSM DLPTVQQALQSGSSEEGVSAVAHR 1369 tr|Q9JHF5|Q9JHF5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2987.20 49.62907 3 2465.220071 2465.214644 R I 329 353 PSM SPWSMDENLMHISYEAGILENPK 1370 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:35,10-UNIMOD:35 ms_run[1]:scan=1.1.3159.10 54.54698 3 2692.220471 2692.214905 K N 177 200 PSM ILLDQGQTHSVETPYGSVTFTVYGTPKPK 1371 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3121.17 53.45647 4 3162.638094 3162.623731 R R 33 62 PSM LQAGTVFVNTYNKTDVAAPFGGFK 1372 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3179.14 55.10118 3 2544.319571 2544.301275 K Q 853 877 PSM LLGNQATFSPIVTVEPR 1373 sp|Q02357|ANK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3176.8 55.02234 2 1840.988647 1841.004699 K R 1117 1134 PSM SSLLDVLAAR 1374 sp|Q7TMS5|ABCG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3252.2 57.1418 2 1043.597447 1043.597509 K K 86 96 PSM AILEVLQTQGA 1375 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3207.4 55.87053 2 1141.633247 1141.634289 R - 568 579 PSM TLGVDFIDVATK 1376 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3192.9 55.44672 2 1277.687047 1277.686718 K V 1270 1282 PSM LLVVYPWTQR 1377 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3188.4 55.33109 2 1273.719247 1273.718293 R Y 32 42 PSM AGSIADEVLSSIR 1378 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3301.6 58.53937 2 1316.692847 1316.693595 K T 277 290 PSM APLVCLPVFVSK 1379 sp|Q91V76|CK054_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:4 ms_run[1]:scan=1.1.3335.9 59.49093 2 1328.752647 1328.752630 K D 245 257 PSM GALVIVNDLGGDFK 1380 sp|P51660|DHB4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3236.13 56.70972 2 1416.763847 1416.761280 R G 33 47 PSM GYFIQPTVFGDVK 1381 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3231.9 56.56973 2 1469.757847 1469.755467 R D 397 410 PSM MGALDVCPFIPVR 1382 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.3340.3 59.6268 2 1473.747047 1473.747227 R G 85 98 PSM EYLPIGGLAEFCK 1383 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:4 ms_run[1]:scan=1.1.3331.14 59.37952 2 1495.740847 1495.738102 K A 95 108 PSM EYLPIGGLAEFCK 1384 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:4 ms_run[1]:scan=1.1.3325.16 59.20777 2 1495.740847 1495.738102 K A 95 108 PSM VFANAYLSDLGGCIK 1385 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 13-UNIMOD:4 ms_run[1]:scan=1.1.3190.19 55.39867 2 1626.809847 1626.807579 K A 114 129 PSM GIGTDEATIIDIVTHR 1386 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3328.5 59.28528 3 1709.899871 1709.894814 K S 378 394 PSM TFSHELSDFGLESTTGEVPVVAIR 1387 sp|P27773|PDIA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3361.17 60.2238 3 2590.294271 2590.291498 K T 306 330 PSM LVGGMVSYLNDLPSQR 1388 sp|Q9R0H0|ACOX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3206.17 55.85263 2 1747.893447 1747.892705 K I 447 463 PSM ALESPERPFLAILGGAK 1389 sp|P09411|PGK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3201.4 55.70027 3 1767.995171 1767.988320 K V 200 217 PSM YTPEQVAMATVTALHR 1390 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3194.3 55.4998 3 1786.909271 1786.903604 K T 244 260 PSM VQAMYIWVDGTGEGLR 1391 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3312.13 58.84257 2 1793.884447 1793.877055 K C 26 42 PSM CFYNSDGDFLIVPQK 1392 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 1-UNIMOD:4 ms_run[1]:scan=1.1.3230.17 56.54917 2 1801.839047 1801.834522 R G 146 161 PSM KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK 1393 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4,31-UNIMOD:4 ms_run[1]:scan=1.1.3355.20 60.05187 4 3624.675294 3624.653470 K N 310 342 PSM SLSGVYMNSMLTQIER 1394 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3326.20 59.24 2 1827.887647 1827.885905 K Q 34 50 PSM TQPTDEEMLFIYSHFK 1395 sp|P31786|ACBP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3332.7 59.40285 3 1984.929671 1984.924065 K Q 18 34 PSM GRLTIIPQDPILFSGNLR 1396 sp|Q8VI47|MRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3297.9 58.42823 3 2009.145671 2009.142195 R M 1373 1391 PSM LRPEDITQIQPQQLLLK 1397 sp|P09055|ITB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3248.3 57.03418 3 2032.176671 2032.168076 K L 106 123 PSM SVHITFSSFENVEGLPAFR 1398 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3372.10 60.53402 3 2136.071171 2136.064004 R Y 276 295 PSM AVLDVAETGTEAAAATGVIGGIR 1399 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3362.12 60.24855 3 2141.141471 2141.132812 K K 361 384 PSM PGGLLLGDEAPNFEANTTIGR 1400 tr|Q6GT24|Q6GT24_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=1.1.3285.9 58.08325 3 2141.0846 2141.0748 M I 2 23 PSM VAGLLVLNYSNDYNHWLATK 1401 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3393.10 61.08502 3 2290.183871 2290.174617 K S 128 148 PSM ILVTHGIHFLPQVDEIVVLGK 1402 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3338.8 59.57605 3 2326.341971 2326.341289 R G 814 835 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 1403 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3255.10 57.229 4 3182.625294 3182.607035 R L 148 178 PSM DRTVPFCSTFAAFFTR 1404 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4 ms_run[1]:scan=1.1.3576.6 66.2623 3 1921.932971 1921.914504 R A 380 396 PSM ESILELITSR 1405 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3512.6 64.41634 2 1159.645447 1159.644853 K S 41 51 PSM AVVLPISLATTFK 1406 sp|Q8VCN5|CGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3466.5 63.10468 2 1358.817047 1358.817339 R Q 35 48 PSM AAALVLQTIWGYK 1407 sp|P30999|CTND1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3447.12 62.57762 2 1432.807447 1432.807836 R E 821 834 PSM IFLLTNNNLLLADQK 1408 sp|P46735|MYO1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3457.7 62.85757 2 1728.976047 1728.977421 R S 978 993 PSM GLAPVQAYLHIPDIIK 1409 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3422.3 61.90545 3 1747.010471 1747.003242 R V 89 105 PSM VAPEEVSEVIFGHVLTAGCGQNPTR 1410 tr|Q80X81|Q80X81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 19-UNIMOD:4 ms_run[1]:scan=1.1.3434.14 62.2201 3 2666.312471 2666.312250 K Q 47 72 PSM VYEGSILEADCDILIPAASEK 1411 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:4 ms_run[1]:scan=1.1.3436.12 62.26908 3 2292.129671 2292.119530 K Q 366 387 PSM MGFCSVQEDINSLCLTVVQR 1412 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 4-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3628.14 67.75768 3 2355.111671 2355.102123 R L 93 113 PSM AHCLSEVEHDTMPADLPAIAADFVEDQEVCK 1413 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 3-UNIMOD:4,30-UNIMOD:4 ms_run[1]:scan=1.1.3529.18 64.92028 4 3496.584894 3496.558507 K N 311 342 PSM VGWEQLLTTIAR 1414 sp|P57780|ACTN4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3685.7 69.36066 2 1385.766647 1385.766700 R T 735 747 PSM EGIPALDNFLDKL 1415 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3763.11 71.57999 2 1443.762447 1443.760946 K - 846 859 PSM TVLIMELINNVAK 1416 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3723.10 70.4375 2 1456.832447 1456.832337 K A 213 226 PSM IVNDDFSQVADVLVEDGVVR 1417 sp|Q9EQF5|DPYS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3725.12 70.49802 3 2188.110371 2188.101178 R A 14 34 PSM LGPVGGVFNLAMVLR 1418 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3733.17 70.7384 2 1541.871047 1541.875205 K D 1955 1970 PSM SAGWVIPIGLLFCK 1419 sp|Q921I1|TRFE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 13-UNIMOD:4 ms_run[1]:scan=1.1.3795.9 72.4676 2 1559.854047 1559.853407 R L 144 158 PSM GRDLAILLGMLDPVEK 1420 sp|O08709|PRDX6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3645.2 68.21935 3 1738.966271 1738.965142 K D 107 123 PSM GQETSTNPIASIFAWSR 1421 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3670.19 68.94192 2 1863.912447 1863.911526 K G 322 339 PSM LADVLEQSLEELAQAESK 1422 sp|Q8BH00|AL8A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3745.9 71.05835 3 1972.005971 1972.000067 R D 76 94 PSM GVGAAATAVTQALNELLQHVK 1423 sp|P26039|TLN1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3766.3 71.66607 3 2090.151671 2090.148403 R A 766 787 PSM DMDLTEVITGTLWNLSSHDSIK 1424 sp|P30999|CTND1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3837.10 73.61855 3 2474.221871 2474.199906 R M 465 487 PSM FFIVNIDSLSSSSSAAPIQIPAPASVAR 1425 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3733.19 70.74007 3 2844.517271 2844.502159 K G 262 290 PSM CCAEANPPACYGTVLAEFQPLVEEPK 1426 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3805.21 72.7452 3 2932.3212 2932.3072 K N 384 410 PSM GKFPDVPGFSWVTPCISAK 1427 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 15-UNIMOD:4 ms_run[1]:scan=1.1.3381.2 60.78182 3 2094.054971 2092.045183 K D 154 173 PSM EDTNTITDLGILYGGIGATVISADK 1428 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3774.6 71.88638 3 2537.302571 2536.290829 K S 451 476 PSM SSPAQPAVPAPLADLK 1429 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.3354.15 60.01853 2 1602.8587 1602.8612 M I 2 18 PSM AGFAGDDAPR 1430 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1956.17 20.52707 2 975.441047 975.441009 K A 19 29 PSM DDDIAALVVDNGSGMCK 1431 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1,16-UNIMOD:4 ms_run[1]:scan=1.1.3620.21 67.52602 2 1820.7987 1820.7915 M A 2 19 PSM DDDIAALVVDNGSGMCK 1432 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4 ms_run[1]:scan=1.1.3465.18 63.08627 2 1836.7870 1836.7865 M A 2 19 PSM NQWEPVCGENGVTYISPCLAGCK 1433 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4,18-UNIMOD:4,22-UNIMOD:4 ms_run[1]:scan=1.1.3225.19 56.4095 3 2639.151371 2638.161429 K S 463 486 PSM VAVLGASGGIGQPLSLLLK 1434 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3689.16 69.48683 2 1792.077647 1792.082221 K N 27 46 PSM RLTGFHETSNINDFSAGVANR 1435 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=1.1.2504.17 35.93297 4 2307.1372 2305.1192 R G 299 320 PSM QGGLGPMNIPLISDPKR 1436 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:28 ms_run[1]:scan=1.1.3435.20 62.24833 2 1774.9370 1774.9395 K T 94 111 PSM FVVNFQNSFNGNDIAFHFNPR 1437 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.3505.9 64.23078 3 2484.170171 2483.177077 R F 44 65 PSM EAAQMDMVNDGVEDLRGK 1438 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:35 ms_run[1]:scan=1.1.2485.19 35.38963 3 1993.894271 1992.888091 R Y 86 104 PSM YVTLIYTNYENGKNDYVK 1439 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2859.15 45.99273 3 2197.065671 2196.073900 K A 104 122 PSM LVSIGAEEIVDGNAK 1440 sp|P57780|ACTN4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2796.19 44.21365 2 1514.795247 1513.798788 K M 127 142 PSM QKTEDELLETSLK 1441 sp|Q8VCT4|CES1D_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:28 ms_run[1]:scan=1.1.2794.17 44.1567 2 1515.7705 1515.7663 R L 287 300 PSM IGASTQAAQR 1442 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.1668.18 12.43245 2 1001.526847 1001.525407 K L 527 537 PSM ELPGHTGYLSCCR 1443 sp|P29387|GBB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2168.13 26.50773 3 1550.697071 1548.681333 R F 138 151 PSM AVCMLSNTTAIAEAWAR 1444 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 3-UNIMOD:4 ms_run[1]:scan=1.1.3346.21 59.7993 2 1863.900447 1863.897139 R L 374 391 PSM GAPTTSLVSVAVTK 1445 sp|Q9DBF1|AL7A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2613.15 38.98655 2 1330.751647 1329.750381 K I 219 233 PSM AHYHDNYGKNDEVEFVR 1446 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.2281.17 29.69568 3 2133.9652 2133.9502 M T 2 19 PSM SELDQLRQEAEQLK 1447 sp|P62874|GBB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.3287.19 58.14987 2 1727.8738 1727.8685 M N 2 16 PSM ADKPILYSYFR 1448 tr|A0A1Y7VJZ2|A0A1Y7VJZ2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 23 1-UNIMOD:1 ms_run[1]:scan=1.1.3197.12 55.59423 2 1413.7303 1413.7287 M S 2 13 PSM NQVAVVTGGGTGIGK 1449 sp|Q99MZ7|PECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2256.18 28.98935 2 1356.736047 1356.736128 K A 18 33 PSM DSPSVWAAVPGK 1450 sp|P62962|PROF1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2777.12 43.67902 2 1212.614647 1212.613888 K T 27 39 PSM TVFGVDETSLQR 1451 sp|Q9QZ85|IIGP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2706.15 41.65152 2 1349.668647 1350.677945 R L 318 330 PSM VLNSYWVGEDSTYK 1452 sp|Q9CZM2|RL15_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=1.1.2813.6 44.68877 2 1660.768447 1659.778053 R F 115 129 PSM KHHLDGETEEER 1453 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1551.14 9.1734 3 1478.676071 1478.674984 R I 83 95 PSM TPVSEHVTK 1454 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1636.17 11.53062 2 996.520447 996.524010 K C 491 500 PSM EATTEQQLR 1455 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1743.19 14.51248 2 1074.528247 1074.530552 K E 387 396 PSM HQGVMVGMGQK 1456 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:35 ms_run[1]:scan=1.1.1665.20 12.35072 2 1186.556047 1186.558698 R D 40 51 PSM VGGTSDVEVNEKK 1457 sp|P63038|CH60_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1721.16 13.89613 3 1360.681871 1360.683424 K D 406 419 PSM VTDALNATR 1458 sp|P63038|CH60_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1898.17 18.89997 2 959.504447 959.503609 R A 421 430 PSM NSASLHVLK 1459 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1851.16 17.573 2 967.543847 967.545080 K T 287 296 PSM AIDVEQGQTR 1460 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1897.17 18.87155 2 1115.557447 1115.557101 K T 372 382 PSM ESDCLVCQK 1461 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.1891.21 18.7061 2 1137.478047 1137.479445 R F 245 254 PSM TVEAEAAHGTVTR 1462 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1781.14 15.58387 3 1340.666771 1340.668442 K H 302 315 PSM KLEEEGEQFVK 1463 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2121.8 25.16853 3 1334.673971 1334.671797 K K 443 454 PSM INAQLVEAK 1464 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2130.9 25.42802 2 984.559847 984.560395 R M 611 620 PSM SPGVAELSQR 1465 sp|O08966|S22A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2090.12 24.29998 2 1042.541447 1042.540723 R C 52 62 PSM GGDRIPADLR 1466 sp|Q8VDN2|AT1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2009.4 22.0158 3 1068.569771 1068.567606 K I 195 205 PSM AISQSGVVISK 1467 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2124.19 25.26393 2 1087.624047 1087.623724 R I 254 265 PSM VAFTGSTQVGK 1468 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2104.16 24.68843 2 1093.576847 1093.576774 K L 242 253 PSM IAVAAQNCYK 1469 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.2013.17 22.13775 2 1136.566447 1136.564829 K V 110 120 PSM YIDQEELNK 1470 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2086.20 24.19293 2 1150.552047 1150.550619 K T 285 294 PSM ITAHLVHELR 1471 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1980.7 21.19975 3 1187.679671 1187.677491 R R 361 371 PSM SPQYSQVIHR 1472 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1998.6 21.7086 3 1213.622171 1213.620370 K L 53 63 PSM HVLGVPLDDRK 1473 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2051.9 23.20035 3 1247.700971 1247.698620 R A 44 55 PSM KYEEIDNAPEER 1474 sp|Q8BFR5|EFTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.1943.16 20.16775 3 1491.691271 1491.684152 K A 91 103 PSM GTSFEAAATSGGSASSEK 1475 sp|Q99LC5|ETFA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2060.21 23.46807 2 1643.726247 1643.727474 R A 170 188 PSM LEGHGDPLHLEEVKR 1476 sp|P28230|CXB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2147.7 25.91828 4 1727.899694 1727.895482 R H 108 123 PSM LGPLVEQGR 1477 sp|P08226|APOE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2196.9 27.27748 2 967.542047 967.545080 R Q 191 200 PSM GLNSDSVTEETLRK 1478 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2165.16 26.42597 3 1547.780471 1547.779115 K A 893 907 PSM RHVFGESDELIGQK 1479 sp|P17751|TPIS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2167.17 26.48282 3 1613.817671 1613.816169 R V 150 164 PSM LQNLQLQPGK 1480 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2281.8 29.68652 2 1137.649847 1137.650607 K A 535 545 PSM GEFITTVQQR 1481 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2320.17 30.77188 2 1177.608647 1177.609137 K G 221 231 PSM HQGSLYSLFPDHSVKK 1482 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2308.4 30.42868 3 1841.945471 1841.942433 R Y 130 146 PSM WDTVSNQVQR 1483 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2152.20 26.07257 2 1231.593647 1231.594549 R V 42 52 PSM YVGSMVADIHR 1484 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2282.6 29.71217 3 1246.612871 1246.612842 R T 245 256 PSM CLSCDLNPER 1485 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.2238.17 28.47623 2 1262.538447 1262.538357 K C 438 448 PSM SDANTDLIGGSPK 1486 sp|P53986|MOT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2195.19 27.2576 2 1273.613647 1273.615010 K G 220 233 PSM VNADEVGGEALGR 1487 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2327.17 30.96827 2 1285.626047 1285.626243 K L 19 32 PSM IIYGGSVTGATCK 1488 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 12-UNIMOD:4 ms_run[1]:scan=1.1.2246.20 28.7062 2 1325.666247 1325.664937 R E 257 270 PSM AVDPDSPAEASGLR 1489 sp|P70441|NHRF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2271.18 29.41897 2 1383.666047 1383.663023 R A 176 190 PSM AVDPDSPAEASGLR 1490 sp|P70441|NHRF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2265.21 29.24897 2 1383.666047 1383.663023 R A 176 190 PSM AVAQGNLSSADVQAAK 1491 sp|Q9DB77|QCR2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2152.21 26.0734 2 1528.784247 1528.784535 K N 360 376 PSM SALEHSVQCAVDVK 1492 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.2302.11 30.26792 3 1541.753471 1541.750792 R R 417 431 PSM GLNSDSVTEETLRK 1493 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2162.14 26.3408 3 1547.780471 1547.779115 K A 893 907 PSM KGGDQTTLLVLDK 1494 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2424.4 33.65488 3 1386.773471 1386.771845 R E 310 323 PSM RGLQGSFEELCR 1495 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 11-UNIMOD:4 ms_run[1]:scan=1.1.2393.8 32.80428 3 1450.709171 1450.698697 K N 616 628 PSM RHPDYSVSLLLR 1496 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2543.5 36.99866 3 1454.802071 1454.799397 R L 361 373 PSM VGAFTVVCK 1497 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.2348.7 31.53753 2 979.515847 979.516088 R D 288 297 PSM LVEIAQVPK 1498 sp|Q91ZJ5|UGPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2441.9 34.13138 2 995.601647 995.601532 R A 304 313 PSM GGASDALLYR 1499 sp|P48771|CX7A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2346.6 31.48522 2 1021.518847 1021.519259 K A 47 57 PSM MFASFPTTK 1500 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:35 ms_run[1]:scan=1.1.2384.11 32.55603 2 1044.495847 1044.495018 R T 33 42 PSM MFASFPTTK 1501 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:35 ms_run[1]:scan=1.1.2390.14 32.7258 2 1044.495847 1044.495018 R T 33 42 PSM VFSGVVSTGLK 1502 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2527.9 36.55302 2 1092.615247 1092.617910 R V 416 427 PSM LVQEVTDFAK 1503 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2549.13 37.17468 2 1148.608447 1148.607740 K T 66 76 PSM VVLVTGAGGGLGR 1504 sp|P51660|DHB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2504.17 35.93297 2 1154.678847 1154.677157 R A 11 24 PSM DTTASAVAVGLR 1505 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2498.16 35.7598 2 1159.622847 1159.619701 K Q 520 532 PSM ALNDHHVYLEGTLLKPNMVTAGHACTK 1506 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 18-UNIMOD:35,25-UNIMOD:4 ms_run[1]:scan=1.1.2419.11 33.53282 5 3005.509618 3005.485147 K K 216 243 PSM NAGVEGSLIVEK 1507 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2388.17 32.67283 2 1214.651647 1214.650667 K I 482 494 PSM CQYYAVSFSK 1508 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.2542.17 36.9805 2 1251.560447 1251.559410 R E 448 458 PSM LMIEMDGTENK 1509 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2524.10 36.47895 2 1279.581447 1279.578824 K S 93 104 PSM AAPTEPPEAPEATAAGGVTSK 1510 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2354.16 31.70878 3 1950.957671 1950.953451 R Q 352 373 PSM VSVISVEEPPQR 1511 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2485.20 35.39046 2 1338.714647 1338.714330 K S 222 234 PSM LTCTYSGFSSPR 1512 sp|O88792|JAM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.2376.19 32.33522 2 1374.627447 1374.623801 K V 47 59 PSM LTCTYSGFSSPR 1513 sp|O88792|JAM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 3-UNIMOD:4 ms_run[1]:scan=1.1.2382.20 32.5069 2 1374.627447 1374.623801 K V 47 59 PSM AQVAQPGGDTIFGK 1514 sp|P70349|HINT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2495.18 35.67617 2 1387.712647 1387.709579 K I 8 22 PSM VFANPEDCAGFGK 1515 sp|Q91VS7|MGST1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.2546.19 37.09513 2 1410.624647 1410.623801 K G 43 56 PSM GTFASLSELHCDK 1516 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 11-UNIMOD:4 ms_run[1]:scan=1.1.2433.8 33.90668 3 1463.677271 1463.671479 K L 84 97 PSM SQIHDIVLVGGSTR 1517 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2417.8 33.4807 2 1480.801847 1480.799791 K I 329 343 PSM HGSIIYHPSLLPR 1518 sp|Q8K009|AL1L2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2378.8 32.38318 3 1488.824771 1488.820132 K H 122 135 PSM NVIIWGNHSSTQYPDVNHAK 1519 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2444.21 34.22692 3 2279.118371 2279.108329 K V 180 200 PSM TFTTQETITNAETAK 1520 sp|P06745|G6PI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2380.21 32.4512 2 1654.808247 1654.804996 K E 212 227 PSM RHPDYSVSLLLR 1521 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2568.4 37.7043 3 1454.802071 1454.799397 R L 361 373 PSM LGDVYVNDAFGTAHR 1522 sp|P09041|PGK2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2632.10 39.53233 3 1633.790171 1633.784869 K A 157 172 PSM APLVLEQGLR 1523 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2642.8 39.82053 2 1094.646847 1094.644794 K G 222 232 PSM KFHFPGDIHSPDTELAEMK 1524 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2702.10 41.53192 4 2198.059694 2198.046640 R L 625 644 PSM VSSLPTVYLK 1525 sp|P18242|CATD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2723.10 42.12433 2 1105.638447 1105.638311 K L 330 340 PSM SADTLWGIQK 1526 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2655.9 40.19653 2 1117.576647 1117.576774 K E 319 329 PSM RLGTLEVEDQIEAAR 1527 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2626.12 39.36028 3 1698.891971 1698.890063 R Q 591 606 PSM RLYATTSLYSDWDK 1528 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2721.10 42.06703 3 1717.834871 1717.831151 K Q 398 412 PSM DQFTTLPEVK 1529 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2735.12 42.4627 2 1176.604247 1176.602654 K D 176 186 PSM RLDGDFELGSISNQGR 1530 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2691.13 41.21733 3 1762.866071 1762.859825 R E 13 29 PSM VLSSMTDAVLAR 1531 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2735.13 42.46353 2 1261.670647 1261.670022 R V 130 142 PSM SFLVGSAAQSLSK 1532 sp|Q9R0H0|ACOX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2675.7 40.7735 2 1293.697047 1293.692866 R A 283 296 PSM TDTDAELDLVSR 1533 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2652.13 40.11312 2 1333.635447 1333.636139 K L 761 773 PSM TVIIEQSWGSPK 1534 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2656.13 40.22897 2 1343.709647 1343.708516 R V 61 73 PSM YLQTLTTIAAEK 1535 sp|P54116|STOM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2712.16 41.82072 2 1350.738647 1350.739482 R N 252 264 PSM AALEALGSCLNNK 1536 sp|Q9CZN7|GLYM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.2594.17 38.4378 2 1359.683047 1359.681650 R Y 83 96 PSM CLYASVLTAQPR 1537 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:4 ms_run[1]:scan=1.1.2745.18 42.75573 2 1377.709047 1377.707471 R L 728 740 PSM SIVVTNYEESIK 1538 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2614.20 39.01927 2 1380.713847 1380.713661 R M 226 238 PSM AVLEALGSCLNNK 1539 sp|P50431|GLYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.2753.17 42.98637 2 1387.714247 1387.712950 R Y 54 67 PSM DYSEMYVTCAR 1540 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.2609.16 38.87195 2 1393.566047 1393.564237 K D 254 265 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 1541 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2644.16 39.8851 4 2932.415294 2932.399368 K L 176 205 PSM VIAINVDDPDAANYK 1542 sp|Q9D819|IPYR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2746.18 42.78475 2 1616.805647 1616.804602 K D 156 171 PSM SLEDALSSDTSGHFR 1543 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2627.10 39.38762 3 1620.741071 1620.737979 K R 484 499 PSM NQLTSNPENTVFDAK 1544 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2578.11 37.9983 2 1676.797847 1676.800579 K R 83 98 PSM LGREEATMEDIVQAAK 1545 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2729.7 42.28893 3 1759.883471 1759.877449 R D 518 534 PSM IMNVIGEPIDERGPIK 1546 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2743.14 42.69442 3 1779.960971 1779.955305 R T 144 160 PSM YYVTIIDAPGHRDFIK 1547 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2735.14 42.46437 3 1907.002571 1906.994134 K N 85 101 PSM SLGPENLLLK 1548 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2922.8 47.80148 2 1082.631047 1082.633560 R G 238 248 PSM IINEPTAAAIAYGLDKK 1549 sp|P17156|HSP72_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2820.5 44.8707 3 1786.986971 1786.982900 R G 173 190 PSM FGQAISLLPDR 1550 sp|Q8VBW8|TTC36_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2959.9 48.83064 2 1215.657047 1215.661172 K A 71 82 PSM LIDDMVAQAMK 1551 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2943.4 48.38908 2 1233.611847 1233.609730 R S 250 261 PSM DYLHGDNSDIIPTDTIK 1552 sp|P25688|URIC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2890.10 46.88457 3 1915.919171 1915.916337 K N 56 73 PSM TSIAIDTIINQK 1553 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2882.12 46.6535 2 1315.735247 1315.734731 K R 219 231 PSM SLGVAAEGLPDQYADGEAAR 1554 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2835.13 45.29742 3 1988.951471 1988.943949 R V 10 30 PSM GCDVVVIPAGVPR 1555 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 2-UNIMOD:4 ms_run[1]:scan=1.1.2837.15 45.3566 2 1337.712047 1337.712556 K K 92 105 PSM PLRLPLQDVYK 1556 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2758.2 43.11925 3 1340.784371 1340.781622 K I 245 256 PSM LIIWDSYTTNK 1557 sp|P29387|GBB4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2962.14 48.9189 2 1352.696647 1352.697617 K M 79 90 PSM QEGQNYGFFLR 1558 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2923.12 47.83367 2 1357.640847 1357.641499 K I 15 26 PSM HAVVNLINYQDDAELATR 1559 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2843.15 45.52967 3 2041.028771 2041.022868 K A 134 152 PSM TVLMNPNIASVQTNEVGLK 1560 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 4-UNIMOD:35 ms_run[1]:scan=1.1.2877.15 46.5109 3 2043.071771 2043.067041 K Q 459 478 PSM ANVVASALAQIPQK 1561 tr|Q8R084|Q8R084_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2948.11 48.5275 2 1408.803647 1408.803814 K V 322 336 PSM GYLGPEQLPDCLK 1562 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 11-UNIMOD:4 ms_run[1]:scan=1.1.2929.18 48.0119 2 1488.728047 1488.728266 K G 79 92 PSM VAPPGLTQIPQIQK 1563 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2863.17 46.10987 2 1488.868047 1488.866414 R T 72 86 PSM GLEVTAYSPLGSSDR 1564 sp|Q9JII6|AK1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2850.15 45.73442 2 1550.758847 1550.757651 R A 204 219 PSM VCYEGQPVGEFIR 1565 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 2-UNIMOD:4 ms_run[1]:scan=1.1.2822.21 44.93521 2 1552.734447 1552.734414 K C 328 341 PSM YVTLIYTNYENGK 1566 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2819.9 44.84862 2 1576.776647 1576.777324 K N 104 117 PSM YFSMTEVDKLGIGK 1567 sp|Q61176|ARGI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2937.2 48.22393 3 1586.804171 1586.801431 K V 197 211 PSM ELGEYGLQAYTEVK 1568 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2933.18 48.12793 2 1598.786847 1598.782804 R T 495 509 PSM VALEEEVVDSSISEK 1569 sp|O70570|PIGR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2816.8 44.7703 2 1632.810247 1632.809412 K E 585 600 PSM LVLEVAQHLGESTVR 1570 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2782.17 43.82808 2 1649.910647 1649.910070 R T 95 110 PSM IPGGPQMIQLSLDGKR 1571 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2853.10 45.81804 3 1708.933271 1708.929425 R L 383 399 PSM VITAFNDGLNHLDSLK 1572 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2938.8 48.2609 2 1755.915647 1755.915549 K G 68 84 PSM EAAQMDMVNDGVEDLR 1573 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2869.19 46.28578 2 1791.779047 1791.776749 R G 86 102 PSM KYPLLLDVYAGPCSQK 1574 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 13-UNIMOD:4 ms_run[1]:scan=1.1.2963.7 48.94065 3 1850.963171 1850.960057 K A 533 549 PSM AIAEELAPERGFLPPASEK 1575 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2840.13 45.4412 3 2024.061671 2024.057856 R H 309 328 PSM KGFIGPGIDVPAPDMSTGER 1576 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2924.12 47.8626 3 2043.013871 2043.009526 K E 212 232 PSM AGGLATTGDKDILDIVPTEIHQK 1577 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2957.16 48.78 3 2391.269771 2391.264555 K A 292 315 PSM LCAIPNLRENYGELADCCTK 1578 sp|P07724|ALBU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 2-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.2859.17 45.9944 3 2396.100971 2396.092287 K Q 98 118 PSM LDQGGAPLAGTNKETTIQGLDGLSER 1579 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2832.20 45.21663 3 2640.344171 2640.335488 K C 109 135 PSM LILPGLMSSR 1580 tr|A0A0R4J135|A0A0R4J135_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3065.4 51.82398 2 1085.625247 1085.626701 K I 94 104 PSM LAVNMVPFPR 1581 sp|A2AQ07|TBB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3031.3 50.87113 2 1142.626647 1142.627035 K L 253 263 PSM DAFVAIVQSVK 1582 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3140.5 53.99805 2 1175.654447 1175.655024 K N 588 599 PSM TDYDNFLMAHLINEK 1583 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:35 ms_run[1]:scan=1.1.2993.8 49.79198 3 1838.854271 1838.850900 K D 114 129 PSM VWQLYIGDTR 1584 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3020.8 50.56888 2 1249.645047 1249.645522 R S 30 40 PSM ELLLQPVTISR 1585 sp|P59999|ARPC4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3011.11 50.30813 2 1267.748847 1267.749987 K N 45 56 PSM LYVDVGYVDLR 1586 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3157.4 54.48115 2 1310.687847 1310.687053 K S 228 239 PSM NVATEALGALEAR 1587 sp|Q9JM62|REEP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3064.14 51.80412 2 1313.692447 1313.693929 K T 16 29 PSM SGWQWAGGSPFR 1588 sp|Q61830|MRC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3055.4 51.5495 2 1334.613047 1334.615619 R Y 288 300 PSM LVAIVDVIDQNR 1589 sp|Q9CR57|RL14_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3141.9 54.03017 2 1353.759847 1353.761615 K A 24 36 PSM ALLDAAAFYCDK 1590 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.3066.12 51.85907 2 1356.637647 1356.638388 K E 277 289 PSM TVDNFVALATGEK 1591 sp|P24369|PPIB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2976.14 49.30983 2 1363.696847 1363.698346 K G 72 85 PSM NGAPIIMSFPHFYQADEK 1592 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3172.12 54.90536 3 2063.980571 2063.977498 K F 331 349 PSM IQFHNVKPECLDAYNSLTEAVLPK 1593 sp|O55125|NIPS1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.3136.11 53.8879 4 2785.414494 2785.410902 K L 74 98 PSM AERPDGLILGMGGQTALNCGVELFKR 1594 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 11-UNIMOD:35,19-UNIMOD:4 ms_run[1]:scan=1.1.3154.7 54.40027 4 2817.4319 2817.4260 K G 498 524 PSM GIHVEIPGAQAESLGPLQVAR 1595 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3097.10 52.75422 3 2141.163071 2141.159302 R V 86 107 PSM NVGLDIEAEVPAVK 1596 sp|P42932|TCPQ_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3053.4 51.49737 2 1452.781247 1452.782410 K D 477 491 PSM FLTEELSLDQDR 1597 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2980.18 49.42792 2 1464.712847 1464.709639 K I 84 96 PSM GYSFSLTTFSPSGK 1598 sp|P49722|PSA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3122.15 53.4837 2 1477.710447 1477.708910 R L 5 19 PSM LYATTSLYSAWDK 1599 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3008.18 50.22603 2 1517.751247 1517.740210 R Q 399 412 PSM VVLDDKDYFLFR 1600 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3116.2 53.3005 3 1528.795571 1528.792580 K D 81 93 PSM GVVNILPGSGSLVGQR 1601 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3032.17 50.9105 2 1551.874047 1551.873290 K L 621 637 PSM LDTPDLLEVGTQQK 1602 sp|P13597|ICAM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2994.15 49.82508 2 1555.809247 1555.809353 K L 223 237 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 1603 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 6-UNIMOD:35 ms_run[1]:scan=1.1.3156.5 54.45587 4 3198.618494 3198.601950 R L 148 178 PSM MTVAHMWFDNQIHEADTTENQSGVSFDK 1604 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3004.19 50.11003 4 3237.432094 3237.413163 R T 386 414 PSM ELFSNLQEFAGPSGK 1605 tr|Q5I0W6|Q5I0W6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3171.17 54.88095 2 1622.791047 1622.794037 R L 57 72 PSM TQEFILNSPTVTSIK 1606 sp|Q9R0H0|ACOX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2979.18 49.39957 2 1676.898847 1676.898502 K W 160 175 PSM TLVYGGIFLYPANKK 1607 sp|Q9QXD6|F16P1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2994.4 49.8159 3 1682.940371 1682.939579 R S 256 271 PSM ISSEYSDMIESFCK 1608 tr|Q8R084|Q8R084_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 13-UNIMOD:4 ms_run[1]:scan=1.1.3131.18 53.7489 2 1694.712647 1694.716775 K A 116 130 PSM AIVAIENPADVSVISSR 1609 sp|P14206|RSSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3078.20 52.21029 2 1739.941047 1739.941764 R N 64 81 PSM VITAFNDGLNHLDSLK 1610 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3022.11 50.6296 3 1755.915671 1755.915549 K G 68 84 PSM ILVEPACGAALAAVYSR 1611 sp|Q8VBT2|SDHL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.3169.18 54.82473 2 1759.932247 1759.929091 K V 264 281 PSM IYGADDIELLPEAQNK 1612 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3125.20 53.5754 2 1787.895047 1787.894145 R A 833 849 PSM EGSVMLQVDVDTVNGGLK 1613 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3113.20 53.23015 2 1859.931047 1859.929879 R L 420 438 PSM FQDEEEVFEWNNEVK 1614 sp|Q9DBF1|AL7A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3126.21 53.60545 2 1940.840847 1940.842838 K Q 438 453 PSM GTLLSLSEQELLDCDKVDK 1615 sp|Q9R013|CATF_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 14-UNIMOD:4 ms_run[1]:scan=1.1.3147.12 54.20828 3 2162.082671 2162.077665 R A 291 310 PSM GHPLGATGLAQCAELCWQLR 1616 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 12-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3046.18 51.31545 3 2237.089871 2237.083377 K G 354 374 PSM NHPEPSTEQIMETLGGNLCR 1617 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 19-UNIMOD:4 ms_run[1]:scan=1.1.3078.18 52.20862 3 2282.051771 2282.041965 R C 134 154 PSM AGSNVMQTFTFYASEDKLENR 1618 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3141.19 54.0385 3 2407.116971 2407.111425 R G 66 87 PSM NQWEPVCGENGVTYISPCLAGCK 1619 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:4,18-UNIMOD:4,22-UNIMOD:4 ms_run[1]:scan=1.1.3154.13 54.40693 3 2638.167371 2638.161429 K S 463 486 PSM GTHMENAYDFYKPNLASEYPLVDGK 1620 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3007.14 50.19342 4 2858.336094 2858.322146 R L 232 257 PSM LLSHCLLVTLASHHPADFTPAVHASLDK 1621 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.2977.10 49.33557 5 3049.601618 3049.580761 K F 101 129 PSM TTGIVMDSGDGVTHTVPIYEGYALPHAILR 1622 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 6-UNIMOD:35 ms_run[1]:scan=1.1.3163.18 54.65365 4 3198.618494 3198.601950 R L 148 178 PSM GTNVITSLSSVLR 1623 sp|Q91X77|CY250_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3251.6 57.1225 2 1345.745247 1345.756529 K D 384 397 PSM ALPPLALFTSK 1624 sp|Q9DBE0|CSAD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3306.2 58.67003 2 1156.686047 1156.685596 R E 178 189 PSM DFLLQQTMLR 1625 sp|Q9CPU0|LGUL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3271.8 57.67193 2 1263.663847 1263.664543 K I 29 39 PSM LALDIEIATYR 1626 tr|E9Q1Z0|E9Q1Z0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3217.9 56.16728 2 1276.702447 1276.702703 K K 434 445 PSM SLDMDGIIAEVR 1627 sp|P11679|K2C8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3268.8 57.585 2 1317.658247 1317.659852 R A 259 271 PSM LNVAPVSDIIEIK 1628 sp|Q99LC5|ETFA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3220.10 56.25585 2 1409.813847 1409.812981 K S 127 140 PSM MIPAVVDGEFLPK 1629 sp|Q8QZR3|EST2A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3235.14 56.68308 2 1414.754647 1414.753024 K H 308 321 PSM DFSATDLTEFAAR 1630 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3297.10 58.42907 2 1442.667447 1442.667774 K A 26 39 PSM DGETFQLMGLYGR 1631 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3377.10 60.67658 2 1485.691647 1485.692214 K E 129 142 PSM FTDVSYPIIISPAR 1632 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3182.9 55.17513 2 1577.845847 1577.845344 K I 277 291 PSM LHFFMPGFAPLTSR 1633 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3329.6 59.315 3 1619.833271 1619.828254 R G 263 277 PSM ALTVPELTQQMFDAK 1634 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3387.9 60.95201 2 1690.859447 1690.860008 R N 283 298 PSM GVALPETIEEAENLGR 1635 sp|O08966|S22A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3220.3 56.25 3 1696.867871 1696.863179 K R 519 535 PSM GFGSDKESILELITSR 1636 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3333.7 59.43192 3 1750.913171 1750.910129 K S 35 51 PSM MQLIMLCYNPDFEK 1637 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 5-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3296.20 58.40822 2 1816.823447 1816.819800 R Q 109 123 PSM TDYDNFLMAHLINEK 1638 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3243.6 56.89578 3 1822.865171 1822.855985 K D 114 129 PSM SPLIIFSDCNMENAVK 1639 sp|Q9JLJ2|AL9A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4 ms_run[1]:scan=1.1.3241.15 56.84948 2 1836.879647 1836.875007 K G 259 275 PSM IFFYDAENPPGSEVLR 1640 sp|P52430|PON1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3286.19 58.12103 2 1852.906247 1852.899565 R I 291 307 PSM ICTTLIGLEEHLNALDR 1641 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 2-UNIMOD:4 ms_run[1]:scan=1.1.3257.4 57.27695 3 1967.023571 1967.014612 R A 381 398 PSM ITLPVDFVTADKFDENAK 1642 sp|P09411|PGK1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3231.6 56.56723 3 2022.039071 2022.030973 K T 280 298 PSM AVLDVAETGTEAAAATGVIGGIR 1643 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3368.14 60.42285 3 2141.141471 2141.132812 K K 361 384 PSM KPALPYTPGSDVAGIIESVGDK 1644 sp|P47199|QOR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3220.14 56.25918 3 2213.164871 2213.157964 R V 62 84 PSM LAEELNVPVYLYGEAAQTPSR 1645 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3387.5 60.9445 3 2319.185171 2319.174677 R Q 115 136 PSM IGPALSCGNTVVVKPAEQTPLTALHLASLIK 1646 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:4 ms_run[1]:scan=1.1.3375.16 60.62455 4 3197.807294 3197.784606 K E 180 211 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 1647 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.3249.7 57.06948 5 3609.842618 3609.815071 R S 178 213 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 1648 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:4 ms_run[1]:scan=1.1.3252.5 57.14682 5 3609.842618 3609.815071 R S 178 213 PSM AYLPVNESFGFTADLR 1649 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3419.5 61.82427 3 1798.893371 1798.889000 K S 786 802 PSM SSFIDDAFALAR 1650 sp|P16406|AMPE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3467.10 63.13818 2 1311.644847 1311.645916 R A 647 659 PSM FFPLEAWQIGK 1651 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3500.6 64.0951 2 1334.701647 1334.702309 R K 100 111 PSM NLTDAFLAEIEK 1652 sp|P11714|CP2D9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3507.5 64.28288 2 1362.703447 1362.703097 R A 273 285 PSM GIYETPAGTILYHAHLDIEAFTMDR 1653 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 23-UNIMOD:35 ms_run[1]:scan=1.1.3579.4 66.34355 4 2849.395294 2849.369431 R E 280 305 PSM DYGVLLESAGIALR 1654 sp|P20108|PRDX3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3618.13 67.46015 2 1475.797047 1475.798394 R G 172 186 PSM GLGGVNVEELFGISK 1655 sp|Q9Z2V4|PCKGC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3580.7 66.36885 2 1517.808247 1517.808959 K E 568 583 PSM AFIITINSFGTELSK 1656 sp|P51863|VA0D1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3500.10 64.10178 2 1639.880247 1639.882124 R E 220 235 PSM KIISQEILNLIELR 1657 sp|Q9QZ85|IIGP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3509.3 64.33511 3 1681.014671 1681.013807 R M 32 46 PSM AIQSLTDTCSDDLSVVTDCMEHALTACHPR 1658 sp|O88451|RDH7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 9-UNIMOD:4,19-UNIMOD:4,27-UNIMOD:4 ms_run[1]:scan=1.1.3443.19 62.46965 4 3402.514094 3402.494861 K T 248 278 PSM WGTDEAQFIYILGNR 1659 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3602.19 66.99503 2 1781.876447 1781.873684 K S 192 207 PSM KEGGLGPLNIPLLADVTK 1660 sp|Q61171|PRDX2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3430.6 62.10283 3 1834.058771 1834.056400 R S 92 110 PSM TGLLSGLDIMEVNPTLGK 1661 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:35 ms_run[1]:scan=1.1.3416.19 61.74994 2 1872.987447 1872.986666 K T 267 285 PSM FFNQLFSGLDPHALAGR 1662 sp|Q9DBE0|CSAD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3457.3 62.8509 3 1888.968671 1888.958417 R I 89 106 PSM INVLPLGSGAIAGNPLGVDR 1663 sp|Q91YI0|ARLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3432.3 62.15208 3 1932.080171 1932.079260 R E 194 214 PSM LLEPLVTQVTTLVNTNSK 1664 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3569.5 66.0759 3 1969.119971 1969.109558 R G 28 46 PSM TTVLLADMNDFGTVNEIYK 1665 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3532.12 65.0029 3 2143.068971 2143.050722 K T 79 98 PSM LSTIQNSDIIAVMSQGVVIEK 1666 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3602.11 66.98835 3 2244.212471 2244.203534 R G 1277 1298 PSM ITGTNAEVMPAQWEFQIGPCEGIR 1667 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 20-UNIMOD:4 ms_run[1]:scan=1.1.3498.11 64.05143 3 2703.288671 2703.278507 K M 190 214 PSM AEELGLPILGVLR 1668 sp|Q8VCH0|THIKB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3688.8 69.45061 2 1378.818047 1378.818401 K S 293 306 PSM LLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSK 1669 sp|P01942|HBA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 5-UNIMOD:4 ms_run[1]:scan=1.1.3719.15 70.32446 6 4283.313141 4283.277650 K Y 101 141 PSM IYIDDGLISLVVR 1670 sp|P53657|KPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3711.13 70.09075 2 1474.839647 1474.839531 R K 217 230 PSM GLVLIAFSQYLQK 1671 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3656.10 68.52654 2 1478.853047 1478.849701 K C 45 58 PSM VNFSPPGDTSNLFPGTWYLER 1672 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3696.4 69.68017 3 2396.152571 2396.143711 K V 474 495 PSM SALSGHLETVILGLLK 1673 sp|P07356|ANXA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3671.4 68.95783 3 1649.975471 1649.971607 K T 89 105 PSM FYTEDGNWDLVGNNTPIFFIR 1674 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3770.7 71.77392 3 2517.210371 2517.196475 K D 136 157 PSM GPGLFFILPCTDSLIK 1675 sp|P54116|STOM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.3760.18 71.49747 2 1776.951047 1776.948429 K V 78 94 PSM VLGILAMIDEGETDWK 1676 sp|Q9D819|IPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3754.19 71.32188 2 1788.900047 1788.896788 K V 140 156 PSM LFLEQIHVLENSLVLK 1677 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3639.4 68.05957 3 1894.098071 1894.092785 R F 59 75 PSM AIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFK 1678 tr|E9QPD7|E9QPD7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3689.21 69.491 4 3952.064494 3952.041091 R A 158 196 PSM LFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIR 1679 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3714.20 70.18328 4 3967.957694 3967.934060 K K 1388 1425 PSM QALSPDMLATDLAYYLVR 1680 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3820.10 73.14682 3 2039.046971 2039.039763 K K 362 380 PSM IISWQPPEVIQQYLSGGR 1681 sp|Q99J08|S14L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3731.7 70.67136 3 2070.096671 2070.089825 K C 71 89 PSM FNLGLDFPNLPYLIDGSHK 1682 sp|P19639|GSTM3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3726.12 70.5275 3 2159.109071 2159.105141 K V 51 70 PSM ALNVEPDGTGLTCSLAPNILSQL 1683 sp|P99029|PRDX5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 13-UNIMOD:4 ms_run[1]:scan=1.1.3819.6 73.12558 3 2382.219371 2382.210077 K - 188 211 PSM EIIGVVSQEPVLFSTTIAENIR 1684 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3722.11 70.40905 3 2414.311571 2414.305691 R Y 467 489 PSM KLTLQMPYQLFIGGEFVDAEGAK 1685 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3672.14 68.99423 3 2554.321271 2554.314148 K T 415 438 PSM FFIVNIDSLSSSSSAAPIQIPAPASVAR 1686 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3739.15 70.90508 3 2844.517271 2844.502159 K G 262 290 PSM CCAEANPPACYGTVLAEFQPLVEEPK 1687 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3643.6 68.17827 3 2949.347171 2949.334702 K N 384 410 PSM SFVQNYPVVSIEDPFDQDDWGAWQK 1688 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3757.20 71.4109 3 2969.367371 2969.350804 K F 282 307 PSM AHRFPALTPEQK 1689 sp|Q91Y97|ALDOB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.2273.7 29.46743 3 1435.7573 1435.7567 M K 2 14 PSM ILELFVVTNTK 1690 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3251.4 57.11833 2 1275.743047 1275.743839 R Q 291 302 PSM MDQTQHPSK 1691 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.1747.20 14.62233 2 1112.4873 1112.4915 - A 1 10 PSM SSYATCVLVSEENTNAIIIEPEKR 1692 sp|Q9QXD6|F16P1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 6-UNIMOD:4 ms_run[1]:scan=1.1.3028.21 50.80385 3 2722.353671 2722.348361 K G 88 112 PSM HRELPEDVGLDASTAESFHR 1693 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2467.11 34.86813 4 2265.090894 2265.077423 K V 1808 1828 PSM QKGEYLPLLQGK 1694 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:28 ms_run[1]:scan=1.1.2936.5 48.20207 2 1355.7423 1355.7444 K S 69 81 PSM NIVAVGAGFCDGLGFGDNTK 1695 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:4 ms_run[1]:scan=1.1.3291.9 58.25475 3 2010.954971 2010.946926 K A 205 225 PSM ELNDFISYLQR 1696 sp|P27773|PDIA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3381.2 60.78182 2 1396.698247 1396.698680 R E 472 483 PSM IHGQTIPSDGNIFTYTR 1697 sp|O35945|AL1A7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 ms_run[1]:scan=1.1.2767.15 43.3918 3 1918.9392 1918.9532 K R 140 157 PSM STGTFVVSQPLNYR 1698 sp|Q9JLJ2|AL9A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1 ms_run[1]:scan=1.1.3249.8 57.07115 2 1609.8087 1609.8095 M G 2 16 PSM VADALANAAGHLDDLPGALSALSDLHAHK 1699 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3455.6 62.80175 4 2863.456894 2862.462420 K L 63 92 PSM KVSFTVEVLLPDK 1700 sp|Q99J08|S14L2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2998.2 49.92418 3 1473.846971 1473.844282 K A 376 389 PSM SLAMEMVLTGDR 1701 sp|Q8BH95|ECHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3045.13 51.28227 2 1321.633247 1321.637008 K I 186 198 PSM TLASLSPETSLFIIASK 1702 sp|P06745|G6PI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3572.7 66.16275 2 1776.984247 1776.987317 K T 195 212 PSM AMNYSAKDEVDGGPAGPPGGAAK 1703 sp|Q8VEK0|CC50A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:1,2-UNIMOD:35 ms_run[1]:scan=1.1.2374.20 32.27902 3 2217.0122 2217.0002 M T 2 25 PSM CNTEEHIFVSK 1704 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2485.21 35.3913 2 1345.6009 1345.5967 K M 327 338 PSM CNTEEHIFVSK 1705 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 22 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2479.20 35.21838 2 1345.6009 1345.5967 K M 327 338 PSM APSHVPFLLIGGGTAAFAAAR 1706 sp|Q9Z0X1|AIFM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.3268.10 57.58667 3 2023.101371 2023.100330 R S 127 148 PSM KYVLGNPLTPGINQGPQIDK 1707 sp|P24549|AL1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=1.1.2790.11 44.04947 3 2151.176171 2151.168804 K E 329 349 PSM VHLTDAEK 1708 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=1.1.1682.13 12.81463 2 911.4675 911.4707 M A 2 10 PSM GVSEIVHEGKK 1709 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1720.21 13.87198 2 1181.638447 1181.640437 K I 37 48 PSM SPKVENDGELK 1710 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1728.21 14.09555 2 1214.610447 1214.614282 R T 657 668 PSM RPAGQQDEDTDK 1711 tr|Q9JHF5|Q9JHF5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1538.20 8.81955 2 1358.604247 1358.606236 R L 669 681 PSM TATPQQAQEVHEK 1712 sp|P17751|TPIS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1683.12 12.84473 2 1465.717247 1465.716121 K L 226 239 PSM TVEAEAAHGTVTR 1713 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1775.13 15.41142 3 1340.666771 1340.668442 K H 302 315 PSM VSQAAADLK 1714 sp|Q80SZ7|GBG5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1775.14 15.41225 2 901.486647 901.486896 K Q 28 37 PSM VGFGQCAGK 1715 sp|P35505|FAAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.1876.14 18.27975 2 922.431047 922.433087 R V 403 412 PSM RFLEEATR 1716 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1902.17 19.01463 2 1020.535047 1020.535243 K V 1150 1158 PSM TNCDLYEK 1717 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 3-UNIMOD:4 ms_run[1]:scan=1.1.1852.14 17.59968 2 1041.442447 1041.443711 K L 414 422 PSM TASTNSIAQAR 1718 sp|Q9DAS9|GBG12_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1768.20 15.2168 2 1118.566647 1118.568000 K R 5 16 PSM STTTGHLIYK 1719 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1851.19 17.5755 2 1119.590247 1119.592424 K C 21 31 PSM SHGQDYLVGNR 1720 sp|P10648|GSTA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1889.9 18.64 3 1244.593571 1244.589798 K L 142 153 PSM TAHIVLEDGTK 1721 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1955.8 20.49135 3 1182.624371 1182.624452 K M 45 56 PSM SRNDQVVTDLR 1722 sp|Q91YI0|ARLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1985.12 21.34723 3 1301.670671 1301.668777 R L 112 123 PSM IDGASPLDK 1723 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2012.16 22.10912 2 914.470047 914.470912 K V 161 170 PSM IDGASPLDK 1724 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2006.14 21.94058 2 914.470047 914.470912 K V 161 170 PSM LGVTADDVK 1725 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2073.11 23.82215 2 916.484847 916.486562 K N 171 180 PSM SSITQIER 1726 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1998.15 21.71612 2 932.492847 932.492710 K R 48 56 PSM GAAELMQQK 1727 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1962.15 20.69668 2 974.483647 974.485516 K E 378 387 PSM DHHDVSGTDSPFR 1728 sp|Q8VC12|HUTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1943.14 20.16608 3 1468.633571 1468.633120 R E 544 557 PSM RPWFAGDK 1729 sp|P10649|GSTM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2022.16 22.39123 2 975.487047 975.492650 K V 145 153 PSM YVVVSTPEK 1730 sp|P18572|BASI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2108.14 24.80042 2 1020.547247 1020.549162 K S 278 287 PSM NQAPPGLYTK 1731 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2062.15 23.51992 2 1087.565647 1087.566209 K T 200 210 PSM NKTEDLEATSEHFK 1732 sp|O70404|VAMP8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2025.19 22.47972 3 1647.776471 1647.774030 R T 46 60 PSM IAVAAQNCYK 1733 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 8-UNIMOD:4 ms_run[1]:scan=1.1.2007.19 21.97255 2 1136.566447 1136.564829 K V 110 120 PSM ALQATVGNSYK 1734 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2054.20 23.29522 2 1150.599647 1150.598238 K C 316 327 PSM REDIFYTSK 1735 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2073.18 23.828 2 1157.570847 1157.571688 K V 76 85 PSM ATAVMPDGQFK 1736 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:35 ms_run[1]:scan=1.1.2062.18 23.52242 2 1179.559047 1179.559410 K D 17 28 PSM GRNDLMEYAK 1737 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2125.6 25.2818 3 1195.568171 1195.565557 K Q 156 166 PSM TFRPPYYHR 1738 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1992.10 21.54395 3 1235.620271 1235.619976 K N 328 337 PSM GEGMSQAATICR 1739 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 11-UNIMOD:4 ms_run[1]:scan=1.1.2074.21 23.85798 2 1279.566447 1279.564906 K S 305 317 PSM MDSTEPPYSQK 1740 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1980.19 21.20977 2 1281.554847 1281.554718 K R 155 166 PSM ALQTTYGTNAPR 1741 sp|Q8CG76|ARK72_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2062.21 23.52492 2 1291.652047 1291.652064 K M 287 299 PSM GDNQSPIELHTK 1742 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2004.10 21.88157 3 1337.661971 1337.657543 K D 25 37 PSM TLEEDAHQQIAR 1743 sp|Q9DCG6|PBLD1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2029.14 22.58762 3 1409.692271 1409.689906 R E 29 41 PSM FNSANEDNVTQVR 1744 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2121.21 25.17938 2 1492.689447 1492.690634 R T 432 445 PSM TTITTTTSSSTTVGSAR 1745 sp|O35682|MYADM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2042.21 22.95893 2 1670.837247 1670.832273 R A 8 25 PSM HPQVQEAQVVGVKDER 1746 sp|Q8VCW8|ACSF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1978.20 21.15323 3 1817.944571 1817.938410 K M 532 548 PSM IAAELNCDPTDER 1747 sp|Q9CXF0|KYNU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.2303.8 30.30312 2 1502.677247 1502.667122 R V 16 29 PSM ADEGISFR 1748 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2231.10 28.2722 2 893.424647 893.424296 K G 121 129 PSM QTVAVGVIK 1749 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2202.6 27.44133 2 913.556847 913.559667 R A 431 440 PSM TNAENEFVTIKK 1750 sp|P04104|K2C1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2149.12 25.98003 3 1392.725171 1392.724895 R D 286 298 PSM DSQGNLFR 1751 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2206.10 27.55695 2 935.444847 935.446094 K N 88 96 PSM ALAVSDLNR 1752 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2253.9 28.89732 2 957.523447 957.524344 K A 1062 1071 PSM DGGGDVAFVK 1753 sp|Q921I1|TRFE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2280.6 29.65758 2 963.466247 963.466161 K H 216 226 PSM SCNCLLLK 1754 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.2261.11 29.1251 2 1006.493247 1006.493973 K V 336 344 PSM CGIAVAPVSR 1755 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.2219.10 27.92683 2 1028.542847 1028.543700 K W 643 653 PSM KLDPGSEETQTLVR 1756 sp|Q9D8N0|EF1G_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2212.15 27.72975 3 1571.817971 1571.815501 R E 401 415 PSM TPQIQVYSR 1757 sp|P01887|B2MG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2244.13 28.64303 2 1090.576847 1090.577108 K H 24 33 PSM WLNENAVEK 1758 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2251.16 28.84627 2 1101.546047 1101.545474 K V 310 319 PSM GYEPDPNIVK 1759 sp|P11725|OTC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2333.17 31.13127 2 1130.560447 1130.560789 K L 222 232 PSM IQRPPEDSIQPYEK 1760 sp|Q91ZJ5|UGPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2200.17 27.39513 3 1698.859871 1698.857700 K I 78 92 PSM YHTEIVFAR 1761 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2280.12 29.66258 2 1134.577447 1134.582194 R T 684 693 PSM GEFITTVQQR 1762 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2314.18 30.6001 2 1177.608647 1177.609137 K G 221 231 PSM QHGIPIPVTPK 1763 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2280.2 29.65425 3 1185.688871 1185.686993 K S 166 177 PSM AIQDAGCQVLK 1764 sp|P40936|INMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.2234.18 28.36353 2 1201.612247 1201.612508 K C 225 236 PSM LAQGEYIAPEK 1765 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2161.17 26.31573 2 1217.632247 1217.629203 K I 563 574 PSM KFDQLLAEEK 1766 sp|O08638|MYH11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2278.15 29.61057 2 1219.642847 1219.644853 K N 1452 1462 PSM LPAKPEVSSDEDVQYR 1767 sp|Q8BMS1|ECHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2239.21 28.50792 3 1831.897571 1831.895208 R V 661 677 PSM DQVANSAFVER 1768 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2285.18 29.80435 2 1234.593047 1234.594215 K L 501 512 PSM EQVANSAFVER 1769 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2190.19 27.1173 2 1248.607247 1248.609865 K V 492 503 PSM HLWNVDVQGSK 1770 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2313.16 30.57043 2 1281.655447 1281.646585 R A 33 44 PSM ASGPGAAAQIQEVK 1771 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2150.20 26.01548 2 1325.692647 1325.693929 K E 762 776 PSM EAAQMDMVNDGVEDLRGK 1772 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:35,7-UNIMOD:35 ms_run[1]:scan=1.1.2212.19 27.73308 3 2008.887671 2008.883006 R Y 86 104 PSM ALGQNPTNAEVLK 1773 sp|Q60605|MYL6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2292.20 29.99752 2 1353.725247 1353.725229 R V 38 51 PSM FEEGGYVVCNTK 1774 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2320.21 30.77523 2 1401.625647 1401.623466 R Q 65 77 PSM VVAGVAAALAHKYH 1775 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2307.5 30.39758 3 1405.785671 1405.783019 K - 134 148 PSM IWHHTFYNELR 1776 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2298.17 30.16402 3 1514.744471 1514.741882 K V 85 96 PSM QVIQDCEDENIQR 1777 sp|Q3V3R4|ITA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.2160.20 26.29162 2 1645.739047 1645.736599 K F 292 305 PSM GTVCAANDFNPDADAK 1778 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.2318.21 30.71748 2 1664.710847 1664.710050 K A 355 371 PSM SALEHSVQCAVDVKR 1779 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2163.18 26.37183 3 1697.855771 1697.851903 R F 417 432 PSM ASGGGVPTDEEQATGLER 1780 tr|Q9D881|Q9D881_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 21 ms_run[1]:scan=1.1.2307.20 30.41093 2 1772.8146470956601 1772.8176850320797 M E 32 50 PSM SLVANLAAANCYKK 1781 sp|P55264|ADK_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 11-UNIMOD:4 ms_run[1]:scan=1.1.2424.11 33.66573 2 1521.796247 1521.797348 R E 149 163 PSM THINIVVIGHVDSGK 1782 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2379.6 32.41022 4 1587.878494 1587.873290 K S 6 21 PSM GQVGDLSPQQQEALAR 1783 sp|Q8R0F9|S14L4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2416.12 33.45383 2 1695.858447 1695.854011 R F 3 19 PSM EGHEVVGVFTIPDKDGK 1784 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2536.5 36.79898 4 1825.929294 1825.921028 K A 22 39 PSM VVGNPFDSR 1785 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2356.10 31.76005 2 989.492647 989.493044 R T 349 358 PSM VLTEIIASR 1786 sp|P48036|ANXA5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2534.12 36.74771 2 1000.590847 1000.591696 K T 107 116 PSM STALQLIQR 1787 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2527.7 36.55135 2 1028.596647 1028.597844 K F 462 471 PSM THINIVVIGHVDSGK 1788 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2394.14 32.83748 3 1587.875471 1587.873290 K S 6 21 PSM ALGLSNFNSR 1789 sp|Q9JII6|AK1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2495.14 35.67282 2 1077.557647 1077.556707 K Q 158 168 PSM TIAQDYGVLK 1790 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2512.7 36.1503 2 1106.598647 1106.597175 R A 111 121 PSM ILDLIESGKK 1791 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2349.2 31.56032 3 1114.660871 1114.659775 K E 354 364 PSM VVFDDTYDR 1792 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2411.15 33.3116 2 1128.511047 1128.508754 R S 68 77 PSM VEMSDMSFSK 1793 sp|P01887|B2MG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2492.13 35.58698 2 1159.489847 1159.488946 K D 69 79 PSM NRYFPAFEK 1794 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2363.15 31.96192 2 1170.584847 1170.582194 R V 130 139 PSM GLGTDDNTLIR 1795 sp|P97429|ANXA4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2441.15 34.1364 2 1173.597647 1173.598966 K V 260 271 PSM SHMPYTDAMIHEVQR 1796 sp|Q64458|CP2CT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2427.18 33.74803 3 1813.831571 1813.823974 R F 343 358 PSM VAEEWAQGTFK 1797 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2535.14 36.77785 2 1264.610847 1264.608802 K L 70 81 PSM AFSGYLGPDESK 1798 sp|Q9R0P3|ESTD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2462.16 34.73185 2 1269.589847 1269.587733 K W 187 199 PSM NMVPQQALVIR 1799 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:35 ms_run[1]:scan=1.1.2466.15 34.8431 2 1283.693447 1283.701992 K E 153 164 PSM MLSASGDPVSVVK 1800 sp|O08601|MTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2514.12 36.20607 2 1288.666447 1288.669688 K G 716 729 PSM QMYMSLPQGEK 1801 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2514.13 36.20773 2 1310.602847 1310.599894 K V 15 26 PSM GNIYSLNEGYAK 1802 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2466.17 34.84477 2 1327.640847 1327.640831 K D 207 219 PSM AIAGTGANVIVTGGK 1803 sp|P42932|TCPQ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2377.19 32.3637 2 1327.745247 1327.745965 K V 282 297 PSM ILYSQCGDVMR 1804 sp|Q60605|MYL6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.2422.11 33.61345 2 1340.627847 1340.621692 K A 27 38 PSM IYYGTEAQIGER 1805 sp|Q9JLF6|TGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2397.19 32.92533 2 1398.679247 1398.677945 R T 274 286 PSM YSSTEEVLVAANK 1806 sp|Q3V3R4|ITA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2426.20 33.72235 2 1409.704447 1409.703825 K I 227 240 PSM EGLELPEDEEEK 1807 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2518.18 36.31721 2 1415.630447 1415.630385 K K 548 560 PSM TWNDPSVQQDIK 1808 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2451.19 34.42192 2 1429.685647 1429.683758 R F 103 115 PSM FAQLCEEHGILR 1809 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.2451.9 34.41357 3 1471.727471 1471.724183 R E 153 165 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 1810 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:35,11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2468.21 34.90457 4 2948.406494 2948.394283 K L 176 205 PSM IFINNEWHNSVSGK 1811 sp|P24549|AL1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2469.12 34.92532 3 1643.810171 1643.805605 K K 23 37 PSM YFVTAVSRPGLGEPR 1812 sp|P01901|HA1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2526.4 36.5244 3 1647.875171 1647.873290 R Y 28 43 PSM HQGSLYSLFPDHSVK 1813 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2549.12 37.17385 3 1713.851171 1713.847470 R K 130 145 PSM MLLEYTDSSYDEKR 1814 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2504.18 35.9338 3 1748.801171 1748.792716 R Y 19 33 PSM YHTSQSGDEMTSLSEYVSR 1815 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:35 ms_run[1]:scan=1.1.2378.19 32.39237 3 2191.942571 2191.932792 R M 457 476 PSM SGFHTVPGQPGCQDINECLR 1816 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 12-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.2510.20 36.10205 3 2271.020771 2271.016085 R F 3812 3832 PSM ALNDHHVYLEGTLLKPNMVTAGHACTK 1817 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 25-UNIMOD:4 ms_run[1]:scan=1.1.2553.5 37.28227 6 2989.510941 2989.490232 K K 216 243 PSM IWDIGGQPR 1818 sp|Q9CQW2|ARL8B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2566.6 37.65112 2 1040.539047 1040.540329 K F 69 78 PSM EATWVVDVK 1819 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2646.8 39.93616 2 1045.546047 1045.544411 K N 471 480 PSM LAELEAALQR 1820 sp|P11679|K2C8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2649.7 40.02193 2 1112.618847 1112.618973 K A 359 369 PSM LGDPLLEDTR 1821 sp|Q9JLJ2|AL9A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2625.11 39.3305 2 1127.583247 1127.582253 K M 317 327 PSM SADVIIGFEHGTAVER 1822 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2674.5 40.74145 3 1699.861271 1699.852949 R G 622 638 PSM LDPTQTSFLK 1823 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2676.4 40.79702 2 1148.609447 1148.607740 K M 278 288 PSM YIGGCCGFEPYHIR 1824 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2622.11 39.2431 3 1727.762471 1727.754832 R A 295 309 PSM AVAQALEVIPR 1825 sp|P80318|TCPG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2747.11 42.8079 2 1165.684047 1165.681908 R T 439 450 PSM LGREEATMEDIVQAAK 1826 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2721.11 42.06787 3 1759.883471 1759.877449 R D 518 534 PSM LVQAFQFTDK 1827 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2733.10 42.40378 2 1195.625247 1195.623724 R H 159 169 PSM EVATSVQLTLR 1828 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2642.11 39.82303 2 1215.682647 1215.682302 K S 42 53 PSM LEVGTETIIDK 1829 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2609.12 38.86862 2 1216.654847 1216.655084 R S 127 138 PSM GVLFASGQNLAR 1830 sp|Q9CPY7|AMPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2612.12 38.95532 2 1231.666047 1231.667320 K H 189 201 PSM AHMVTLDYTVQVPGTGR 1831 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 3-UNIMOD:35 ms_run[1]:scan=1.1.2662.12 40.40287 3 1859.921171 1859.919983 K D 214 231 PSM AHMVTLDYTVQVPGTGR 1832 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 3-UNIMOD:35 ms_run[1]:scan=1.1.2656.11 40.2273 3 1859.921171 1859.919983 K D 214 231 PSM MNPQSAFFQGK 1833 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2562.18 37.55147 2 1253.584247 1253.586293 K L 512 523 PSM AADTIGYPVMIR 1834 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:35 ms_run[1]:scan=1.1.2705.16 41.62355 2 1321.669847 1321.670023 K S 576 588 PSM IGAFGYMECSAK 1835 sp|Q9QUI0|RHOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2643.20 39.85952 2 1332.586847 1332.584244 R T 151 163 PSM TVIIEQSWGSPK 1836 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2650.19 40.06078 2 1343.709647 1343.708516 R V 61 73 PSM LPMGMTAENLAAK 1837 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2670.16 40.6385 2 1345.673647 1345.673393 K Y 159 172 PSM YLILNATQAESK 1838 sp|Q9CQV8|1433B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2581.15 38.07922 2 1349.719447 1349.719081 K V 106 118 PSM VLDASWYSPGTR 1839 sp|P52196|THTR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2747.16 42.81207 2 1350.657847 1350.656815 R Q 31 43 PSM SIVVTNYEESIK 1840 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2608.17 38.84383 2 1380.713847 1380.713661 R M 226 238 PSM LGPALATGNVVVMK 1841 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:35 ms_run[1]:scan=1.1.2619.20 39.16335 2 1384.774847 1384.774822 K V 198 212 PSM GNPTVEVDLYTAK 1842 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2650.20 40.06161 2 1405.710247 1405.708910 R G 16 29 PSM SPQSFFDTTPSGR 1843 sp|B2RX12|MRP3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2609.17 38.87278 2 1425.657647 1425.652458 R I 1051 1064 PSM QVIGPSGLLQGTTR 1844 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2756.15 43.07178 2 1425.793047 1425.793977 K I 792 806 PSM APQVSTPTLVEAAR 1845 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2553.18 37.29312 2 1438.777047 1438.777993 K N 439 453 PSM DRATLGINDTLIR 1846 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2696.2 41.35172 3 1456.804871 1456.799791 K L 362 375 PSM LEGTNVQEAQNILK 1847 sp|Q9Z2I8|SUCB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2648.18 40.00232 2 1555.822047 1555.820586 R S 394 408 PSM MTSEVETNIVAVER 1848 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2644.19 39.8876 2 1576.777647 1576.776672 R I 1256 1270 PSM AIANECQANFISIK 1849 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.2738.20 42.55562 2 1577.788447 1577.787178 K G 530 544 PSM FLGVAEQLHNEGFK 1850 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2746.6 42.77473 3 1587.810071 1587.804542 R L 1374 1388 PSM NYDYILSTGCAPPGK 1851 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:4 ms_run[1]:scan=1.1.2740.20 42.61308 2 1654.767647 1654.766108 R N 177 192 PSM DGFNPAHVEAGLYGSR 1852 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2742.13 42.66473 3 1688.798171 1688.790683 K I 212 228 PSM AGDREDITEPAICALR 1853 sp|Q02248|CTNB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.2606.15 38.78415 3 1785.868571 1785.867947 R H 454 470 PSM EAAQMDMVNDGVEDLR 1854 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:35 ms_run[1]:scan=1.1.2615.20 39.04783 2 1807.773047 1807.771664 R G 86 102 PSM EAAQMDMVNDGVEDLR 1855 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:35 ms_run[1]:scan=1.1.2635.21 39.62852 2 1807.773847 1807.771664 R G 86 102 PSM KYTPEQVAMATVTALHR 1856 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:35 ms_run[1]:scan=1.1.2669.14 40.60775 3 1931.000471 1930.993482 K T 243 260 PSM MGFEPLAYR 1857 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2822.11 44.92687 2 1082.521047 1082.521901 K G 40 49 PSM LGVGGAVLLER 1858 sp|Q99LB7|SARDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2779.7 43.73257 2 1082.643447 1082.644794 K E 89 100 PSM ALLNLVPVQK 1859 sp|P04919|B3AT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2935.3 48.17015 2 1093.686047 1093.685930 K E 344 354 PSM VADIGLAAWGR 1860 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2933.7 48.11875 2 1127.606647 1127.608743 K K 9 20 PSM AAFQLGSPWR 1861 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2928.10 47.9762 2 1131.581447 1131.582528 R R 87 97 PSM SKDIVLVAYSALGSHR 1862 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2770.8 43.47352 3 1714.944371 1714.936619 R E 208 224 PSM TGQSYLAAGLLK 1863 sp|Q99MZ7|PECR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2786.5 43.92963 2 1220.676647 1220.676488 K N 6 18 PSM VAGALAEEGMGLEEITKR 1864 sp|Q8VC30|TKFC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2843.11 45.52632 3 1872.966071 1872.961513 K V 163 181 PSM EVGADFTIQVGK 1865 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2775.7 43.61775 2 1262.651047 1262.650667 K E 215 227 PSM LKLPAVVTADLR 1866 sp|Q9DCW4|ETFB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2841.3 45.46162 3 1294.796771 1294.797272 R L 175 187 PSM LVQNCLWTLR 1867 sp|Q02248|CTNB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.2938.4 48.25422 2 1301.690247 1301.691427 R N 377 387 PSM IMNTFSVVPSPK 1868 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2803.16 44.40782 2 1318.696247 1318.695509 R V 163 175 PSM QGFGNLPICMAK 1869 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2948.9 48.52583 2 1334.644647 1334.647513 K T 855 867 PSM IQDTIEITGTFK 1870 sp|O35488|S27A2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2834.16 45.27108 2 1364.716847 1364.718747 R H 561 573 PSM TIIPLISQCTPK 1871 sp|P08249|MDHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2919.16 47.72217 2 1369.762647 1369.763923 K V 204 216 PSM VSFELFADKVPK 1872 sp|P17742|PPIA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2926.2 47.91177 3 1378.750871 1378.749653 R T 20 32 PSM GNDVLVIECNLR 1873 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2865.15 46.16613 2 1400.708047 1400.708199 K A 1248 1260 PSM GNDVLVIECNLR 1874 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.2875.17 46.45485 2 1400.708047 1400.708199 K A 1248 1260 PSM LHVVGAPGGQSLSLSLDDLHK 1875 sp|Q8R086|SUOX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2880.15 46.59808 3 2142.145571 2142.143317 R F 233 254 PSM DQNCQEILSTFK 1876 sp|P56528|CD38_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.2869.15 46.28245 2 1481.682047 1481.682044 R G 83 95 PSM ALENNMSLDEIVR 1877 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2965.14 49.00157 2 1502.741247 1502.739893 K L 857 870 PSM WEYYDSVYTER 1878 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2817.13 44.79807 2 1509.641847 1509.641225 R Y 653 664 PSM WEYYDSVYTER 1879 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2824.19 44.98892 2 1509.641847 1509.641225 R Y 653 664 PSM LGTLEVEDQIEAAR 1880 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2864.21 46.14215 2 1542.790047 1542.788952 R Q 592 606 PSM SAYALGGLGSGICPNK 1881 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.2775.19 43.62775 2 1563.772447 1563.771528 R E 588 604 PSM STEPCAHLLVSSIGVVGTAEQNR 1882 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.2952.20 48.6444 3 2424.211871 2424.206723 K T 53 76 PSM FSSETWQNLGTLQR 1883 sp|Q8VCR7|ABHEB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2956.20 48.75543 2 1665.814247 1665.811084 R L 43 57 PSM EFGASECISPQDFSK 1884 sp|P28474|ADHX_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.2809.20 44.58183 2 1700.730847 1700.735202 K S 234 249 PSM ETIPLQESTLYTEDR 1885 sp|O88531|PPT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2856.20 45.91167 2 1793.870047 1793.868324 K L 254 269 PSM NPDDITNEEYGEFYK 1886 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2831.20 45.18772 2 1832.774647 1832.774089 R S 301 316 PSM EGSVMLQVDVDTVNGGLK 1887 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:35 ms_run[1]:scan=1.1.2949.14 48.56285 2 1875.923847 1875.924794 R L 420 438 PSM ATDFVVPGPGKVEITYTPK 1888 sp|O88844|IDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2931.14 48.0667 3 2018.073971 2018.072444 R D 141 160 PSM ALPGHLKPFETLLSQNQGGK 1889 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2793.2 44.11682 4 2134.162494 2134.153488 K A 122 142 PSM DAEVVLCGGTESMSQSPYCVR 1890 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4,13-UNIMOD:35,19-UNIMOD:4 ms_run[1]:scan=1.1.2811.15 44.63648 3 2360.020571 2360.008283 K N 110 131 PSM RLVGQGATAVLLDVPDSEGEAQAK 1891 tr|A2AFQ2|A2AFQ2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2872.20 46.37217 3 2423.271071 2423.265617 K K 29 53 PSM INQYPESNAEYLAQLEPGAHVVK 1892 sp|Q923B6|STEA4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2939.9 48.29033 3 2569.284671 2569.281267 K A 110 133 PSM AGVLADDHLIEVNGENVENASHEEVVEK 1893 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2792.11 44.09873 4 3015.463694 3015.442138 K V 172 200 PSM ILPSVSHKPFESIDQGHVTHNWDEVGPDPNQLR 1894 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2791.15 44.07492 5 3747.863618 3747.839372 R W 64 97 PSM QGEIFLLPAR 1895 sp|Q78JT3|3HAO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3012.8 50.3349 2 1142.643847 1142.644794 R V 79 89 PSM TREGNDLYHEMIESGVINLK 1896 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3083.4 52.34063 4 2317.142894 2317.137246 R D 240 260 PSM VCLIGCGFSTGYGSAVK 1897 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2970.5 49.1329 3 1774.840271 1774.838227 K V 170 187 PSM WTLGEVQVLR 1898 sp|Q8C0Z1|F234A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3110.6 53.1314 2 1199.665447 1199.666258 R K 365 375 PSM TFESLVDFCK 1899 sp|Q61425|HCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 9-UNIMOD:4 ms_run[1]:scan=1.1.3056.5 51.57978 2 1244.578647 1244.574725 K T 193 203 PSM VWQLYIGDTR 1900 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3014.8 50.39352 2 1249.645047 1249.645522 R S 30 40 PSM APLDIPVPDPVK 1901 sp|P97371|PSME1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3057.4 51.60677 2 1259.703247 1259.712539 K E 59 71 PSM VPTPNVSVVDLTCRLEK 1902 sp|P16858|G3P_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.2986.15 49.59615 3 1926.029171 1926.024448 R P 233 250 PSM DATNVGDEGGFAPNILENK 1903 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3095.7 52.69307 3 1959.927071 1959.917400 K E 203 222 PSM LASLSEKPPAIDWAYYR 1904 sp|Q9DCX2|ATP5H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3022.13 50.63127 3 1979.020871 1979.015263 R A 42 59 PSM DVFISAAERDVYTGDALR 1905 sp|O09061|PSB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3110.10 53.13474 3 1996.989071 1996.985420 K I 204 222 PSM VCLLGCGISTGYGAAVNTAK 1906 sp|P28474|ADHX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2993.10 49.79365 3 2010.991871 2010.986683 K V 169 189 PSM LEAALADVPELAR 1907 sp|Q9D6Y9|GLGB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3028.13 50.79718 2 1366.744647 1366.745630 R L 18 31 PSM GVDLVLNSLAEEK 1908 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3083.16 52.35063 2 1385.737447 1385.740210 K L 1733 1746 PSM FVEGLPINDFSR 1909 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3110.17 53.14058 2 1392.704647 1392.703765 K E 299 311 PSM ELEEIVQPIISK 1910 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3028.16 50.79968 2 1396.779847 1396.781347 K L 623 635 PSM LHSFVSDDIFLR 1911 sp|Q9ET01|PYGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2997.3 49.89732 3 1447.744571 1447.745965 K E 522 534 PSM QGVVCIFGTGDFGK 1912 sp|Q923B6|STEA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.3112.12 53.1947 2 1483.711847 1483.712950 K S 19 33 PSM DFDPAINEYLQR 1913 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3169.13 54.82057 2 1479.700247 1479.699408 K K 219 231 PSM LDIDPETITWQR 1914 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3170.14 54.84995 2 1485.748047 1485.746358 R V 521 533 PSM SCVITYLAQVDPK 1915 sp|Q9JMD3|STA10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.3023.17 50.66337 2 1492.760647 1492.759566 K G 180 193 PSM ANNTTYGLAAGLFTK 1916 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3055.10 51.55952 2 1540.788847 1540.788558 R D 421 436 PSM LLLINNAATLGDVSK 1917 sp|Q64105|SPRE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3102.17 52.90593 2 1540.880647 1540.882458 R G 96 111 PSM AILVDLEPGTMDSVR 1918 sp|P99024|TBB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3160.10 54.57065 2 1614.829247 1614.828708 R S 63 78 PSM LTVEDPVTVEYITR 1919 sp|Q9CWH6|PSMA8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3075.16 52.12095 2 1633.855047 1633.856303 K F 98 112 PSM AAVEEGIVLGGGCALLR 1920 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.3164.20 54.6832 2 1683.898847 1683.897791 R C 430 447 PSM ETTDTDTADQVIASFK 1921 sp|P57780|ACTN4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3043.21 51.23087 2 1740.803247 1740.805390 R V 839 855 PSM IFVEESVYDEFVKR 1922 sp|P24549|AL1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3136.3 53.88122 3 1758.889271 1758.882852 R S 309 323 PSM VFLTTAEVISQQVSDK 1923 sp|P06801|MAOX_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3088.19 52.4989 2 1763.927247 1763.930531 K H 477 493 PSM SGNSVTLLVLDGDSYEK 1924 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3130.19 53.72065 2 1795.883047 1795.883974 K A 78 95 PSM GSRVEIEAIAVQGPFIK 1925 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3016.8 50.4521 3 1813.013171 1813.009784 R A 118 135 PSM HIEWESVLTNTAGCLR 1926 sp|P30999|CTND1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 14-UNIMOD:4 ms_run[1]:scan=1.1.3136.6 53.88372 3 1884.919271 1884.915232 R N 520 536 PSM HSMNPFCEIAVEEAVR 1927 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.2977.11 49.3364 3 1887.865571 1887.860753 K L 36 52 PSM ECDVLPDDTVSTLYNR 1928 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.3005.21 50.14085 2 1895.860047 1895.857108 K F 151 167 PSM AGSNVMQTFTFYASEDKLENR 1929 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3129.18 53.6907 3 2407.116971 2407.111425 R G 66 87 PSM CEMASTGEVACFGEGIHTAFLK 1930 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.3109.19 53.11283 3 2414.079371 2414.070489 R A 1327 1349 PSM CEMASTGEVACFGEGIHTAFLK 1931 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.3115.17 53.28455 3 2414.079371 2414.070489 R A 1327 1349 PSM GMHPNKEEHESFVDINPLTGIILR 1932 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3102.14 52.90343 4 2745.402894 2745.390835 K G 355 379 PSM GPHLVQSDGTVPFWAHAGNAIPSADQIR 1933 sp|Q9D0F3|LMAN1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3035.18 50.99578 4 2940.474094 2940.463088 K I 62 90 PSM NICFTVWDVGGQDK 1934 sp|P61750|ARF4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 3-UNIMOD:4 ms_run[1]:scan=1.1.3252.9 57.15432 2 1637.749647 1637.750792 K I 60 74 PSM VCTLAIIDPGDSDIIR 1935 sp|P62889|RL30_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.3311.11 58.81715 2 1756.912847 1756.902936 R S 91 107 PSM MATLVQDILDK 1936 sp|Q9JKX3|TFR2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3239.3 56.7849 2 1245.664247 1245.663874 R L 167 178 PSM AWRHPDEPVLLEEPVVLALAEK 1937 sp|Q9JII6|AK1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3373.10 60.56255 4 2510.362494 2510.353310 R H 219 241 PSM LALIQLQVSSIK 1938 sp|Q9JHW2|NIT2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3176.4 55.01232 2 1311.813247 1311.812588 R S 6 18 PSM TPVLFDVYEIK 1939 sp|P97384|ANX11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3304.3 58.62207 2 1322.713447 1322.712205 K E 270 281 PSM NCMSEFMGLIK 1940 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:4 ms_run[1]:scan=1.1.3302.2 58.56145 2 1328.594847 1328.592700 R G 337 348 PSM TDEQALLSSILAK 1941 sp|Q9CQ22|LTOR1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3349.7 59.87052 2 1387.754847 1387.755861 R T 48 61 PSM AFPAWADTSILSR 1942 sp|Q9EQ20|MMSA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3305.3 58.64485 2 1433.729647 1433.730314 R Q 89 102 PSM NEGVATYAAAVLFR 1943 sp|Q02248|CTNB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3357.10 60.10172 2 1480.765047 1480.767428 R M 648 662 PSM DGETFQLMGLYGR 1944 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3371.12 60.50715 2 1485.691647 1485.692214 K E 129 142 PSM MGALDVCPFIPVR 1945 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3198.11 55.62193 2 1489.745447 1489.742142 R G 85 98 PSM NLFFSTNIDDAIR 1946 sp|O70475|UGDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3340.4 59.63013 2 1524.760047 1524.757258 K E 68 81 PSM TIPIDGDFFSYTR 1947 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3329.14 59.32167 2 1530.738247 1530.735459 K H 162 175 PSM NSQSFFSGLFGGSSK 1948 sp|Q9DB05|SNAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3308.7 58.73307 2 1548.722247 1548.720872 K I 23 38 PSM EAINVEQAFQTIAR 1949 sp|P51150|RAB7A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3288.14 58.17432 2 1588.821047 1588.820920 K N 158 172 PSM VVLAYEPVWAIGTGK 1950 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3366.15 60.36625 2 1601.882647 1601.881730 K T 211 226 PSM LAGTQPLEVLEAVQR 1951 sp|Q02053|UBA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3246.16 56.98977 2 1622.900847 1622.899171 R S 679 694 PSM TGAIVDVPVGEELLGR 1952 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3299.14 58.48886 2 1623.883047 1623.883186 R V 134 150 PSM FGFTFLGNQNGYIR 1953 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3378.8 60.70783 2 1632.807647 1632.804876 R V 508 522 PSM SGEYSCIFLPEPVGR 1954 sp|P18572|BASI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4 ms_run[1]:scan=1.1.3182.11 55.17847 2 1709.809447 1709.808307 R S 198 213 PSM IIVIMDSYGSDLVER 1955 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3250.5 57.0956 2 1708.871847 1708.870573 K G 224 239 PSM ETECTYFSTPLLLGK 1956 sp|P08249|MDHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 4-UNIMOD:4 ms_run[1]:scan=1.1.3324.20 59.18228 2 1757.855847 1757.854589 K K 282 297 PSM LLVFSTDAGFHFAGDGK 1957 sp|P09055|ITB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3197.6 55.58923 3 1780.884971 1780.878435 R L 273 290 PSM VQAMYIWVDGTGEGLR 1958 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3311.12 58.81882 2 1793.884447 1793.877055 K C 26 42 PSM AGSNVMQTFTFYASEDK 1959 sp|O35490|BHMT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3201.21 55.71447 2 1894.839847 1894.840729 R L 66 83 PSM RTAVDSGIALLTNFQVTK 1960 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3286.6 58.11018 3 1933.070471 1933.063276 R L 1454 1472 PSM TQPTDEEMLFIYSHFK 1961 sp|P31786|ACBP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3320.9 59.05803 3 1984.929671 1984.924065 K Q 18 34 PSM NIVAVGAGFCDGLGFGDNTK 1962 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:4 ms_run[1]:scan=1.1.3287.21 58.15154 2 2010.949447 2010.946926 K A 205 225 PSM GHYTEGAELVDSVLDVVRK 1963 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3235.13 56.68225 3 2086.076171 2086.069484 K E 104 123 PSM IAVIGQSLFGQEVYCQLRK 1964 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 15-UNIMOD:4 ms_run[1]:scan=1.1.3220.13 56.25835 3 2208.178271 2208.172509 K E 3 22 PSM INPVCPADLVIDHSIQVDFNR 1965 sp|P28271|ACOC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:4 ms_run[1]:scan=1.1.3379.8 60.7348 3 2421.221471 2421.211080 K R 114 135 PSM GSVHDFPEFDANQDAEALYTAMK 1966 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3321.17 59.09328 3 2555.137871 2555.127469 R G 12 35 PSM AERPDGLILGMGGQTALNCGVELFK 1967 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 11-UNIMOD:35,19-UNIMOD:4 ms_run[1]:scan=1.1.3321.18 59.09412 3 2661.333071 2661.325458 K R 498 523 PSM DSTLIMQLLR 1968 sp|O70456|1433S_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3614.10 67.34026 2 1188.654047 1188.653644 K D 215 225 PSM FVSISDLFVPK 1969 sp|Q61598|GDIB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3521.6 64.67496 2 1250.691247 1250.691075 K D 380 391 PSM TGEAIVDAALSALR 1970 sp|Q922R8|PDIA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3553.13 65.61487 2 1385.753047 1385.751444 R Q 119 133 PSM SNLQLPLQFLSR 1971 sp|O35604|NPC1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3465.6 63.07625 2 1414.793847 1414.793249 K C 85 97 PSM DLGQDLAGVIAIQR 1972 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3508.5 64.30811 2 1467.809247 1467.804542 K K 974 988 PSM VVGVPVALDLITSGR 1973 sp|Q9DBM2|ECHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3514.14 64.4789 2 1494.873847 1494.876979 R H 140 155 PSM VTMWVFEEDIGGR 1974 sp|P13707|GPDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3412.15 61.6309 2 1537.726647 1537.723515 R K 36 49 PSM VSILIGASQDLIPQLK 1975 sp|O88587|COMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3554.15 65.64552 2 1694.000447 1693.997822 K K 155 171 PSM ATYQDADIYILDDPLSAVDTHVGK 1976 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3478.19 63.4674 3 2619.279971 2619.270428 R H 772 796 PSM DVLSGDGFDAVICLGNSFAHLPDCKGDQSEHR 1977 sp|Q9QXF8|GNMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4,24-UNIMOD:4 ms_run[1]:scan=1.1.3578.5 66.31667 4 3515.607694 3515.583417 K L 124 156 PSM LTIIPQDPILFSGNLR 1978 sp|Q8VI47|MRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3607.16 67.13955 2 1796.021847 1796.019620 R M 1375 1391 PSM QLSLTMMAQWSQFAR 1979 sp|Q63880|EST3A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3619.20 67.4956 2 1796.873847 1796.870196 K T 491 506 PSM AIFASGSPFDPVTLPDGR 1980 sp|P06801|MAOX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3417.20 61.77953 2 1845.924247 1845.926114 R T 428 446 PSM ILPNVPEVEDSTDFFK 1981 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3423.8 61.9457 2 1848.915847 1848.914546 R S 334 350 PSM YFDSFGDLSSASAIMGNAK 1982 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3466.21 63.11803 2 1979.899247 1979.893493 R V 42 61 PSM GIAVHPELFSIDNGLLTPTLK 1983 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3495.12 63.9621 3 2234.239571 2234.231070 K A 656 677 PSM LNPNFLVDFGKEPLGPALAHELR 1984 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3445.6 62.51513 4 2546.379294 2546.364544 K Y 438 461 PSM SGPFGQIFRPDNFVFGQSGAGNNWAK 1985 sp|P68372|TBB4B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3484.21 63.64493 3 2797.346471 2797.336097 R G 78 104 PSM VLLSICSLLCDPNPDDPLVPEIAR 1986 sp|P61079|UB2D3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3793.7 72.41497 3 2705.351471 2705.376825 K I 102 126 PSM LHPAPEATVAATCAFPSVQAAVDSTVQILQAAVPVAR 1987 sp|Q7TNG8|LDHD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.3819.7 73.12891 4 3755.9800941913204 3755.9668797566897 R I 239 276 PSM LGGSLIVAFEGSPV 1988 sp|Q9R0P5|DEST_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3724.9 70.46606 2 1344.729847 1344.728917 K - 152 166 PSM GEFQILLDALDK 1989 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3692.7 69.56741 2 1360.723647 1360.723832 K I 154 166 PSM DNLEFFLTNLGK 1990 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3702.4 69.83714 2 1409.718847 1409.719081 K V 791 803 PSM GMPFELCFLVQR 1991 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:4 ms_run[1]:scan=1.1.3649.6 68.3271 2 1495.735047 1495.731577 K S 95 107 PSM AILPFDLQIIDEK 1992 sp|Q91VA0|ACSM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3664.13 68.76263 2 1513.839847 1513.839196 K G 388 401 PSM VGFPEVMLGILPGAR 1993 sp|Q9DBM2|ECHP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3728.10 70.58477 2 1554.858447 1554.859220 R G 118 133 PSM ELFPQQLEQFFR 1994 sp|Q9WVT6|CAH14_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3718.12 70.29295 2 1580.798247 1580.798728 R Y 200 212 PSM VPTANLENVLPLAEDFTEILSR 1995 sp|P21614|VTDB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3864.11 74.3493 3 2440.301771 2440.284956 K C 243 265 PSM AAGVSVEPFWPGLFAK 1996 sp|P47955|RLA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3667.15 68.85172 2 1674.877647 1674.876979 K A 34 50 PSM VDFDTMSTTDLLTALK 1997 tr|Q8R084|Q8R084_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3692.15 69.57408 2 1769.879647 1769.875718 R T 416 432 PSM TTWIAPGTLNDLLELK 1998 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3723.14 70.44083 2 1783.974447 1783.972001 R M 241 257 PSM TLGGILAPVYYGALIDR 1999 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3683.17 69.3095 2 1791.002447 1790.993071 R T 577 594 PSM VAEQTPLTALYVANLIK 2000 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3648.10 68.31252 2 1843.047247 1843.045501 K E 212 229 PSM ATDLLLDDSLVSLFGNR 2001 sp|P99029|PRDX5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3780.19 72.04858 2 1847.962847 1847.962893 K R 156 173 PSM GQETSTNPIASIFAWSR 2002 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3664.20 68.76849 2 1863.912447 1863.911526 K G 322 339 PSM IGAFSYGSGLAASFFSFR 2003 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3749.17 71.17535 2 1883.922247 1883.920634 R V 407 425 PSM EPLFGISTGNIITGLAAGAK 2004 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3677.21 69.13865 2 1929.055447 1929.057128 K S 288 308 PSM LNAGEVVIGDGGFVFALEK 2005 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3673.21 69.02776 2 1934.017847 1934.014929 R R 17 36 PSM TLDGGLNVIQLETAVGAAIK 2006 sp|Q91ZJ5|UGPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3726.9 70.525 3 1982.109371 1982.104807 K S 358 378 PSM EAQELNLPVVGSQLVGLVPLK 2007 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3750.10 71.19791 3 2202.272471 2202.262370 R A 256 277 PSM DLGTQLAPIIQEFFHSEQYR 2008 sp|Q78JT3|3HAO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3818.5 73.09862 3 2391.195071 2391.185910 K T 136 156 PSM ETAIELGYLTAEQFDEWVKPK 2009 sp|P97807|FUMH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3729.16 70.61948 3 2466.245771 2466.231858 K D 481 502 PSM CCAEANPPACYGTVLAEFQPLVEEPK 2010 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3656.21 68.53571 3 2949.347171 2949.334702 K N 384 410 PSM NLSDLIDLVPSLCEDLLSSVDQPLK 2011 sp|P47757|CAPZB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:4 ms_run[1]:scan=1.1.3937.6 76.31125 3 2782.423571 2782.431028 K I 24 49 PSM TLEAVQDLLEQGR 2012 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3216.13 56.14127 2 1470.763447 1470.767822 R Q 430 443 PSM LNAGEVVIGDGGFVFALEK 2013 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3698.10 69.74387 2 1933.995647 1934.014929 R R 17 36 PSM QHGIPIPVTPK 2014 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.2666.12 40.5187 2 1168.6609 1168.6599 K S 166 177 PSM QHGIPIPVTPK 2015 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.2672.6 40.68803 2 1168.6609 1168.6599 K S 166 177 PSM CNEIISWLDK 2016 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3789.16 72.30637 2 1259.5847 1259.5851 K N 574 584 PSM RIQEITEQLDITTSEYEK 2017 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2842.15 45.50062 3 2196.091871 2195.095758 K E 370 388 PSM YYTSASGDEMVSLK 2018 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2583.6 38.1314 2 1550.709047 1549.697025 R D 466 480 PSM QALSPDMLATDLAYYLVR 2019 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:35 ms_run[1]:scan=1.1.3810.5 72.88139 3 2056.037171 2055.034678 K K 362 380 PSM CGVEIISLK 2020 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 1-UNIMOD:4 ms_run[1]:scan=1.1.2706.5 41.64317 2 1017.552247 1017.552868 K A 242 251 PSM MDQTQHPSK 2021 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1,1-UNIMOD:35 ms_run[1]:scan=1.1.1552.19 9.204967 2 1128.4851 1128.4864 - A 1 10 PSM SSITQIER 2022 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.1992.16 21.54897 2 932.492847 932.492710 K R 48 56 PSM QLGGYVATIGTK 2023 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.3175.4 54.98218 2 1189.6314 1189.6338 R F 65 77 PSM LGLDSLAPFDPK 2024 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3306.4 58.67503 2 1271.676647 1271.676154 R E 307 319 PSM QNGQWGPEER 2025 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:28 ms_run[1]:scan=1.1.2377.17 32.36203 2 1182.5041 1182.5049 K K 77 87 PSM VPYHLVDTIAVSGCLK 2026 sp|O08573|LEG9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 14-UNIMOD:4 ms_run[1]:scan=1.1.2894.10 47.0013 3 1770.935171 1770.933842 R L 125 141 PSM ILLDQGQTHSVETPYGSVTFTVYGTPKPK 2027 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3115.16 53.28372 4 3162.638094 3162.623731 R R 33 62 PSM LDNLVAIFDINR 2028 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3589.14 66.62268 2 1402.751847 1401.761615 K L 175 187 PSM SPAQILIR 2029 sp|Q9DCT1|AKCL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2455.4 34.52408 2 896.543247 896.544351 K F 229 237 PSM INGEWHTIILASDKR 2030 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2690.2 41.17938 4 1752.924494 1751.931868 K E 34 49 PSM LAQENMDLFK 2031 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2716.10 41.92633 2 1208.594647 1207.590709 K E 479 489 PSM ENGTITAANASTLNDGAAALVLMTAEAAQR 2032 sp|Q8QZT1|THIL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:27 ms_run[1]:scan=1.1.3863.8 74.32404 3 2927.4382 2926.4452 K L 271 301 PSM LGFAGVVQEISFGTTK 2033 sp|P80316|TCPE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.3474.17 63.34898 2 1652.878847 1652.877373 K D 353 369 PSM AGVDQHEGTIK 2034 tr|A0A087WP24|A0A087WP24_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.1971.21 20.95537 2 1195.5823 1195.5828 M V 2 13 PSM GFGHIGIAVPDVYSACK 2035 sp|Q9CPU0|LGUL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 16-UNIMOD:4 ms_run[1]:scan=1.1.2960.7 48.8571 3 1789.884071 1789.882141 R R 124 141 PSM NQVAVVTGGGTGIGK 2036 sp|Q99MZ7|PECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2253.19 28.90567 2 1356.736047 1356.736128 K A 18 33 PSM AVVQVFEGTSGIDAK 2037 sp|P62814|VATB2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2775.18 43.62691 2 1520.791447 1519.788223 K K 94 109 PSM ANVIAAGLAQIPQK 2038 tr|Q8K154|Q8K154_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2883.17 46.68663 2 1393.805247 1392.808899 R V 324 338 PSM SGSSSVAAMKK 2039 sp|Q80SZ7|GBG5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 21 1-UNIMOD:1 ms_run[1]:scan=1.1.1822.20 16.74782 2 1093.5461 1093.5432 M V 2 13 PSM DLTTAGAVTQCYR 2040 sp|P62717|RL18A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 11-UNIMOD:4 ms_run[1]:scan=1.1.2525.10 36.50918 2 1453.693447 1454.682378 R D 99 112 PSM SLGQWLQEEK 2041 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=1.1.2753.9 42.97968 2 1218.604647 1216.608802 K V 148 158 PSM SGVEAMNK 2042 sp|Q9CQ62|DECR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1674.13 12.59262 2 834.389847 834.390553 K S 215 223 PSM EVQAAQAR 2043 sp|P08226|APOE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1584.17 10.08958 2 871.447047 871.451179 K L 106 114 PSM KVSVEPQDSHQDAQPR 2044 sp|Q8BXB6|SO2B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1719.14 13.83782 4 1819.882494 1819.881289 R G 19 35 PSM VHLTDAEK 2045 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=1.1.1689.17 13.00258 2 911.4675 911.4707 M A 2 10 PSM SAEAAAEATK 2046 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1614.16 10.91325 2 947.454647 947.455990 K N 526 536 PSM FHVEEEGK 2047 sp|P09041|PGK2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1736.19 14.31628 2 973.449647 973.450511 R G 124 132 PSM AGVLAGHDNR 2048 sp|P62874|GBB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1650.19 11.9275 2 1008.507447 1008.510091 R V 305 315 PSM ACVVHGSDLK 2049 sp|Q6PIE5|AT1A2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.1730.18 14.14753 2 1084.529247 1084.533529 K D 659 669 PSM HPESNFCSR 2050 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.1662.21 12.26725 2 1132.471247 1132.471991 K S 106 115 PSM TSQGLQTEQR 2051 sp|P01027|CO3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1687.13 12.9519 2 1146.561447 1146.562915 K A 647 657 PSM ESECTDVCR 2052 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 4-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.1701.21 13.33857 2 1154.430847 1154.433223 K S 648 657 PSM GVSEIVHEGKK 2053 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1726.9 14.03105 3 1181.639171 1181.640437 K I 37 48 PSM SNVNDGVAQSTR 2054 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1735.20 14.28868 2 1246.587047 1246.590192 K I 245 257 PSM AAVPDAVGK 2055 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1888.16 18.61758 2 826.452647 826.454868 R C 587 596 PSM AGDEFVEK 2056 sp|Q61425|HCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1898.15 18.8983 2 893.412847 893.413063 K T 88 96 PSM VGEFSGANK 2057 sp|P10639|THIO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1781.16 15.58553 2 907.438847 907.439946 K E 86 95 PSM NTSDVISAAK 2058 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1929.15 19.77835 2 1004.513847 1004.513839 K K 738 748 PSM ELSEPSSTR 2059 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1761.17 15.01702 2 1004.475047 1004.477454 K I 842 851 PSM TNCDLYEK 2060 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.1846.14 17.42947 2 1041.442447 1041.443711 K L 414 422 PSM NVLADCNTR 2061 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.1879.17 18.36628 2 1061.491847 1061.492393 K C 434 443 PSM GVQHPLYGEK 2062 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1767.9 15.17922 3 1126.575971 1126.577108 K N 424 434 PSM ADGSTQVIDTK 2063 sp|O08749|DLDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1881.18 18.42345 2 1133.555247 1133.556432 K N 167 178 PSM MEEQTQQIR 2064 sp|P08226|APOE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1806.21 16.29267 2 1161.541647 1161.544822 K L 253 262 PSM HQGVMVGMGQK 2065 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1859.20 17.80397 2 1170.565447 1170.563783 R D 40 51 PSM SGSGEVYQGPAK 2066 sp|P51660|DHB4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1821.20 16.71917 2 1178.555447 1178.556767 K G 669 681 PSM YKPESDELTAEK 2067 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1928.12 19.74708 3 1408.675271 1408.672190 K I 329 341 PSM HHAAYVNNLNATEEK 2068 sp|P09671|SODM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1827.18 16.8896 3 1709.814371 1709.812147 K Y 54 69 PSM TPEELQHSLR 2069 sp|Q9QXE0|HACL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1979.10 21.17357 3 1208.616371 1208.614950 R Q 537 547 PSM ALVHERDEAAYGALR 2070 sp|P97372|PSME2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2107.6 24.76515 4 1669.860894 1669.853618 R A 189 204 PSM VSNLPTVK 2071 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2033.13 22.69897 2 856.500647 856.501818 R K 188 196 PSM ALEQALEK 2072 sp|P97449|AMPN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2035.14 22.756 2 900.490847 900.491647 R T 935 943 PSM IDGASPLDK 2073 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2018.11 22.27313 2 914.470047 914.470912 K V 161 170 PSM LGVTADDVK 2074 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2080.13 24.0172 2 916.484847 916.486562 K N 171 180 PSM VCNPIITK 2075 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.2089.9 24.27 2 943.515447 943.516088 K L 602 610 PSM FNENAVVR 2076 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2047.14 23.09228 2 947.483047 947.482479 R N 270 278 PSM TVAGIGVEGR 2077 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2120.13 25.14402 2 957.524647 957.524344 R F 949 959 PSM EVEMDAVGK 2078 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2044.13 23.00808 2 976.453647 976.453547 R E 1175 1184 PSM CIEEAIDK 2079 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.2032.16 22.67328 2 976.455647 976.453547 K L 269 277 PSM AAGAQVVAVSR 2080 sp|Q91X52|DCXR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1979.16 21.17857 2 1027.577447 1027.577443 K T 29 40 PSM SVGEVMAIGR 2081 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:35 ms_run[1]:scan=1.1.2105.17 24.71753 2 1033.523447 1033.522630 K T 794 804 PSM EAAMGQGFDR 2082 sp|P52825|CPT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2071.17 23.77163 2 1080.466447 1080.465843 K H 545 555 PSM AGEYEALPEK 2083 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2130.15 25.43303 2 1105.531447 1105.529155 R L 143 153 PSM RPQPEEGATYEGIQK 2084 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1997.19 21.69125 3 1701.835571 1701.832213 R K 191 206 PSM VEIIANDQGNR 2085 sp|P16627|HS71L_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2083.18 24.10568 2 1227.621647 1227.620764 K T 28 39 PSM SVTHANALTVMGK 2086 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2113.19 24.94792 2 1327.694447 1327.691820 R A 749 762 PSM KLEEEGEQFVK 2087 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2127.20 25.35077 2 1334.672447 1334.671797 K K 443 454 PSM VVATTQMQAADAR 2088 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2036.20 22.78907 2 1360.681047 1360.676899 K K 206 219 PSM INQTYQQQYGR 2089 sp|P97429|ANXA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.1980.21 21.21143 2 1397.667447 1397.668777 R S 124 135 PSM HGSWGSGLDMHTK 2090 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2024.17 22.44938 3 1411.634171 1411.630283 K P 328 341 PSM FNSANEDNVTQVR 2091 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2127.21 25.3516 2 1492.689447 1492.690634 R T 432 445 PSM YHSLAPMYYR 2092 sp|P35278|RAB5C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2319.11 30.73792 3 1299.609371 1299.607028 R G 83 93 PSM LFAEAVQK 2093 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2154.6 26.11627 2 904.502047 904.501818 K S 1472 1480 PSM HIEVLIDK 2094 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2162.12 26.33913 2 965.554447 965.554582 K Y 143 151 PSM HGSWGSGLDMHTKPWIR 2095 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 10-UNIMOD:35 ms_run[1]:scan=1.1.2331.3 31.06733 4 1979.953294 1979.942450 K A 328 345 PSM AYEQLGYR 2096 sp|Q9DCP2|S38A3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2152.16 26.06922 2 998.481847 998.482145 R A 127 135 PSM VLAACLTEK 2097 tr|G5E8H9|G5E8H9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:4 ms_run[1]:scan=1.1.2194.15 27.22612 2 1003.535447 1003.537217 R G 56 65 PSM SAGVKVETTEDLVAK 2098 sp|Q9DCW4|ETFB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2238.9 28.46957 3 1545.828371 1545.825003 R L 234 249 PSM SGEIEPVSVK 2099 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2136.16 25.60732 2 1043.550447 1043.549890 K V 57 67 PSM EVYTHFTCATDTK 2100 sp|Q9DC51|GNAI3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.2147.18 25.92747 3 1571.695271 1571.692609 K N 318 331 PSM EVNLAVENAK 2101 sp|Q9JLJ2|AL9A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2139.19 25.69658 2 1085.572047 1085.571688 K A 50 60 PSM CNILEGEPR 2102 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.2233.18 28.33522 2 1086.512847 1086.512794 K E 539 548 PSM LRVDPVNFK 2103 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2327.10 30.96242 2 1086.619647 1086.618579 K L 92 101 PSM VTVVDVNEAR 2104 sp|O70475|UGDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2211.17 27.70292 2 1100.581447 1100.582588 R I 32 42 PSM VMIGESIDEK 2105 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2326.17 30.9411 2 1119.548247 1119.548176 K R 1282 1292 PSM EITALAPSTMK 2106 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 10-UNIMOD:35 ms_run[1]:scan=1.1.2220.19 27.96322 2 1176.607047 1176.606025 K I 316 327 PSM EAAENSLVAYK 2107 sp|P62259|1433E_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2256.15 28.98685 2 1193.592047 1193.592818 K A 143 154 PSM RFQINTYVR 2108 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2304.9 30.32507 2 1195.646647 1195.646191 K K 382 391 PSM FAAATGATPIAGR 2109 sp|P14206|RSSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2266.14 29.27188 2 1202.640047 1202.640771 K F 90 103 PSM TPAQYDASELK 2110 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2157.17 26.20682 2 1221.589047 1221.587733 K A 105 116 PSM NAAGNFYINDK 2111 sp|Q8CHT0|AL4A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2296.16 30.10602 2 1225.573247 1225.572751 R S 498 509 PSM EQVANSAFVER 2112 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2196.17 27.28417 2 1248.607247 1248.609865 K V 492 503 PSM ASQRPDVLTTGGGNPIGDK 2113 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2282.17 29.72135 3 1881.958571 1881.954454 R L 20 39 PSM ALEESNYELEGK 2114 sp|P02535|K1C10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2299.21 30.19547 2 1380.638447 1380.640890 R I 164 176 PSM LADIGACAQIVHK 2115 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.2339.10 31.29448 3 1394.736971 1394.734020 K R 165 178 PSM ELPGHTGYLSCCR 2116 sp|P29387|GBB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2170.19 26.57008 2 1548.680847 1548.681333 R F 138 151 PSM AHADEFPLTTDSSEK 2117 sp|Q923B6|STEA4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2245.16 28.67422 3 1646.749571 1646.742395 K Q 4 19 PSM IRADIVENQVMDTR 2118 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:35 ms_run[1]:scan=1.1.2302.14 30.27043 3 1674.839171 1674.835919 R M 95 109 PSM HSYTASYNIYDVNKR 2119 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2216.19 27.84797 3 1829.875571 1829.869662 R Q 120 135 PSM EAAQMDMVNDGVEDLRGK 2120 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35,7-UNIMOD:35 ms_run[1]:scan=1.1.2218.18 27.90482 3 2008.887671 2008.883006 R Y 86 104 PSM KIYGVAVYTGMETK 2121 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2509.13 36.0742 2 1558.809047 1558.806516 K M 256 270 PSM IIAVDINK 2122 sp|P00329|ADH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2345.4 31.45655 2 884.532047 884.533118 R D 220 228 PSM AAVSGLWGK 2123 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2411.4 33.30242 2 887.488447 887.486502 K V 10 19 PSM VISLSGEHSIIGR 2124 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2502.4 35.86462 3 1366.762571 1366.756864 R T 104 117 PSM DGATLILSK 2125 sp|B2RXS4|PLXB2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2492.5 35.5803 2 916.520647 916.522947 R V 1556 1565 PSM GRVVYEAGVFNVTAGHGK 2126 sp|Q9EQF5|DPYS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2358.10 31.81718 4 1859.967294 1859.964231 R F 444 462 PSM GADSSIFPR 2127 sp|P98197|AT11A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2345.6 31.46072 2 948.465647 948.466495 K V 579 588 PSM HGSWGSGLDMHTKPWIR 2128 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2518.7 36.30803 4 1963.957294 1963.947535 K A 328 345 PSM HGSWGSGLDMHTKPWIR 2129 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2508.2 36.03462 4 1963.957294 1963.947535 K A 328 345 PSM SSVEWQIR 2130 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2434.8 33.93415 2 1003.510047 1003.508694 K Q 446 454 PSM FAIQYGTGR 2131 sp|O09043|NAPSA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2402.12 33.06128 2 1011.512647 1011.513780 K L 132 141 PSM SVGEVMAIGR 2132 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2440.9 34.10283 2 1017.527047 1017.527715 K T 794 804 PSM IGGIGTVPVGR 2133 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2453.12 34.47305 2 1024.603647 1024.602929 K V 256 267 PSM MFASFPTTK 2134 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:35 ms_run[1]:scan=1.1.2446.12 34.27593 2 1044.491247 1044.495018 R T 33 42 PSM YAAELHLVHWNPK 2135 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2512.5 36.14697 3 1576.820171 1576.815047 K Y 114 127 PSM LQAEIFQAR 2136 sp|P08226|APOE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2510.11 36.09453 2 1074.581247 1074.582194 R L 262 271 PSM ILNPEEIEK 2137 sp|Q9Z2U0|PSA7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2406.9 33.1695 2 1083.582047 1083.581191 K Y 219 228 PSM RVLVETEGPAGVAVMK 2138 sp|P42125|ECI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2499.12 35.78488 3 1654.912271 1654.907627 K L 33 49 PSM ALRETLPAEQDLTTK 2139 sp|Q9R1P4|PSA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2382.14 32.5019 3 1684.904771 1684.899565 R N 194 209 PSM VGVVDEVVPEDQVHSK 2140 sp|P42125|ECI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2447.15 34.30667 3 1734.886871 1734.878829 K A 207 223 PSM LPQEMSGFQK 2141 sp|Q64735|CR1L_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2365.13 32.01678 2 1163.562647 1163.564495 R G 344 354 PSM LGTAAIQGAIEK 2142 sp|Q8QZT1|THIL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2435.15 33.96763 2 1170.661647 1170.660838 K A 64 76 PSM LLEAAITPQTK 2143 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2439.17 34.08109 2 1183.684247 1183.681239 K L 141 152 PSM TNVSGGAIALGHPLGGSGSR 2144 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2379.15 32.41773 3 1806.942971 1806.933659 K I 341 361 PSM TNVSGGAIALGHPLGGSGSR 2145 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2384.14 32.55853 3 1806.942971 1806.933659 K I 341 361 PSM WDTGENPIYK 2146 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2521.7 36.3947 2 1221.566447 1221.566603 K S 775 785 PSM SNDEDSFAFAR 2147 sp|Q91WT9|CBS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2527.10 36.55387 2 1257.526647 1257.526195 K M 323 334 PSM GHSSVGAPETEAFLQPER 2148 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2502.16 35.87462 3 1910.920571 1910.912255 K S 274 292 PSM AELDQLPGAQEK 2149 sp|Q7TMS5|ABCG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2360.16 31.87867 2 1297.652447 1297.651395 K K 347 359 PSM PSWGNHTPIFR 2150 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2423.3 33.62873 3 1310.657471 1310.652004 K D 160 171 PSM CGGDIAFHLNPR 2151 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:4 ms_run[1]:scan=1.1.2425.6 33.6836 3 1355.640671 1355.640454 R F 258 270 PSM EGVVECSFVQSK 2152 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.2407.19 33.20515 2 1367.640647 1367.639116 K E 270 282 PSM EGVVECSFVQSK 2153 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.2401.18 33.03747 2 1367.640647 1367.639116 K E 270 282 PSM ADIVENQVMDTR 2154 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2455.18 34.53577 2 1389.657647 1389.655829 R M 97 109 PSM HGVPISVTGIAQVK 2155 sp|O08917|FLOT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2537.5 36.82762 3 1404.810971 1404.808899 R I 59 73 PSM MISQSCLSNIEK 2156 tr|Q8BGL3|Q8BGL3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.2461.19 34.70653 2 1408.663247 1408.669036 R H 227 239 PSM LQAFQGYQVTMK 2157 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:35 ms_run[1]:scan=1.1.2516.12 36.26362 2 1428.707647 1428.707137 R T 278 290 PSM HVFGESDELIGQK 2158 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2396.8 32.8884 3 1457.717471 1457.715058 R V 151 164 PSM RLTGFHETSNINDFSAGVANR 2159 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2501.21 35.85005 3 2305.128671 2305.119956 R G 299 320 PSM QEQDTYALSSYTR 2160 sp|Q8QZT1|THIL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2480.21 35.24807 2 1560.707847 1560.705616 R S 206 219 PSM YAAELHLVHWNPK 2161 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2519.6 36.33458 3 1576.820171 1576.815047 K Y 114 127 PSM ILVTHTLHVLPQADR 2162 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2424.6 33.65738 3 1711.975571 1711.973339 R I 806 821 PSM EGHEVVGVFTIPDKDGK 2163 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2537.15 36.83595 3 1825.930571 1825.921028 K A 22 39 PSM DEQGSAADSEDSPTIEAVR 2164 sp|P10518|HEM2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2451.21 34.42358 2 1975.865247 1975.860673 K L 88 107 PSM HAFSPVASVESASGETLHSPK 2165 sp|P29699|FETUA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2482.19 35.3038 3 2137.054571 2137.043997 R V 302 323 PSM DSSRLPSEGPQPAHVVVGDVR 2166 sp|Q923D2|BLVRB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2401.19 33.0383 3 2201.129471 2201.118893 R Q 36 57 PSM IASGRPYNPSMSRPDAWGVTK 2167 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=1.1.2410.15 33.28403 4 2289.1472 2289.1322 R G 357 378 PSM KTVVVNCNPETVSTDFDECDK 2168 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4,19-UNIMOD:4 ms_run[1]:scan=1.1.2537.20 36.84013 3 2456.087771 2456.083556 K L 1009 1030 PSM TPALIALR 2169 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2603.2 38.6861 2 853.537647 853.538538 R Y 251 259 PSM LYSEFLGK 2170 sp|O35660|GSTM6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2607.7 38.80653 2 955.502247 955.501484 K Q 137 145 PSM IGLFGGAGVGK 2171 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2688.8 41.1266 2 974.556247 974.554916 K T 202 213 PSM ALASLMTYK 2172 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2607.8 38.80737 2 996.531447 996.531404 K C 163 172 PSM DVNAAIATIK 2173 sp|P05213|TBA1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2554.4 37.31023 2 1014.569447 1014.570960 K T 327 337 PSM EGGLLTLAGAK 2174 sp|Q8BVI4|DHPR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2692.6 41.2401 2 1028.587447 1028.586610 K A 125 136 PSM YIATPIFSK 2175 sp|P10649|GSTM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2681.5 40.93027 2 1038.575847 1038.574983 R M 203 212 PSM SGQEDHYWLDVEK 2176 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2555.10 37.344 3 1604.718671 1604.710701 K N 593 606 PSM ILSQDDLLR 2177 tr|B2RT89|B2RT89_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2636.9 39.64742 2 1071.594047 1071.592424 R I 66 75 PSM HRPELPLAVQGVSLK 2178 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2599.12 38.57832 3 1642.952771 1642.951875 R I 1269 1284 PSM MGFEPLAYR 2179 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:35 ms_run[1]:scan=1.1.2628.9 39.41567 2 1098.518047 1098.516816 K G 40 49 PSM TVVTEAGNLLK 2180 sp|Q61207|SAP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2661.11 40.37288 2 1143.650847 1143.649939 K D 68 79 PSM AVAQALEVIPR 2181 sp|P80318|TCPG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2753.8 42.97885 2 1165.684047 1165.681908 R T 439 450 PSM IALTDNSLIAR 2182 sp|P14148|RL7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2749.9 42.86413 2 1185.672047 1185.671737 R S 189 200 PSM HLEINPDHPIVETLR 2183 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2563.13 37.57563 3 1781.946971 1781.942433 K Q 625 640 PSM LSILYPATTGR 2184 sp|O08709|PRDX6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2748.11 42.83681 2 1190.666447 1190.665923 K N 145 156 PSM ALADPTVALPAR 2185 sp|Q9JIM1|S29A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2653.13 40.14183 2 1193.669447 1193.676822 K S 62 74 PSM HLGLPVFNTVK 2186 sp|Q9WUM5|SUCA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2707.8 41.67397 2 1223.702447 1223.702643 K E 95 106 PSM IYVVDVGSEPR 2187 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2586.11 38.20777 2 1232.640447 1232.640102 R A 104 115 PSM VFVTGPLPAEGR 2188 sp|Q91Z53|GRHPR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2663.11 40.4311 2 1241.674647 1241.676822 K A 9 21 PSM TIAMDGTEGLVR 2189 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2601.18 38.64145 2 1261.633847 1261.633637 R G 110 122 PSM TIAMDGTEGLVR 2190 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2607.15 38.81322 2 1261.633847 1261.633637 R G 110 122 PSM VLSSMTDAVLAR 2191 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2741.10 42.63338 2 1261.670647 1261.670022 R V 130 142 PSM HALIIYDDLSK 2192 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2595.15 38.46498 2 1286.688647 1286.687053 K Q 306 317 PSM NVFTSAEELER 2193 sp|Q91WM6|EVA1A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2723.15 42.12852 2 1293.619847 1293.620095 K A 114 125 PSM DITTSVLTVNNK 2194 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2728.17 42.26963 2 1303.699847 1303.698346 K A 202 214 PSM EVVLEEGTTAFK 2195 sp|Q08857|CD36_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2653.18 40.146 2 1321.676847 1321.676548 R N 41 53 PSM AEAERDVLFPGYTHLQR 2196 sp|Q91YI0|ARLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2569.19 37.74473 3 2001.015971 2001.006824 R A 147 164 PSM TDTDAELDLVSR 2197 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2658.15 40.28883 2 1333.635447 1333.636139 K L 761 773 PSM VVDLMAYMASKE 2198 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:35 ms_run[1]:scan=1.1.2697.17 41.39305 2 1371.646247 1371.641425 R - 322 334 PSM ASIYQSVVINTSK 2199 sp|P97872|FMO5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2645.19 39.91645 2 1408.756647 1408.756195 R E 53 66 PSM ETTIQGLDGLSER 2200 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2712.18 41.82238 2 1417.706447 1417.704888 K C 122 135 PSM LTGFHETSNINDFSAGVANR 2201 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2681.12 40.93612 3 2149.028171 2149.018845 R G 300 320 PSM TTPSVVAFTADGER 2202 sp|P38647|GRP75_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2638.18 39.71307 2 1449.711247 1449.709973 R L 86 100 PSM YHTSQSGDEMTSLSEYVSR 2203 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2670.19 40.641 3 2175.944471 2175.937877 R M 457 476 PSM THLPGFVEQAGALK 2204 sp|P99029|PRDX5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2617.4 39.09208 3 1466.790671 1466.788164 K A 99 113 PSM SGFTTANQVLGVSSK 2205 sp|O08601|MTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2642.18 39.82888 2 1494.768047 1494.767822 R A 199 214 PSM GENLSLVVHGPGDIR 2206 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2632.9 39.5315 3 1561.825871 1561.821255 K L 7 22 PSM ELEEQLGPVAEETR 2207 sp|P08226|APOE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2622.18 39.24895 2 1598.781247 1598.778781 K A 87 101 PSM MQQVEASLQPETLR 2208 sp|P07759|SPA3K_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2622.19 39.24978 2 1628.818647 1628.819206 R K 283 297 PSM CIEVCCGSVMEMR 2209 sp|Q8VDN2|AT1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2715.20 41.90702 2 1629.642847 1629.644161 K E 459 472 PSM TQLREPVLNDELPGR 2210 sp|P50285|FMO1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2554.10 37.31525 3 1735.925171 1735.921697 R I 277 292 PSM ADNFEYSDPVDGSISK 2211 sp|Q9D0F9|PGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2716.20 41.93467 2 1742.764647 1742.763525 K N 471 487 PSM HNHQGFGAGNFNSLFK 2212 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2578.7 37.99163 3 1773.838571 1773.833551 R A 354 370 PSM GEVITTYCPANNEPIAR 2213 sp|Q9DBF1|AL7A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.2617.21 39.10629 2 1903.911647 1903.909812 R V 63 80 PSM VNNSSLIGVGYTQTLRPGVK 2214 sp|Q60930|VDAC2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2701.14 41.50632 3 2102.157371 2102.148403 K L 249 269 PSM YISGFGNECASEDPRCPGSLPK 2215 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 9-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2580.9 38.05392 3 2440.084271 2440.078745 K G 6 28 PSM IGFGSFVEK 2216 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2770.4 43.47018 2 982.512447 982.512383 R T 182 191 PSM ISIPLDSNLRLDK 2217 tr|B2RT89|B2RT89_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2880.4 46.58892 3 1482.844271 1482.840593 R C 75 88 PSM APMFSWPR 2218 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2916.4 47.62727 2 990.473447 990.474557 K L 1310 1318 PSM LLCGLLSDR 2219 sp|P34884|MIF_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.2836.9 45.32287 2 1045.558247 1045.559016 K L 79 88 PSM THILLFLPK 2220 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2832.6 45.20495 2 1080.669447 1080.669552 K S 257 266 PSM EGNSFGFSLK 2221 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2761.7 43.21037 2 1084.519447 1084.518925 K T 141 151 PSM TDSVVWLGDLQTHR 2222 sp|P11609|CD1D1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2901.9 47.20238 3 1625.820071 1625.816169 R W 44 58 PSM FDAGELITQR 2223 sp|P67778|PHB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2775.5 43.61607 2 1148.583447 1148.582588 R E 134 144 PSM VTLPAGPDILR 2224 sp|Q8BI08|MAL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2940.6 48.3073 2 1150.668247 1150.671009 R T 22 33 PSM EKVDLLFLGK 2225 sp|Q9DCW4|ETFB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2870.8 46.30547 2 1160.681047 1160.680511 K Q 115 125 PSM AITGIQAFTVGK 2226 sp|Q60759|GCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2828.13 45.0956 2 1204.682247 1204.681573 R - 427 439 PSM AITAATLQFAEGK 2227 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2765.15 43.3333 2 1319.710247 1319.708516 K G 578 591 PSM TQAALVLGSLEAR 2228 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2910.13 47.46163 2 1327.744847 1327.745965 K K 527 540 PSM AANEAGYFNEEMAPIEVK 2229 sp|Q8BWT1|THIM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 12-UNIMOD:35 ms_run[1]:scan=1.1.2802.14 44.3784 3 1997.909771 1997.904058 K T 192 210 PSM TLTIVDTGIGMTK 2230 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2958.14 48.80648 2 1348.725847 1348.727203 R A 88 101 PSM SAIVHLINYQDDAELATR 2231 sp|Q02257|PLAK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2872.15 46.368 3 2028.031871 2028.027619 K A 125 143 PSM SGVLPWLRPDSK 2232 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2762.3 43.23617 3 1353.744671 1353.740485 R T 171 183 PSM QEGQNYGFFLR 2233 sp|Q9JIL4|NHRF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2917.13 47.66302 2 1357.640847 1357.641499 K I 15 26 PSM IAEEFEVELER 2234 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2899.12 47.14813 2 1362.665847 1362.666711 K G 1044 1055 PSM DFTPVCTTELGR 2235 sp|O08709|PRDX6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.2778.16 43.71107 2 1394.652447 1394.650015 R A 42 54 PSM DVVELTDDTFDK 2236 sp|Q922R8|PDIA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2947.8 48.50043 2 1395.643447 1395.640556 K N 161 173 PSM WAEVVLSDPEAAK 2237 sp|P17439|GLCM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2825.14 45.01254 2 1413.711447 1413.713996 R Y 309 322 PSM LLLGPCTPVQYR 2238 sp|P97872|FMO5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.2858.15 45.96405 2 1415.758247 1415.759506 R L 463 475 PSM VLTLDTMNPCVR 2239 sp|Q8QZR5|ALAT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 10-UNIMOD:4 ms_run[1]:scan=1.1.2820.9 44.87738 2 1417.708447 1417.705756 K R 20 32 PSM ISIYSNSIEAVAR 2240 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2805.16 44.46385 2 1421.749047 1421.751444 R S 225 238 PSM APMSFFDTTPTGR 2241 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2926.15 47.92262 2 1426.652047 1426.655101 R I 1065 1078 PSM KLNCQVIGASVDSHFCHLAWINTPK 2242 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2904.18 47.29388 4 2894.444494 2894.431989 K K 68 93 PSM EQFLDGDAWTNR 2243 sp|P14211|CALR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2862.15 46.0793 2 1450.647247 1450.647707 K W 25 37 PSM RIQEITEQLDITTSEYEK 2244 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2843.17 45.53133 3 2195.103071 2195.095758 K E 370 388 PSM SIMISGNVLPDATR 2245 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2918.19 47.69628 2 1472.766447 1472.765714 K F 238 252 PSM VCIVGSGNWGSAIAK 2246 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.2849.19 45.70848 2 1517.765047 1517.766048 K I 6 21 PSM LLIHQSLAGGIIGVK 2247 sp|P61979|HNRPK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2830.5 45.14625 3 1517.935271 1517.929349 R G 149 164 PSM VTWDSTFCAVNPK 2248 sp|Q9WUM3|COR1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:4 ms_run[1]:scan=1.1.2881.16 46.62795 2 1523.712447 1523.707865 R F 34 47 PSM ALDIAENEMPGLMR 2249 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 9-UNIMOD:35 ms_run[1]:scan=1.1.2780.21 43.77333 2 1574.748047 1574.743264 K M 21 35 PSM AGSNVMQTFTFYASEDKLENR 2250 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:35 ms_run[1]:scan=1.1.2846.21 45.62232 3 2423.112071 2423.106340 R G 66 87 PSM GTTITSVLPKPALVASR 2251 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2803.9 44.40199 3 1710.007571 1710.003970 K V 403 420 PSM SKDIVLVAYSALGSHR 2252 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2772.2 43.5269 4 1714.946894 1714.936619 R E 208 224 PSM AFTTWTANAGIEECR 2253 sp|Q9R0H0|ACOX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.2828.19 45.1006 2 1725.782047 1725.778070 K M 379 394 PSM GAGAFGYFEVTHDITR 2254 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2948.4 48.52167 3 1739.829971 1739.826734 K Y 78 94 PSM TFVVQGFGNVGLHSMR 2255 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2934.6 48.14533 3 1747.886471 1747.882809 K Y 303 319 PSM GPREEIVYLPCIYR 2256 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.2962.4 48.91057 3 1763.908571 1763.902876 K N 21 35 PSM VCLIGCGFSTGYGSAVK 2257 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2960.21 48.86878 2 1774.841047 1774.838227 K V 170 187 PSM YADLTEDQLPSCESLK 2258 sp|Q9DBJ1|PGAM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 12-UNIMOD:4 ms_run[1]:scan=1.1.2818.12 44.82667 2 1867.849047 1867.850960 R D 142 158 PSM NLEAVETLGSTSTICSDK 2259 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.2824.21 44.99058 2 1923.912847 1923.909537 K T 350 368 PSM AIAEELAPERGFLPPASEK 2260 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2834.15 45.27025 3 2024.061671 2024.057856 R H 309 328 PSM TVLMNPNIASVQTNEVGLK 2261 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 4-UNIMOD:35 ms_run[1]:scan=1.1.2871.13 46.33805 3 2043.071771 2043.067041 K Q 459 478 PSM KACGDSTLTQITAGLDPVGR 2262 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4 ms_run[1]:scan=1.1.2946.6 48.46928 3 2059.039871 2059.036804 R I 23 43 PSM FLHDPSATQGFVGCALSSNIQR 2263 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.2949.11 48.55783 3 2404.164671 2404.159378 R F 255 277 PSM YLTVAAVFR 2264 sp|P68372|TBB4B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2985.6 49.55973 2 1038.584847 1038.586216 R G 310 319 PSM TCLLIVFSK 2265 sp|P62746|RHOB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.3126.4 53.59127 2 1079.603047 1079.604903 K D 19 28 PSM INEAFDLLR 2266 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3000.5 49.98277 2 1089.581447 1089.581859 K S 356 365 PSM LHFFMPGFAPLTSR 2267 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35 ms_run[1]:scan=1.1.3076.6 52.14115 3 1635.825371 1635.823169 R G 263 277 PSM ALSAIAELLTSEHER 2268 sp|P30999|CTND1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3080.3 52.25348 3 1638.857771 1638.857700 K V 711 726 PSM MLVVLLQGTR 2269 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2990.6 49.70412 2 1128.666847 1128.668900 K E 157 167 PSM LAVNMVPFPR 2270 sp|A2AQ07|TBB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3024.3 50.67904 2 1142.626647 1142.627035 K L 253 263 PSM SFEEIAAEFR 2271 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3099.8 52.81073 2 1197.565247 1197.566603 K K 490 500 PSM FATEAAITILR 2272 sp|P11983|TCPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2980.12 49.42292 2 1204.683247 1204.681573 K I 516 527 PSM IPLENLQIIR 2273 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3056.3 51.57645 2 1207.727647 1207.728858 R G 99 109 PSM ATGYPLAFIAAK 2274 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3056.4 51.57812 2 1221.676047 1221.675760 K I 729 741 PSM FEELNADLFR 2275 sp|P17156|HSP72_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3089.7 52.51803 2 1252.607647 1252.608802 R G 305 315 PSM VHLVGIDIFTGK 2276 sp|P63242|IF5A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3047.2 51.33121 3 1297.739771 1297.739423 K K 56 68 PSM LYVDVGYVDLR 2277 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3170.9 54.84577 2 1310.687847 1310.687053 K S 228 239 PSM IEWLESHQDADIEDFK 2278 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2985.11 49.5639 3 1973.906471 1973.900687 K A 603 619 PSM LFVTNDAATILR 2279 sp|P42932|TCPQ_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3024.10 50.68488 2 1332.740247 1332.740151 K E 63 75 PSM VLAPQISFGLDVSSEEERK 2280 sp|Q9JI75|NQO2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3046.13 51.31127 3 2103.082871 2103.084799 K V 184 203 PSM FTQAGSEVSALLGR 2281 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2968.14 49.0846 2 1434.744447 1434.746693 R I 311 325 PSM VNLLSFTGSTQVGK 2282 sp|Q9DBF1|AL7A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3021.16 50.60472 2 1449.781047 1449.782744 R E 267 281 PSM HMGPLNTWIGLTDQNGPWK 2283 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:35 ms_run[1]:scan=1.1.3169.11 54.8189 3 2180.052971 2180.047309 R W 203 222 PSM DIVYIGLRDVDPGEHYIIK 2284 sp|Q61176|ARGI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3158.5 54.51242 3 2214.173471 2214.168469 K T 173 192 PSM AAPLSRDPTEVTAIGAVEASFK 2285 sp|P53657|KPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3123.13 53.51132 3 2229.171671 2229.164112 R C 444 466 PSM GVVDSEDIPLNLSR 2286 sp|Q9CQN1|TRAP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2982.16 49.48255 2 1512.777647 1512.778387 R E 391 405 PSM ITDVIIGFQACCR 2287 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.3000.19 49.99445 2 1551.750247 1551.753769 K G 779 792 PSM VDFPQDQLATLTGR 2288 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3167.12 54.76237 2 1559.791047 1559.794371 K I 216 230 PSM VDFPQDQLATLTGR 2289 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3154.9 54.40193 2 1559.791047 1559.794371 K I 216 230 PSM TFLLDGDEVIITGHCQGDGYR 2290 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.3123.16 53.51382 3 2365.105571 2365.100860 R V 382 403 PSM FSAPLPPQPWEGVR 2291 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3132.18 53.77794 2 1579.813047 1579.814713 R D 78 92 PSM AVLVDLEPGTMDSVR 2292 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3059.19 51.66938 2 1600.812247 1600.813058 R S 63 78 PSM VIPATDLSEQISTAGTEASGTGNMK 2293 sp|Q9ET01|PYGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2970.18 49.14375 3 2477.202071 2477.195549 K F 657 682 PSM TQEFILNSPTVTSIK 2294 sp|Q9R0H0|ACOX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2985.20 49.5714 2 1676.898847 1676.898502 K W 160 175 PSM AIVAIENPADVSVISSR 2295 sp|P14206|RSSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3082.19 52.3243 2 1739.941047 1739.941764 R N 64 81 PSM IHFPLATYAPVISAEK 2296 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3096.8 52.72333 3 1755.957371 1755.955957 R A 265 281 PSM RFGFTFLGNQNGYIR 2297 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3039.9 51.10427 3 1788.905171 1788.905987 K V 507 522 PSM VAGNIPTGFVAPQVPDPK 2298 sp|P58735|S26A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3007.21 50.19925 2 1805.966847 1805.967585 R I 324 342 PSM DGPNALTPPPTTPEWVK 2299 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3063.20 51.78093 2 1818.917047 1818.915215 R F 65 82 PSM HSMNPFCEIAVEEAVR 2300 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.2983.9 49.50497 3 1887.865571 1887.860753 K L 36 52 PSM ISSVQSIVPALEIANAHR 2301 sp|P63038|CH60_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3066.8 51.85573 3 1904.052071 1904.047960 K K 251 269 PSM SPIYSHFSETVSGLPVIR 2302 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3077.9 52.17238 3 1988.037971 1988.036727 K A 1155 1173 PSM LIRDGSIDLVINLPNNNTK 2303 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3055.5 51.55117 3 2108.165171 2108.158967 K F 1426 1445 PSM AAVAWEAGKPLSIEEIEVAPPK 2304 sp|P28474|ADHX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3154.8 54.4011 3 2304.244571 2304.236549 K A 10 32 PSM TFLLDGDEVIITGHCQGDGYR 2305 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.3117.15 53.34005 3 2365.105571 2365.100860 R V 382 403 PSM YKGTTQEVDGLSQTDGPLAYFDK 2306 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3083.20 52.35398 3 2532.207671 2532.202014 K A 431 454 PSM LNCQVIGASVDSHFCHLAWINTPK 2307 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.3075.12 52.11762 4 2766.351694 2766.337026 K K 69 93 PSM TFPTVNPSTGEVICQVAEGNKEDVDK 2308 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.2984.21 49.54338 3 2833.349171 2833.344004 K A 55 81 PSM VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR 2309 sp|P34914|HYES_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.3035.21 50.99828 4 3445.761694 3445.745260 K L 216 248 PSM ASDFLLLLNK 2310 sp|Q9EPK2|XRP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3304.2 58.6179 2 1132.652247 1132.649211 K G 282 292 PSM LIDDMVAQVLK 2311 sp|P54071|IDHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3306.3 58.67253 2 1243.682047 1243.684610 R S 289 300 PSM SWTDLENSMVAVER 2312 sp|Q9R1S7|MRP6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3255.11 57.23068 2 1635.770447 1635.756271 R V 1217 1231 PSM VGVIDLSPFGK 2313 sp|Q9DBT9|M2GD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3203.5 55.75732 2 1130.631847 1130.633560 R F 522 533 PSM DLTSVLILQR 2314 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3337.2 59.53968 2 1156.678847 1156.681573 K K 660 670 PSM KFDEILEVSDGIMVAR 2315 tr|E9Q509|E9Q509_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3210.6 55.95935 3 1820.937071 1820.934236 K G 291 307 PSM FSMVQVWPVR 2316 sp|P50516|VATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3256.4 57.25247 2 1247.650047 1247.648499 K Q 203 213 PSM LLVVYPWTQR 2317 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3194.8 55.50397 2 1273.719247 1273.718293 R Y 32 42 PSM LLALEFAQELR 2318 sp|Q8VC12|HUTU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3402.9 61.3356 2 1301.736247 1301.734337 K Q 59 70 PSM VLQPTIFPVVPR 2319 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3208.8 55.90278 2 1364.819047 1364.818007 K L 358 370 PSM GKFPDVPGFSWVTPCISAK 2320 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 15-UNIMOD:4 ms_run[1]:scan=1.1.3368.13 60.42202 3 2092.052171 2092.045183 K D 154 173 PSM LFQVEYAIEAIK 2321 sp|Q9Z2U1|PSA5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3369.11 60.44918 2 1422.777047 1422.775868 R L 21 33 PSM DMTSEELDDILR 2322 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3358.11 60.13163 2 1435.651447 1435.650075 K Y 672 684 PSM LDIDPETITWQR 2323 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3176.5 55.01482 2 1485.748047 1485.746358 R V 521 533 PSM TLQTLEIDLDSMK 2324 sp|P05784|K1C18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3256.6 57.25582 2 1505.764847 1505.764711 R N 295 308 PSM LFIYNPSSGEFLGR 2325 sp|P97370|AT1B3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3282.15 58.00012 2 1598.811647 1598.809293 K T 18 32 PSM ADVSQELEEALAESR 2326 sp|Q3T9X0|GTR9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3344.13 59.74148 2 1645.785447 1645.779509 K V 261 276 PSM AISESGVAFIPGMFTK 2327 sp|Q91WU0|CES1F_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3386.10 60.92437 2 1653.838647 1653.843630 R D 243 259 PSM GVLLGIDDLQTNQFK 2328 sp|Q3UQ44|IQGA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3282.16 58.00097 2 1659.883247 1659.883186 K N 1490 1505 PSM ALTVPELTQQMFDAK 2329 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3380.7 60.76668 2 1690.859447 1690.860008 R N 283 298 PSM FTSSFQGIVDAYGVGR 2330 tr|Q9JHF5|Q9JHF5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3274.20 57.76927 2 1702.826447 1702.831485 R Y 368 384 PSM FSSEFELQQLEQFK 2331 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3357.19 60.10921 2 1758.846847 1758.846467 R A 908 922 PSM GVNAIVYMIDAADREK 2332 sp|Q9CQW2|ARL8B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3231.2 56.5639 3 1763.893571 1763.887620 R I 88 104 PSM FEDGDLTLYQSNAILR 2333 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3230.18 56.55 2 1853.920847 1853.915943 K H 56 72 PSM ACGDSTLTQITAGLDPVGR 2334 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 2-UNIMOD:4 ms_run[1]:scan=1.1.3259.20 57.34473 2 1930.942447 1930.941841 K I 24 43 PSM AQFGQPEILLGTIPGAGGTQR 2335 sp|Q8BH95|ECHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3344.5 59.73148 3 2110.125371 2110.117103 K L 158 179 PSM FNIWGGSLSLGHPFGATGCR 2336 sp|Q99JY0|ECHB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 19-UNIMOD:4 ms_run[1]:scan=1.1.3311.5 58.80713 3 2133.023471 2133.021428 K L 418 438 PSM TTVLLADMNDFGTVNEIYK 2337 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:35 ms_run[1]:scan=1.1.3252.4 57.14515 3 2159.050871 2159.045637 K T 79 98 PSM LIPPFHAASAQLTSLVDADAR 2338 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3269.14 57.61883 3 2192.165771 2192.158967 R A 394 415 PSM LAEELNVPVYLYGEAAQTPSR 2339 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3395.14 61.14253 3 2319.185171 2319.174677 R Q 115 136 PSM TGTLTENSMEFIECCIDGHK 2340 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.3262.13 57.42118 3 2341.005671 2341.002469 K Y 411 431 PSM TGTLTENSMEFIECCIDGHK 2341 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.3268.16 57.59167 3 2341.005671 2341.002469 K Y 411 431 PSM YIVDADDRSGEYSCIFLPEPVGR 2342 sp|P18572|BASI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.3272.16 57.70761 3 2657.251271 2657.243168 K S 190 213 PSM SPWSMDENLMHISYEAGILENPK 2343 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 10-UNIMOD:35 ms_run[1]:scan=1.1.3371.19 60.51299 3 2676.225971 2676.219990 K N 177 200 PSM NHEEEVQGLEAQIASSGLTVEVDAPK 2344 sp|P05784|K1C18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3242.20 56.87963 3 2749.350071 2749.340633 K S 209 235 PSM KVADALANAAGHLDDLPGALSALSDLHAHK 2345 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3300.2 58.50633 6 2990.580741 2990.557383 K L 62 92 PSM KAHCLSEVEHDTMPADLPAIAADFVEDQEVCK 2346 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 4-UNIMOD:4,31-UNIMOD:4 ms_run[1]:scan=1.1.3357.9 60.10088 5 3624.676118 3624.653470 K N 310 342 PSM GLGTDEDSLIEIICSR 2347 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:4 ms_run[1]:scan=1.1.3576.5 66.25978 3 1776.869171 1776.856380 K T 120 136 PSM YLDFIFAVK 2348 sp|P17047|LAMP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3502.3 64.14874 2 1114.605447 1114.606283 K N 286 295 PSM LGIFGFLSTGDK 2349 sp|Q63880|EST3A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3538.5 65.1698 2 1253.667047 1253.665589 R H 183 195 PSM MFVLDEADEMLSR 2350 sp|P10630|IF4A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3482.14 63.58013 2 1554.704447 1554.705816 K G 179 192 PSM ANINVENAFFTLAR 2351 sp|P55258|RAB8A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3431.6 62.13238 2 1578.817647 1578.815441 K D 154 168 PSM TFVSITPAEVGVLVGK 2352 sp|P62962|PROF1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3465.12 63.08125 2 1615.919847 1615.918509 K D 39 55 PSM DLADELALVDVMEDK 2353 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 12-UNIMOD:35 ms_run[1]:scan=1.1.3546.16 65.4123 2 1690.799847 1690.797133 K L 43 58 PSM AVFVDLEPTVIDEVR 2354 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3429.9 62.08253 2 1700.898047 1700.898502 R T 65 80 PSM DAFQNAYLELGGLGER 2355 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3525.17 64.80167 2 1751.851447 1751.847863 K V 536 552 PSM ALDITLLLACCSPSVR 2356 sp|P58735|S26A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 10-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.3605.16 67.08065 2 1787.929247 1787.927377 R D 644 660 PSM MQLIMLCYNPDFEK 2357 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.3451.19 62.69968 2 1800.823247 1800.824885 R Q 109 123 PSM YVFITGCDSGFGNLLAR 2358 tr|G5E8H9|G5E8H9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:4 ms_run[1]:scan=1.1.3515.19 64.5114 2 1888.917647 1888.914169 K Q 31 48 PSM TSDFWDSLQEASNLPVK 2359 sp|P16406|AMPE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3557.21 65.73714 2 1935.924647 1935.921422 K E 508 525 PSM HSLAFASGLAATITITHLLK 2360 sp|Q8VCN5|CGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3435.11 62.24082 3 2064.177371 2064.173161 K A 82 102 PSM DLYANTVLSGGTTMYPGIADR 2361 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3425.5 61.96812 3 2214.068171 2214.062684 K M 292 313 PSM VYEGSILEADCDILIPAASEK 2362 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.3429.5 62.07585 3 2292.129671 2292.119530 K Q 366 387 PSM VLILGSGGLSIGQAGEFDYSGSQAVK 2363 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3489.16 63.78768 3 2552.319971 2552.312233 K A 425 451 PSM EGNIFVTTTGCVDIILGR 2364 sp|P50247|SAHH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 11-UNIMOD:4 ms_run[1]:scan=1.1.3641.6 68.1214 2 1964.006847 1964.003713 K H 268 286 PSM INVNEIFYDLVR 2365 sp|P62835|RAP1A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3745.10 71.06002 2 1493.794047 1493.787829 K Q 152 164 PSM EAETFPFNPFDLTK 2366 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3694.13 69.6296 2 1654.789447 1654.787889 K V 288 302 PSM EVVDSYLPVILDMIK 2367 sp|Q61207|SAP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3829.4 73.40195 2 1732.934247 1732.932110 K G 108 123 PSM GLGTDEDTLIEILTTR 2368 sp|P10107|ANXA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3746.13 71.08884 2 1745.912047 1745.904710 K S 129 145 PSM TTSLELFMYLNEVAGK 2369 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3744.12 71.03957 2 1814.917847 1814.912438 R H 245 261 PSM CCAEANPPACYGTVLAEFQPLVEEPK 2370 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.3660.21 68.65238 3 2949.347171 2949.334702 K N 384 410 PSM SGELAVQALDQFATVVEAK 2371 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3730.8 70.64249 3 1975.032371 1975.026222 R L 533 552 PSM AVIGDHGDEIFSVFGSPFLK 2372 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3657.6 68.55228 3 2134.080971 2134.073506 K D 461 481 PSM VAAFDLDGVLALPSIAGAFRR 2373 sp|P34914|HYES_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3738.7 70.87158 3 2158.194971 2158.189874 R S 5 26 PSM VNFSPPGDTSNLFPGTWYLER 2374 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3690.11 69.51208 3 2396.152571 2396.143711 K V 474 495 PSM EQGYDVIAYLANIGQKEDFEEAR 2375 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3638.5 68.04456 3 2657.268671 2657.260926 K K 26 49 PSM LTTPTYGDLNHLVSATMSGVTTCLR 2376 sp|P68372|TBB4B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 23-UNIMOD:4 ms_run[1]:scan=1.1.3650.16 68.3627 3 2707.338671 2707.330937 K F 217 242 PSM AQDTAELFFEDVRLPANALLGEENK 2377 sp|P51174|ACADL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3694.18 69.63377 3 2789.409071 2789.387189 K G 255 280 PSM ENDDVVSEDLVQQDVQDLYEAGELK 2378 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3722.17 70.41405 3 2849.321771 2849.309058 R W 167 192 PSM HVNVEGFSQPVAVFLGIPFAKPPLGSLR 2379 sp|Q91WU0|CES1F_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3690.20 69.5196 3 2975.650571 2975.638534 K F 37 65 PSM TGPAATTLSDTAAAESLVDSSEVTVIGFFK 2380 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3804.21 72.71665 3 2984.500571 2984.486629 R D 135 165 PSM SPDFTNENPLETR 2381 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2679.10 40.88793 2 1518.700247 1518.695051 R N 228 241 PSM CSSILLHGK 2382 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2559.5 37.45512 2 996.5045 996.5057 R E 518 527 PSM EPLGPALAHELR 2383 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2520.4 36.3601 3 1301.713271 1301.709185 K Y 449 461 PSM VFDYSEYWEGAR 2384 sp|Q05920|PYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3114.12 53.25198 2 1520.658247 1520.657209 R G 831 843 PSM RYTMGDAPDFDR 2385 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 4-UNIMOD:35 ms_run[1]:scan=1.1.2062.9 23.51492 3 1458.624071 1458.619778 K S 32 44 PSM HGGTIPVVPTAEFQDR 2386 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2637.14 39.68055 3 1722.876071 1722.868933 K I 481 497 PSM QIHNFISTSTFSQYTVVDDIAVAK 2387 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.3680.18 69.22193 3 2666.3342 2666.3222 K I 137 161 PSM KLMNIEFYDCSCVSGSGFQK 2388 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:35,10-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2750.19 42.90135 3 2385.052571 2385.043940 K G 492 512 PSM ANHAPFETDISTLTR 2389 sp|Q9QXD6|F16P1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.3039.21 51.11427 2 1713.8327 1713.8317 M F 2 17 PSM YFDSFGDLSSASAIMGNAK 2390 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3499.5 64.07827 2 1980.882447 1979.893493 R V 42 61 PSM QGGLGPMNIPLISDPKR 2391 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.3428.13 62.0572 2 1774.9370 1774.9395 K T 94 111 PSM QHATNVGIMFR 2392 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.2679.6 40.88127 2 1255.6128 1255.6127 R G 132 143 PSM QVVDSAYEVIK 2393 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:28 ms_run[1]:scan=1.1.3135.7 53.85565 2 1233.6302 1232.6282 K L 233 244 PSM TSLSPGSGVVTYYLR 2394 sp|P28271|ACOC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3035.20 50.99745 2 1599.824847 1598.830422 K E 469 484 PSM ANDTTFGLAAGVFTR 2395 sp|Q9JLJ2|AL9A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.3211.15 55.99603 2 1540.770847 1539.768157 R D 412 427 PSM STVHEILCK 2396 sp|P07356|ANXA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1,8-UNIMOD:4 ms_run[1]:scan=1.1.2433.17 33.9142 2 1127.5666 1127.5640 M L 2 11 PSM IAVYSCPFDGMITETK 2397 sp|P42932|TCPQ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:4 ms_run[1]:scan=1.1.3156.8 54.46337 2 1831.846247 1830.853208 K G 239 255 PSM SSSRPVALVTGANK 2398 sp|P48758|CBR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.2332.18 31.10713 2 1427.7739 1427.7727 M G 2 16 PSM AGKPVLHYFNAR 2399 sp|P13745|GSTA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.2476.5 35.119 3 1413.7544 1413.7512 M G 2 14 PSM ADQLTEEQIAEFK 2400 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 20 1-UNIMOD:1 ms_run[1]:scan=1.1.3321.14 59.09077 2 1562.7453 1562.7459 M E 2 15 PSM STPAITLENPDIK 2401 sp|Q9DCN2|NB5R3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2680.11 40.9116 2 1398.735247 1397.740210 R Y 30 43 PSM ANVVASALAQIPQK 2402 tr|Q8R084|Q8R084_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2955.14 48.72268 2 1408.803647 1408.803814 K V 322 336 PSM DLEHNVSPGYNFR 2403 sp|Q9JJX6|P2RX4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2496.9 35.6971 3 1546.723271 1546.716455 R F 283 296 PSM IEANEALVK 2404 sp|Q9D3D9|ATPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2124.12 25.25808 2 986.544647 985.544411 R A 157 166 PSM ILTTNTWSSELSK 2405 sp|O70475|UGDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=1.1.2756.17 43.07347 2 1480.761047 1478.761674 K L 208 221 PSM SNNGLAVHIFLCNSSMENR 2406 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 20 12-UNIMOD:4 ms_run[1]:scan=1.1.3061.16 51.72178 3 2162.985371 2161.999707 K C 127 146 PSM AEAQIAAK 2407 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1653.9 12.00372 2 800.436447 800.439218 K N 83 91 PSM KPFDDAK 2408 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1609.12 10.77205 2 819.409247 819.412669 R C 205 212 PSM AAAQTLER 2409 sp|P23492|PNPH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1699.13 13.27613 2 858.450447 858.455930 K F 266 274 PSM DGDGTITTK 2410 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1678.18 12.70713 2 906.423847 906.429441 K E 23 32 PSM VLEQGQHR 2411 sp|Q78JT3|3HAO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1551.12 9.171733 2 965.506647 965.504278 R D 66 74 PSM GLQTSQDAR 2412 sp|P14211|CALR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1650.16 11.925 2 974.474247 974.478122 K F 65 74 PSM KYEATLEK 2413 sp|P07724|ALBU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1714.18 13.70045 2 980.517047 980.517862 K C 376 384 PSM HGSNLEAMGK 2414 tr|Q80X81|Q80X81_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1700.20 13.30997 2 1042.484647 1042.486579 R L 224 234 PSM KATQEAFMK 2415 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:35 ms_run[1]:scan=1.1.1630.20 11.36345 2 1068.525647 1068.527381 K R 322 331 PSM VTYQAQQDK 2416 sp|O08601|MTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1680.19 12.76252 2 1079.522847 1079.524738 K V 176 185 PSM HRADNEVNK 2417 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1532.9 8.654233 2 1081.525447 1081.526470 R S 114 123 PSM GRSPSDCCHNQCAAGCTGPR 2418 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.1656.19 12.09742 4 2246.880094 2246.878623 R E 225 245 PSM SNVNDGVAQSTR 2419 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1741.21 14.45938 2 1246.587047 1246.590192 K I 245 257 PSM AAVPDAVGK 2420 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1894.12 18.78262 2 826.452647 826.454868 R C 587 596 PSM ATDVMIAGK 2421 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:35 ms_run[1]:scan=1.1.1857.12 17.74005 2 920.462847 920.463718 R V 206 215 PSM NSASLHVLK 2422 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1845.16 17.4027 2 967.543847 967.545080 K T 287 296 PSM AGTTLVECK 2423 sp|Q9DBA8|HUTI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.1862.17 17.8868 2 977.484647 977.485182 R S 148 157 PSM HEYQANGPEDLNR 2424 sp|Q9R0P5|DEST_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1926.17 19.69375 3 1541.691971 1541.685883 K T 133 146 PSM VVDDTNITR 2425 sp|P05784|K1C18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1933.18 19.89513 2 1031.524847 1031.524738 K L 181 190 PSM HNADFCYK 2426 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.1799.18 16.0909 2 1053.433247 1053.433815 K L 135 143 PSM GVSEIVHEGK 2427 sp|P12710|FABPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1875.19 18.25602 2 1053.544247 1053.545474 K K 37 47 PSM RATDVMIAGK 2428 sp|P50247|SAHH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1867.20 18.02985 2 1060.566647 1060.569914 K V 205 215 PSM ALSTQGSSVGR 2429 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1779.18 15.52995 2 1061.545847 1061.546536 K K 89 100 PSM IQEAGTEVVK 2430 sp|P08249|MDHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1935.17 19.95022 2 1072.576847 1072.576440 R A 230 240 PSM GVSQAVEHINK 2431 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1861.20 17.86103 2 1180.619047 1180.620036 K T 61 72 PSM SNPTLNEYHTR 2432 sp|Q00623|APOA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1869.14 18.08152 3 1330.629971 1330.626578 K A 206 217 PSM KPMVLGHEAAGTVTK 2433 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1880.20 18.39698 3 1537.831871 1537.828648 K V 64 79 PSM ALAHSELDVR 2434 sp|O35453|HEPS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1966.10 20.8056 3 1109.586971 1109.582922 R T 117 127 PSM SISKEEILER 2435 sp|Q9DBM2|ECHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2075.7 23.87372 3 1202.652671 1202.650667 R C 608 618 PSM VSNLPTVK 2436 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2039.11 22.86592 2 856.500647 856.501818 R K 188 196 PSM IPAGLENR 2437 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2003.12 21.85513 2 868.475047 868.476666 R L 15 23 PSM SVTHANALTVMGK 2438 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2114.10 24.96908 3 1327.694471 1327.691820 R A 749 762 PSM ALEQALEK 2439 sp|P97449|AMPN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2029.11 22.58512 2 900.490847 900.491647 R T 935 943 PSM GGPLSGPYR 2440 sp|P16015|CAH3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2098.10 24.51633 2 902.460047 902.461016 R L 81 90 PSM NDEGIAYR 2441 sp|Q61171|PRDX2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1942.14 20.1385 2 936.429647 936.430110 K G 120 128 PSM VDDVAALDK 2442 sp|Q9ET01|PYGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2128.10 25.37118 2 944.481647 944.481476 R K 716 725 PSM IMEQIAQK 2443 sp|O08966|S22A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2012.17 22.10995 2 959.510847 959.511002 R N 302 310 PSM VVAVDCGIK 2444 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.2091.15 24.32992 2 959.511047 959.511003 K N 220 229 PSM QSDLDTLAK 2445 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2112.14 24.91502 2 989.502247 989.502940 K E 145 154 PSM HVLVTLGEK 2446 sp|Q60605|MYL6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2055.14 23.31892 2 994.581247 994.581131 R M 111 120 PSM DASPGSPLEK 2447 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1973.18 21.00908 2 999.487647 999.487290 K L 428 438 PSM LLVSASQDGK 2448 sp|P29387|GBB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2000.17 21.77453 2 1016.549847 1016.550225 R L 69 79 PSM IICQGFTGK 2449 sp|Q9WUM5|SUCA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.2115.13 25.00028 2 1022.518847 1022.521902 K Q 58 67 PSM HVTLLVCGK 2450 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.2068.15 23.68618 2 1025.567447 1025.569186 K M 449 458 PSM SPGVAELSQR 2451 sp|O08966|S22A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2084.14 24.13062 2 1042.541447 1042.540723 R C 52 62 PSM MPINEPAPGR 2452 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2121.16 25.17522 2 1080.539847 1080.538614 K K 238 248 PSM SGQVLEVSGSK 2453 sp|P62814|VATB2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1966.18 20.81228 2 1089.565447 1089.566603 R A 83 94 PSM FVAVTSTNAAK 2454 sp|Q9EQF5|DPYS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2026.18 22.50715 2 1107.589847 1107.592424 R I 374 385 PSM ELQDNVDVTK 2455 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2108.16 24.80208 2 1159.571847 1159.572082 K Y 274 284 PSM TAHIVLEDGTK 2456 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1941.8 20.106 3 1182.624371 1182.624452 K M 45 56 PSM QNGQWGPEER 2457 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1987.18 21.40945 2 1199.531447 1199.531949 K K 77 87 PSM STESLQANVQR 2458 sp|P47963|RL13_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1964.21 20.75838 2 1231.613847 1231.615679 K L 106 117 PSM LDQGGAPLAGTNK 2459 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2016.19 22.22353 2 1240.642247 1240.641165 K E 109 122 PSM TNQELQEINR 2460 sp|P07356|ANXA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2062.20 23.52408 2 1243.615847 1243.615679 R V 136 146 PSM KFFVQYQHR 2461 sp|O08573|LEG9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1970.8 20.91653 3 1251.649871 1251.651276 K V 116 125 PSM LCTSATESEVTR 2462 sp|Q9CZ13|QCR1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.2011.21 22.08557 2 1352.628247 1352.624195 R G 379 391 PSM LQTCCDKPLLK 2463 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.2003.13 21.85597 3 1374.703571 1374.699943 K K 299 310 PSM DEVDGGPAGPPGGAAK 2464 sp|Q8VEK0|CC50A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2030.21 22.62138 2 1393.646647 1393.647373 K T 9 25 PSM LATDAAQVQGATGTR 2465 sp|P21440|MDR3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2121.20 25.17855 2 1458.743047 1458.742670 R L 814 829 PSM STAGDTHLGGEDFDNR 2466 sp|P17156|HSP72_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2117.21 25.0643 3 1690.724471 1690.718306 K M 224 240 PSM TEQDLALGTDAEGQR 2467 sp|Q60770|STXB3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2330.18 31.05105 2 1602.759647 1602.748543 K V 368 383 PSM LTGVSISQVNHNKPLR 2468 sp|O08917|FLOT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2140.9 25.71725 4 1761.990494 1761.984966 R T 411 427 PSM ADEGISFR 2469 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2237.8 28.44042 2 893.424647 893.424296 K G 121 129 PSM ADEGISFR 2470 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2233.10 28.32855 2 893.424647 893.424296 K G 121 129 PSM TIAPALVSK 2471 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2228.8 28.18465 2 898.547447 898.548768 K K 72 81 PSM VINDFVEK 2472 sp|P07758|A1AT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2240.12 28.52858 2 962.509447 962.507297 K G 174 182 PSM KLDPGSEETQTLVR 2473 sp|Q9D8N0|EF1G_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2209.15 27.64503 3 1571.817971 1571.815501 R E 401 415 PSM TAAYVNAIEK 2474 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2183.13 26.92047 2 1078.565647 1078.565875 R V 536 546 PSM LRVDPVNFK 2475 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2333.4 31.12042 3 1086.620471 1086.618579 K L 92 101 PSM YLVIQGDER 2476 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2318.16 30.7133 2 1091.560847 1091.561124 R M 980 989 PSM LHVDPENFR 2477 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2254.5 28.92235 3 1125.559271 1125.556707 K L 97 106 PSM GYSFTTTAER 2478 sp|P60710|ACTB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2226.16 28.13358 2 1131.520047 1131.519653 R E 197 207 PSM GNDKVPGAWTEACGQK 2479 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 13-UNIMOD:4 ms_run[1]:scan=1.1.2166.16 26.45397 3 1716.794471 1716.788969 R L 226 242 PSM VPLVAMHHAYVVTER 2480 sp|Q99LB7|SARDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2335.17 31.18712 3 1720.916171 1720.908296 K I 287 302 PSM GDDVINASGYR 2481 sp|Q91VA0|ACSM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2242.18 28.59023 2 1165.541647 1165.536366 R I 464 475 PSM RVYATILNAGTNTDGSK 2482 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2292.15 29.99335 3 1779.917771 1779.911526 R E 241 258 PSM LWDQTSSEVK 2483 sp|O88451|RDH7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2223.19 28.0496 2 1191.575047 1191.577168 K E 225 235 PSM AAGCDFNNVVK 2484 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2207.17 27.59077 2 1193.550447 1193.549907 K T 68 79 PSM TTYMEDGQIR 2485 sp|P16406|AMPE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2172.18 26.62647 2 1212.541847 1212.544487 K S 198 208 PSM SNFEEALAAHK 2486 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2214.8 27.78123 3 1215.592271 1215.588401 K Y 34 45 PSM QFSGETFEER 2487 sp|Q9DBA8|HUTI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2271.15 29.41647 2 1228.535647 1228.536031 K I 62 72 PSM AYGENIGYSEK 2488 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2142.19 25.78365 2 1229.556047 1229.556432 K D 279 290 PSM YVGSMVADIHR 2489 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2289.5 29.90308 3 1246.612871 1246.612842 R T 245 256 PSM IEEACEIYAR 2490 sp|Q9DB05|SNAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.2294.20 30.05287 2 1252.576247 1252.575788 K A 38 48 PSM SAVYIIENAKR 2491 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2187.10 27.02568 3 1262.700071 1262.698286 K V 123 134 PSM ALSIAVTGSGSCR 2492 sp|Q62165|DAG1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 12-UNIMOD:4 ms_run[1]:scan=1.1.2323.20 30.86078 2 1277.631847 1277.639785 K H 700 713 PSM LAQEDPDYGLR 2493 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2322.20 30.832 2 1275.615847 1275.609531 R D 253 264 PSM VYGTTDDLCSR 2494 sp|Q61830|MRC1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2161.19 26.3174 2 1285.563247 1285.560866 K G 141 152 PSM GAAQNIIPASTGAAK 2495 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2262.20 29.16147 2 1368.736247 1368.736128 R A 199 214 PSM IAEQVASFQEEK 2496 sp|P26231|CTNA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2334.19 31.16072 2 1377.680647 1377.677610 K S 684 696 PSM AAEIDCQDIEER 2497 sp|P15508|SPTB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.2268.21 29.33528 2 1447.626247 1447.624923 K L 1539 1551 PSM ENYGELADCCTK 2498 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2231.21 28.28138 2 1458.575647 1458.575530 R Q 106 118 PSM SSCIVCNTLTQEK 2499 sp|Q9JL15|LEG8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4,6-UNIMOD:4 ms_run[1]:scan=1.1.2335.21 31.19047 2 1538.705447 1538.706879 R W 72 85 PSM YNPNVLPVQCTGKR 2500 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.2251.15 28.84543 3 1644.844871 1644.840610 K D 205 219 PSM GISEETTTGVHNLYK 2501 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2280.18 29.66843 2 1647.813047 1647.810415 R M 152 167 PSM GTVCAANDFNPDADAK 2502 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2324.21 30.89017 2 1664.710847 1664.710050 K A 355 371 PSM ATWGDGGDNSPSNVVSK 2503 sp|O09044|SNP23_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2338.21 31.27567 2 1689.760247 1689.759442 K Q 101 118 PSM VMLGETNPADSKPGTIR 2504 sp|P15532|NDKA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:35 ms_run[1]:scan=1.1.2204.17 27.50655 3 1800.903671 1800.903999 R G 89 106 PSM SSVTFECDLGR 2505 sp|O70570|PIGR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.2508.5 36.04213 2 1269.576447 1269.565951 R E 251 262 PSM DLTEDHSSLLLHVK 2506 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2547.4 37.11078 4 1605.837294 1605.836236 K Q 114 128 PSM LFNLSKEDDVR 2507 sp|P62754|RS6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2364.8 31.98422 3 1334.687171 1334.683030 K Q 144 155 PSM LVADFMAK 2508 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2545.2 37.05278 2 893.469847 893.468075 K K 332 340 PSM AIGTLIVTK 2509 sp|Q9JLF6|TGM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2452.7 34.4402 2 914.579847 914.580068 K A 521 530 PSM VFIEDVSK 2510 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2357.10 31.78867 2 935.496847 935.496398 K E 59 67 PSM AIGGELASIK 2511 sp|Q61830|MRC1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2415.2 33.41185 2 957.550247 957.549496 K S 682 692 PSM GYYAVAVVK 2512 sp|Q921I1|TRFE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2386.9 32.61063 2 968.532047 968.533118 K A 447 456 PSM QTALAELVK 2513 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2535.8 36.77285 2 971.565047 971.565147 K H 550 559 PSM LVVLGSGGVGK 2514 sp|P62835|RAP1A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2385.13 32.58593 2 984.596247 984.596781 K S 6 17 PSM FGEPIPISK 2515 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2538.9 36.85983 2 986.542847 986.543683 R A 212 221 PSM VLTEIIASR 2516 sp|P48036|ANXA5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2527.6 36.55052 2 1000.590847 1000.591696 K T 107 116 PSM IGYPAPNFK 2517 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2488.11 35.47007 2 1005.529447 1005.528367 K A 8 17 PSM LTFDSSFSPNTGKK 2518 sp|Q60932|VDAC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2418.12 33.50255 3 1527.761171 1527.756923 K N 110 124 PSM IGGIGTVPVGR 2519 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2441.10 34.13222 2 1024.603647 1024.602929 K V 256 267 PSM MPYTNAVIHEVQR 2520 tr|L7N463|L7N463_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2462.7 34.72435 3 1556.782271 1556.776947 R F 356 369 PSM GDFCIQVGR 2521 sp|P15532|NDKA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2536.8 36.80148 2 1050.490647 1050.491664 R N 106 115 PSM GDFCIQVGR 2522 sp|P15532|NDKA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2529.7 36.60537 2 1050.490647 1050.491664 R N 106 115 PSM HTLAANFNPVSEER 2523 sp|P24668|MPRD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2347.6 31.51058 3 1583.776871 1583.769219 R G 149 163 PSM TKPYIQVDIGGGQTK 2524 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2356.14 31.76338 3 1603.862471 1603.856972 K T 125 140 PSM YGVSGYPTLK 2525 sp|P27773|PDIA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2481.15 35.27182 2 1083.560647 1083.560061 K I 95 105 PSM QDIAFAYQR 2526 sp|P07356|ANXA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2475.17 35.10018 2 1110.542847 1110.545808 R R 69 78 PSM GLGTDDNTLIR 2527 sp|P97429|ANXA4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2439.15 34.07942 2 1173.597647 1173.598966 K V 260 271 PSM MLQDVQMPSK 2528 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2380.20 32.45035 2 1175.571047 1175.567865 R K 497 507 PSM MVNHFIAEFK 2529 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2510.17 36.09955 2 1234.617247 1234.616865 R R 237 247 PSM IEGIQNMPNVR 2530 sp|Q99LB7|SARDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2535.15 36.77868 2 1269.648847 1269.649956 R D 302 313 PSM MNPQSAFFQGK 2531 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:35 ms_run[1]:scan=1.1.2346.10 31.49188 2 1269.582447 1269.581208 K L 512 523 PSM NISQSFTNFSK 2532 sp|Q64458|CP2CT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2548.17 37.1497 2 1271.614047 1271.614616 K A 49 60 PSM VLQATVVAVGSGGK 2533 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2393.16 32.81097 2 1284.740247 1284.740151 K G 41 55 PSM AELDQLPGAQEK 2534 sp|Q7TMS5|ABCG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2354.15 31.70795 2 1297.652447 1297.651395 K K 347 359 PSM TIYAGNALCTVK 2535 sp|Q99LC5|ETFA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2453.21 34.48055 2 1309.668647 1309.670023 R C 147 159 PSM TAAAVAAQSGILDR 2536 sp|Q9R112|SQOR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2439.19 34.08275 2 1342.723247 1342.720478 K T 345 359 PSM MGPLINAPHLER 2537 sp|Q9JLJ2|AL9A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2528.2 36.5742 3 1346.714471 1346.712890 R V 327 339 PSM GQNQPVLNITNR 2538 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2356.20 31.7684 2 1352.717047 1352.716061 R Q 317 329 PSM AHVYVEEVPWK 2539 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2537.17 36.83762 2 1355.687447 1355.687387 R R 108 119 PSM LLNDEDQVVVNK 2540 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2372.15 32.21803 2 1384.722047 1384.719809 K A 159 171 PSM AQVAQPGGDTIFGK 2541 sp|P70349|HINT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2501.20 35.84922 2 1387.712647 1387.709579 K I 8 22 PSM AHGGYSVFAGVGER 2542 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2345.9 31.46823 2 1405.676047 1405.673862 K T 226 240 PSM ITSLEVENQNLR 2543 sp|P57776|EF1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2444.19 34.22523 2 1414.741447 1414.741607 R G 84 96 PSM EIYTMDSTTDIK 2544 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2549.20 37.18052 2 1415.647447 1415.649012 K A 129 141 PSM NVVALDTEVTNNR 2545 sp|P35951|LDLR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2455.20 34.53743 2 1443.730047 1443.731771 K I 429 442 PSM FLEQQNQVLQTK 2546 sp|P04104|K2C1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2431.21 33.8622 2 1474.776647 1474.777993 R W 208 220 PSM YNPNVLPVQCTGK 2547 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.2482.20 35.30463 2 1488.740247 1488.739499 K R 205 218 PSM NQVAMNPTNTVFDAK 2548 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:35 ms_run[1]:scan=1.1.2412.21 33.34423 2 1664.786247 1664.782821 K R 57 72 PSM FNNVEAGKYTVGLGQTR 2549 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2472.15 35.0125 3 1852.948871 1852.943161 K M 76 93 PSM EAAQMDMVNDGVEDLRGK 2550 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:35 ms_run[1]:scan=1.1.2428.17 33.7748 3 1992.897071 1992.888091 R Y 86 104 PSM HVGDLGNVTAGKDGVANVSIEDR 2551 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2516.8 36.25694 4 2322.170894 2322.156401 R V 81 104 PSM GAIFGGFK 2552 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2585.2 38.17302 2 795.427047 795.427925 K S 317 325 PSM YRPELDLVLK 2553 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2744.3 42.71432 3 1244.715671 1244.712873 R G 1307 1317 PSM YRPELDLVLK 2554 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2750.3 42.888 3 1244.715671 1244.712873 R G 1307 1317 PSM IILLAEGR 2555 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2555.4 37.339 2 883.549047 883.549102 R L 336 344 PSM HLEINPDHPIVETLR 2556 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2563.4 37.56812 4 1781.951294 1781.942433 K Q 625 640 PSM RPAIFTYHDVGLNYK 2557 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2590.4 38.31288 4 1792.931294 1792.926054 K S 62 77 PSM WIPQNDLLGHPK 2558 tr|Q8R084|Q8R084_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2613.4 38.97737 3 1416.753671 1416.751384 K T 357 369 PSM VDFNVPMK 2559 sp|P09041|PGK2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2601.7 38.63228 2 948.472247 948.473889 R N 23 31 PSM KIGGIFAFK 2560 sp|P32020|NLTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2573.3 37.8457 2 979.584847 979.585488 K V 454 463 PSM ETLIDLGTK 2561 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2635.6 39.616 2 988.545447 988.544077 K A 604 613 PSM ETLIDLGTK 2562 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2641.7 39.7907 2 988.545447 988.544077 K A 604 613 PSM MVEGFFDR 2563 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2702.7 41.52942 2 999.449647 999.448402 K G 69 77 PSM MFASFPTTK 2564 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2592.8 38.37278 2 1028.500847 1028.500103 R T 33 42 PSM IIEETLALK 2565 sp|Q9CVB6|ARPC2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2604.7 38.71937 2 1028.609647 1028.611762 R F 10 19 PSM KIIVDTYGGWGAHGGGAFSGK 2566 sp|Q3THS6|METK2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2578.5 37.9883 4 2077.044094 2077.038124 R D 265 286 PSM MHLPSPTDSNFYR 2567 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2655.6 40.19403 3 1563.716171 1563.714012 R A 989 1002 PSM LVLLGESAVGK 2568 sp|P35278|RAB5C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2704.11 41.5907 2 1084.650047 1084.649211 K S 24 35 PSM VGILGSGDFAR 2569 sp|Q8CI59|STEA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2721.7 42.06453 2 1090.573247 1090.577108 K S 31 42 PSM VNFTVDQIR 2570 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.2600.9 38.60482 2 1090.5747 1090.5766 M A 2 11 PSM EIVPVLVSSR 2571 tr|Q80X81|Q80X81_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2752.10 42.95155 2 1097.644847 1097.644459 K K 201 211 PSM SADTLWGIQK 2572 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2649.8 40.02277 2 1117.576647 1117.576774 K E 319 329 PSM ENLQFSAALR 2573 sp|Q7TMS5|ABCG2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2663.10 40.43027 2 1147.597647 1147.598572 R L 137 147 PSM QLFHPEQLITGKEDAANNYAR 2574 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2700.14 41.4773 4 2414.212494 2414.197872 R G 85 106 PSM IYVVDVGSEPR 2575 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2567.11 37.68262 2 1232.640447 1232.640102 R A 104 115 PSM FKVDLSPYPTISHINK 2576 sp|Q9WVL0|MAAI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2746.12 42.77975 3 1858.003871 1857.998885 R E 176 192 PSM YMACCLLYR 2577 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.2713.13 41.84588 2 1248.546447 1248.545356 K G 312 321 PSM GVLFYGPPGCGK 2578 sp|Q01853|TERA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.2705.12 41.62022 2 1250.614047 1250.611779 K T 513 525 PSM QFADIAYNYR 2579 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2699.12 41.44653 2 1259.599047 1259.593487 K H 160 170 PSM DGNGYISAAELR 2580 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2643.18 39.85785 2 1264.607847 1264.604780 K H 96 108 PSM STSIIATIGPASR 2581 sp|P53657|KPYR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2624.14 39.30388 2 1272.703647 1272.703765 R S 87 100 PSM VAVDAPVSSVALR 2582 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2644.13 39.88258 2 1282.725247 1282.724501 R Q 52 65 PSM VAVDAPVSSVALR 2583 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2656.12 40.22813 2 1282.725247 1282.724501 R Q 52 65 PSM KYTPEQVAMATVTALHR 2584 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:35 ms_run[1]:scan=1.1.2651.17 40.08777 3 1931.000471 1930.993482 K T 243 260 PSM VNFVAGAVEPYK 2585 tr|Q9JHF5|Q9JHF5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2699.14 41.44822 2 1292.678447 1292.676488 K A 168 180 PSM NVFTSAEELER 2586 sp|Q91WM6|EVA1A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2729.12 42.2931 2 1293.619847 1293.620095 K A 114 125 PSM TVMPYISTTPAK 2587 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2584.14 38.15676 2 1307.677047 1307.679524 K L 191 203 PSM GAAVNLTLVTPEK 2588 sp|Q9D6M3|GHC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2739.13 42.57858 2 1311.734847 1311.739817 R A 68 81 PSM STVCGPESFTPDHKPLMGEAPELR 2589 sp|Q99LB7|SARDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2724.14 42.15592 4 2654.261294 2654.246873 K G 379 403 PSM FLIPNASQPESK 2590 sp|P63101|1433Z_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2572.17 37.82855 2 1329.692247 1329.692866 K V 104 116 PSM LTSEDLSDDAFK 2591 sp|Q9DBT9|M2GD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2627.18 39.3943 2 1339.613247 1339.614341 K F 637 649 PSM PLRLPLQDVYK 2592 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2752.2 42.94487 3 1340.784371 1340.781622 K I 245 256 PSM ASDTSITWNNLK 2593 sp|Q921I1|TRFE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2628.18 39.42318 2 1348.663247 1348.662294 K G 456 468 PSM TVFVGNHPISGTEPYIAQR 2594 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2645.18 39.9156 3 2085.071471 2085.064339 R F 21 40 PSM SLVANLAAANCYK 2595 sp|P55264|ADK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:4 ms_run[1]:scan=1.1.2711.19 41.79545 2 1393.705247 1393.702385 R K 149 162 PSM DYSEMYVTCAR 2596 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2605.17 38.75677 2 1393.566047 1393.564237 K D 254 265 PSM CGPGYPTPLEAMK 2597 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.2739.16 42.58109 2 1419.657647 1419.652658 K G 8 21 PSM ARPFPDGLAEDIDKGEVSAR 2598 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.2710.20 41.76845 3 2142.0712 2142.0700 K Q 606 626 PSM GIRPAINVGLSVSR 2599 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2563.8 37.57145 3 1437.840671 1437.841596 K V 403 417 PSM GIRPAINVGLSVSR 2600 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2570.9 37.76458 3 1437.840671 1437.841596 K V 403 417 PSM YLYIKLEEEVR 2601 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2748.19 42.8435 2 1453.782247 1453.781681 R A 244 255 PSM DRATLGINDTLIR 2602 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2690.7 41.18357 3 1456.804871 1456.799791 K L 362 375 PSM ASGKPVAATMCIGPEGDLHGVPPGECAVR 2603 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=1.1.2650.21 40.06245 4 2932.415294 2932.399368 K L 176 205 PSM VVTDETSVVLVSDK 2604 sp|Q02357|ANK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2622.15 39.24645 2 1489.787647 1489.787555 K H 784 798 PSM DIVHSGLAYTMER 2605 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2751.6 42.91935 3 1490.725571 1490.718763 K S 504 517 PSM DIANENEAQFQIR 2606 sp|O35643|AP1B1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2703.21 41.57007 2 1546.741247 1546.737585 K D 849 862 PSM LEGTNVQEAQNILK 2607 sp|Q9Z2I8|SUCB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2654.18 40.17498 2 1555.822047 1555.820586 R S 394 408 PSM IEGRPGASLPPLNLK 2608 sp|Q05920|PYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2617.5 39.09292 3 1560.901871 1560.898777 R E 974 989 PSM MLLEYTDSSYDEK 2609 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2744.18 42.72683 2 1592.694047 1592.691605 R R 19 32 PSM APAAIGPYSQAVQVDR 2610 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2622.20 39.25062 2 1641.849247 1641.847470 K T 14 30 PSM NQVAMNPTNTVFDAK 2611 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2642.20 39.83055 2 1648.788847 1648.787906 K R 57 72 PSM VVEIAPATHLDPQLR 2612 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2663.9 40.42943 3 1657.920071 1657.915155 K S 274 289 PSM EAAQMDMVNDGVEDLR 2613 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:35 ms_run[1]:scan=1.1.2629.21 39.45465 2 1807.773847 1807.771664 R G 86 102 PSM AGPWTPEAAVEHPEAVR 2614 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2588.13 38.26453 3 1815.897071 1815.890397 K Q 41 58 PSM HFRDEELSCSVLELK 2615 sp|P07759|SPA3K_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2650.15 40.05745 3 1860.911171 1860.903998 R Y 252 267 PSM HIDCASVYGNETEIGEALK 2616 sp|Q9JII6|AK1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2737.19 42.52603 3 2104.981571 2104.973535 R E 43 62 PSM DIKHDPSLQPWSASYDPGSAK 2617 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2637.18 39.68388 3 2298.099971 2298.091676 K T 37 58 PSM IGGIFAFK 2618 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2910.2 47.45245 2 851.487647 851.490525 K V 455 463 PSM LSVLLLER 2619 sp|Q8VC30|TKFC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2960.2 48.85293 2 941.588647 941.590967 R M 435 443 PSM LLIIGDSGVGK 2620 sp|Q6PHN9|RAB35_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2806.4 44.48212 2 1070.634047 1070.633560 K S 11 22 PSM SLGPENLLLK 2621 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2916.5 47.62812 2 1082.631047 1082.633560 R G 238 248 PSM ILMVGLDAAGK 2622 sp|P61205|ARF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2812.3 44.65267 2 1086.610247 1086.610717 R T 20 31 PSM IVNAAGFWAR 2623 sp|Q9DBT9|M2GD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2785.6 43.90428 2 1103.588447 1103.587613 R E 237 247 PSM TDVAAPFGGFK 2624 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2771.6 43.50105 2 1108.557047 1108.555310 K Q 866 877 PSM ISIPLDSNLR 2625 tr|B2RT89|B2RT89_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2833.5 45.23302 2 1126.633247 1126.634623 R L 75 85 PSM FINLVPSNLPHEATR 2626 sp|Q05421|CP2E1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2834.6 45.26275 3 1706.910371 1706.910404 R D 360 375 PSM VTLPAGPDILR 2627 sp|Q8BI08|MAL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2947.4 48.49458 2 1150.668247 1150.671009 R T 22 33 PSM FLQASEDLLK 2628 sp|P15532|NDKA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2788.6 43.98707 2 1162.626447 1162.623390 K E 40 50 PSM GNLEFSDVHFSYPSR 2629 sp|P21440|MDR3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2900.8 47.17333 3 1753.815371 1753.805999 K A 389 404 PSM GPLQSVQVFGR 2630 sp|P14131|RS16_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2780.12 43.76582 2 1186.645247 1186.645856 K K 5 16 PSM QITINDLPVGR 2631 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2829.10 45.12148 2 1224.682247 1224.682636 R S 141 152 PSM NIEDVIAQGVGK 2632 tr|A0A5F8MPY2|A0A5F8MPY2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2912.11 47.51792 2 1241.658847 1241.661566 K L 50 62 PSM FLASVSTVLTSK 2633 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2894.14 47.00463 2 1251.708647 1251.707454 K Y 129 141 PSM LYERLEEETGQVVGFHQPGSIR 2634 sp|Q9DBT9|M2GD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2833.10 45.23718 4 2543.287694 2543.276851 K L 108 130 PSM IDVVVNNAGILR 2635 sp|P51660|DHB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2848.12 45.67332 2 1281.739647 1281.740485 R D 93 105 PSM ESLDVYELDPK 2636 sp|Q9WV54|ASAH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2842.11 45.49728 2 1306.629047 1306.629263 K H 299 310 PSM FAELAQIYAQR 2637 sp|Q9JHW2|NIT2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2856.11 45.90415 2 1308.682847 1308.682636 R G 158 169 PSM LASTLVHLGEYQAAVDGAR 2638 sp|Q68FD5|CLH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2838.15 45.38558 3 1970.025671 1970.022140 R K 1227 1246 PSM SLGVAAEGLPDQYADGEAAR 2639 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2832.14 45.21163 3 1988.951471 1988.943949 R V 10 30 PSM VAIVGAGVSGLASIK 2640 sp|P50285|FMO1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2952.14 48.63939 2 1340.800447 1340.802751 R C 5 20 PSM TQVTVQYMQDNGAVIPVR 2641 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2945.10 48.44562 3 2018.030771 2018.025510 K I 183 201 PSM ASLQNLLSASQAR 2642 sp|P35505|FAAA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2812.7 44.66268 2 1357.728647 1357.731377 R L 83 96 PSM VAAGVLCELAQDK 2643 sp|Q02248|CTNB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.2794.12 44.15252 2 1372.701647 1372.702051 R E 613 626 PSM NVVLQTLEGHLR 2644 sp|Q60634|FLOT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2835.3 45.28907 3 1377.775271 1377.772848 K S 101 113 PSM IMNVIGEPIDER 2645 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2783.18 43.85773 2 1384.702047 1384.702051 R G 144 156 PSM GNDVLVIECNLR 2646 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2868.16 46.25423 2 1400.708047 1400.708199 K A 1248 1260 PSM CTHWAEGGQGALALAQAVQR 2647 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.2841.17 45.4733 3 2123.044571 2123.033056 K A 785 805 PSM LSQQYGDVLQIR 2648 sp|P00184|CP1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2794.15 44.15502 2 1418.751047 1418.751778 R I 70 82 PSM LADYYPINSDFK 2649 sp|O88343|S4A4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2882.18 46.65852 2 1444.688647 1444.687447 K V 607 619 PSM KLNCQVIGASVDSHFCHLAWINTPK 2650 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2911.18 47.49483 4 2894.444494 2894.431989 K K 68 93 PSM ANEELAGVVAEVQK 2651 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2787.13 43.96838 2 1455.760047 1455.756923 K N 76 90 PSM ALVINTNPVEVYK 2652 sp|Q3UQ44|IQGA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2878.20 46.5441 2 1458.804247 1458.808230 K A 997 1010 PSM LNTGAWGCCPFAK 2653 sp|P28798|GRN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.2779.18 43.74175 2 1480.659847 1480.659141 R A 297 310 PSM DQNCQEILSTFK 2654 sp|P56528|CD38_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:4 ms_run[1]:scan=1.1.2875.18 46.45568 2 1481.682047 1481.682044 R G 83 95 PSM IPPDSETTLVLVGR 2655 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2950.15 48.58513 2 1495.819447 1495.824609 K A 233 247 PSM GAHGIIVVYDVTDQESYANVK 2656 sp|Q9D1G1|RAB1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2900.18 47.18168 3 2277.134171 2277.127727 R Q 80 101 PSM NLEPEWAAAATEVK 2657 sp|Q922R8|PDIA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2926.18 47.92512 2 1527.756047 1527.756923 K E 195 209 PSM AQALAIETEAELER 2658 sp|Q9EQK5|MVP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2771.18 43.51107 2 1542.790247 1542.788952 K V 748 762 PSM VLEQLTGQTPVFSK 2659 sp|Q9CXW4|RL11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2889.18 46.86213 2 1545.845247 1545.840259 K A 39 53 PSM VIPLFSPQCGECR 2660 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2863.19 46.11153 2 1561.740847 1561.738119 K I 90 103 PSM ALDIAENEMPGLMR 2661 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 13-UNIMOD:35 ms_run[1]:scan=1.1.2923.20 47.84033 2 1574.746047 1574.743264 K M 21 35 PSM IGVVVGNCYGFVGNR 2662 sp|Q9DBM2|ECHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.2907.19 47.37968 2 1609.800447 1609.803496 K M 464 479 PSM SVEALDHDGVVEMIR 2663 sp|Q9JIL4|NHRF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2760.8 43.18212 3 1668.817571 1668.814121 K K 295 310 PSM GTTITSVLPKPALVASR 2664 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2814.8 44.71892 2 1710.005247 1710.003970 K V 403 420 PSM EAFSLFDKDGDGTITTK 2665 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2835.11 45.29575 3 1843.891271 1843.883974 K E 15 32 PSM YFAGTMAEETAPAVLER 2666 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:35 ms_run[1]:scan=1.1.2776.21 43.6579 2 1870.877447 1870.877115 R H 113 130 PSM NALPTPSDDPTALMTDPK 2667 sp|P11352|GPX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2965.21 49.00742 2 1882.897647 1882.898244 R Y 129 147 PSM KISSVQSIVPALEIANAHR 2668 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2822.18 44.93272 3 2032.149371 2032.142923 K K 250 269 PSM HFIEQGINVCLCQSYAK 2669 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2777.18 43.68403 3 2065.976471 2065.971367 R N 263 280 PSM VNLAELFK 2670 sp|P99029|PRDX5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3134.4 53.82433 2 932.531847 932.533118 K G 72 80 PSM VLGLTLLQK 2671 sp|Q9CPU0|LGUL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3004.2 50.09585 2 983.636847 983.637918 R L 52 61 PSM AGIPVFAWK 2672 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3105.2 52.98138 2 987.553647 987.554188 K G 95 104 PSM SSLAWGLLR 2673 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3068.2 51.90773 2 1001.562847 1001.565815 K L 1301 1310 PSM VSFELFADK 2674 sp|P17742|PPIA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3028.3 50.78883 2 1054.532247 1054.533512 R V 20 29 PSM TYSLADYLK 2675 sp|P28843|DPP4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2986.4 49.58697 2 1072.543047 1072.544077 R S 40 49 PSM CLIEILASR 2676 sp|P14824|ANXA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:4 ms_run[1]:scan=1.1.3043.4 51.21668 2 1073.588047 1073.590316 K T 114 123 PSM DVAPQAPVHFLVIPR 2677 sp|Q9D0S9|HINT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3115.3 53.27287 3 1657.932971 1657.930411 R K 80 95 PSM VLQPVEGEVAILFKK 2678 sp|Q61490|CD166_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3144.5 54.1148 3 1668.982271 1668.981444 K E 176 191 PSM VLITTDLLAR 2679 sp|P10630|IF4A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3012.6 50.33323 2 1113.674647 1113.675760 R G 326 336 PSM AQPIRWSHWILSHAVALTR 2680 sp|Q91YI0|ARLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3088.4 52.48638 4 2241.231294 2241.228325 R D 164 183 PSM LVFLGLDNAGK 2681 sp|P36536|SAR1A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3028.6 50.79133 2 1145.641447 1145.644459 K T 28 39 PSM SGEYPFPLIK 2682 sp|P45952|ACADM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3033.7 50.93007 2 1149.607447 1149.607011 K R 70 80 PSM GVPTGFVLPIR 2683 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3161.3 54.58613 2 1154.682247 1154.681179 K D 879 890 PSM VANVSLLALYK 2684 sp|P62267|RS23_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3058.5 51.6305 2 1189.706447 1189.707060 K G 125 136 PSM YIIWSPVCR 2685 sp|P11352|GPX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.2997.6 49.89983 2 1192.605247 1192.606300 K N 147 156 PSM VSLAVLNPYIK 2686 sp|Q9DB20|ATPO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3137.8 53.91415 2 1215.721847 1215.722710 K R 74 85 PSM FSVDVFEETR 2687 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3001.8 50.01385 2 1227.574847 1227.577168 R G 188 198 PSM FSVDVFEETR 2688 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2994.5 49.81673 2 1227.574847 1227.577168 R G 188 198 PSM FGQDYVLELR 2689 sp|Q8K441|ABCA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2997.9 49.90233 2 1238.630647 1238.629538 K V 1511 1521 PSM TFESLVDFCK 2690 sp|Q61425|HCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.3049.6 51.38903 2 1244.578647 1244.574725 K T 193 203 PSM AITGASLADIMAK 2691 sp|Q8BP67|RL24_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2998.9 49.93002 2 1260.671447 1260.674773 R R 81 94 PSM PMILGYWNVR 2692 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 2-UNIMOD:35 ms_run[1]:scan=1.1.3059.6 51.65854 2 1263.6435 1263.6429 M G 2 12 PSM TENLLGSYFPK 2693 sp|P97371|PSME1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3046.9 51.30793 2 1267.641247 1267.644853 K K 25 36 PSM WVINPSGGLISK 2694 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2992.13 49.76763 2 1269.707447 1269.708122 K G 342 354 PSM ALSDALTELGYK 2695 sp|P50431|GLYC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3120.5 53.41778 2 1279.666047 1279.665983 R I 331 343 PSM IAEESNFPFIK 2696 sp|P46460|NSF_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2974.7 49.24673 2 1293.661047 1293.660504 K I 556 567 PSM GVLLSTHDLAEAEALCDR 2697 sp|Q8K441|ABCA6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 16-UNIMOD:4 ms_run[1]:scan=1.1.2973.13 49.2234 3 1968.963371 1968.957491 K A 1472 1490 PSM TIAQDYGVLKADEGISFR 2698 sp|P35700|PRDX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2976.13 49.309 3 1982.016971 1982.010906 R G 111 129 PSM LVAIVDVIDQNR 2699 sp|Q9CR57|RL14_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3147.8 54.20493 2 1353.759847 1353.761615 K A 24 36 PSM LTGQIFLGGSIVR 2700 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3072.13 52.03183 2 1359.788847 1359.787435 R G 345 358 PSM YLGPAVLMQAYR 2701 sp|Q9CQA3|SDHB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3160.7 54.56565 2 1380.722647 1380.722392 K W 208 220 PSM TNRFTSSFQGIVDAYGVGR 2702 tr|Q9JHF5|Q9JHF5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3110.16 53.13975 3 2074.031171 2074.023202 R Y 365 384 PSM LNCQVIGASVDSHFCHLAWINTPK 2703 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4,15-UNIMOD:4 ms_run[1]:scan=1.1.3083.15 52.3498 4 2766.351694 2766.337026 K K 69 93 PSM ELVNNLAEIYGR 2704 sp|Q9QXY6|EHD3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3031.11 50.87782 2 1389.723847 1389.725229 K I 330 342 PSM LVTGWVKPIIIGR 2705 sp|O88844|IDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2976.4 49.30148 3 1450.904171 1450.902406 R H 120 133 PSM ANFLEKPVLGFVR 2706 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2988.3 49.64373 3 1488.847871 1488.845285 R L 247 260 PSM IGNTGGMLDNILASK 2707 sp|Q91V92|ACLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3092.17 52.61353 2 1502.767247 1502.776278 K L 626 641 PSM LVWIETPTNPTLK 2708 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3088.13 52.4939 2 1510.839047 1510.839531 K L 152 165 PSM YLSYTLNPDYIR 2709 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3014.16 50.40018 2 1516.760047 1516.756195 R K 843 855 PSM KYFDQVDISNGLDWSLDHK 2710 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3114.11 53.25115 3 2279.093771 2279.085862 K I 145 164 PSM VVLDDKDYFLFR 2711 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3115.2 53.27203 3 1528.795571 1528.792580 K D 81 93 PSM VPSENVLGEVGDGFK 2712 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2982.18 49.48421 2 1545.774647 1545.767488 K V 318 333 PSM SVIGMGTGAGAYILTR 2713 sp|Q62433|NDRG1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3082.14 52.32012 2 1565.817647 1565.823563 K F 133 149 PSM YYVGDTEDVLFEK 2714 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3043.16 51.2267 2 1576.730247 1576.729705 R W 118 131 PSM YYVGDTEDVLFEK 2715 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3049.11 51.39487 2 1576.730247 1576.729705 R W 118 131 PSM GTWEKPGGASPMGYDFWYQPR 2716 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 12-UNIMOD:35 ms_run[1]:scan=1.1.2998.18 49.93753 3 2445.093071 2445.084817 K H 175 196 PSM YVVVTGITPTPLGEGK 2717 sp|Q922D8|C1TC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2973.19 49.2284 2 1629.896247 1629.897774 K S 371 387 PSM DTIALCTAESIDNLR 2718 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.3153.5 54.37817 2 1690.820447 1690.819600 R A 192 207 PSM DSFIVSEGANTMDIGR 2719 sp|Q9QXE0|HACL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3073.19 52.06575 2 1710.793647 1710.788300 R T 394 410 PSM IEFEGQSVDFVDPNK 2720 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3094.20 52.6746 2 1722.811447 1722.810081 K Q 183 198 PSM VTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIR 2721 sp|P34914|HYES_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 15-UNIMOD:4 ms_run[1]:scan=1.1.3028.19 50.80219 4 3445.761694 3445.745260 K L 216 248 PSM ITSHDIEVQDFLIPK 2722 sp|P11714|CP2D9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3112.3 53.18718 3 1753.927871 1753.925051 R G 380 395 PSM AGLTLAPPEGTLPAPPPR 2723 tr|Q9JHF5|Q9JHF5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3050.6 51.42853 2 1753.970447 1753.972670 R D 75 93 PSM IHFPLATYAPVISAEK 2724 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3102.4 52.89508 3 1755.957371 1755.955957 R A 265 281 PSM YNSHMVPEDGTLTCSEPGIYVLR 2725 sp|Q99J08|S14L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 14-UNIMOD:4 ms_run[1]:scan=1.1.3006.20 50.16913 3 2637.229271 2637.220324 R F 342 365 PSM GVGIISEGNETVEDIAAR 2726 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2995.21 49.85742 2 1828.919847 1828.916671 K L 620 638 PSM ECDVLPDDTVSTLYNR 2727 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.3011.21 50.31648 2 1895.860047 1895.857108 K F 151 167 PSM RFSSEFELQQLEQFK 2728 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3086.12 52.43473 3 1914.950171 1914.947578 R A 907 922 PSM LCNPPVNAISPTVITEVR 2729 sp|Q9DBM2|ECHP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.3108.21 53.08507 2 1979.053447 1979.050997 R N 16 34 PSM DQLIVNLLKEEQAPQNK 2730 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3097.8 52.75255 3 1979.071871 1979.068755 K I 6 23 PSM TVTNAVVTVPAYFNDSQR 2731 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3024.21 50.69407 2 1980.993847 1980.990505 K Q 138 156 PSM ACADATLSQITNNIDPVGR 2732 sp|P62874|GBB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4 ms_run[1]:scan=1.1.3151.7 54.31898 3 2014.978871 2014.974203 K I 24 43 PSM VIVIGIGNSGGDLAVEISHTAK 2733 sp|P97872|FMO5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3149.12 54.26675 3 2149.176071 2149.174283 R Q 188 210 PSM EGFGHLSPTGTTEFWLGNEK 2734 sp|Q8VCM7|FIBG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3124.15 53.54213 3 2206.038071 2206.033098 K I 238 258 PSM QDVSPFNVVAWHGNYTPYK 2735 sp|O09173|HGD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3132.15 53.77543 3 2221.062071 2221.059253 K Y 258 277 PSM KEIEEYELLHTLNFDSVR 2736 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3112.13 53.19553 3 2234.128571 2234.121913 R R 527 545 PSM LDNASAFQGAVISPHYDSLLVK 2737 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3164.16 54.67987 3 2344.212071 2344.206312 R V 407 429 PSM VETGVLKPGMVVTFAPVNVTTEVK 2738 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:35 ms_run[1]:scan=1.1.3103.18 52.93602 3 2530.376471 2530.371663 R S 267 291 PSM DVDLEFLAK 2739 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3178.2 55.0627 2 1048.545847 1048.544077 K M 669 678 PSM DQLIVNLLK 2740 sp|P06151|LDHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3267.3 57.55227 2 1054.637847 1054.638646 K E 6 15 PSM FAMVVIAEPLR 2741 sp|B2RXS4|PLXB2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3198.3 55.61526 2 1244.689047 1244.695115 K S 1017 1028 PSM PMILGYWNVR 2742 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.3243.9 56.8983 2 1247.6495 1247.6480 M G 2 12 PSM DSYDFFTEIK 2743 sp|Q8BH00|AL8A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3301.4 58.53602 2 1263.565247 1263.565934 K T 472 482 PSM SIQLDGLVWGASK 2744 sp|P57776|EF1D_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3244.9 56.92662 2 1372.737847 1372.735065 R L 220 233 PSM LEGLTDEINFLR 2745 sp|P11679|K2C8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3376.8 60.64655 2 1418.741847 1418.740545 R Q 220 232 PSM WLLAAAGVEFEEK 2746 tr|E9Q6L7|E9Q6L7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3353.14 59.98888 2 1461.752047 1461.750381 R F 21 34 PSM LMFNDFLSSSSDK 2747 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3222.18 56.32107 2 1489.678247 1489.675896 R Q 315 328 PSM EVAWNLTSVDLVR 2748 sp|Q9R0H0|ACOX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3351.10 59.92893 2 1500.794447 1500.793643 K A 513 526 PSM VEIEAIAVQGPFIK 2749 sp|P52760|RIDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3289.14 58.20252 2 1512.852847 1512.855181 R A 121 135 PSM TDESQPWVLPVVR 2750 sp|P05201|AATC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3220.16 56.26085 2 1524.794847 1524.793643 R K 43 56 PSM NISFTVWDVGGQDK 2751 sp|P61205|ARF3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3231.12 56.57225 2 1564.758247 1564.752172 K I 60 74 PSM FGDMQEIIQNFVR 2752 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:35 ms_run[1]:scan=1.1.3195.17 55.54048 2 1611.774047 1611.771528 R V 85 98 PSM FGDMQEIIQNFVR 2753 sp|Q9QYG0|NDRG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:35 ms_run[1]:scan=1.1.3186.10 55.28602 2 1611.771847 1611.771528 R V 85 98 PSM SSFICNTLQPGCNSVCYDHFFPISHVR 2754 sp|P28230|CXB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3181.7 55.15658 4 3241.464894 3241.453195 K L 49 76 PSM QGGLGPMNIPLISDPK 2755 sp|P35700|PRDX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3305.4 58.64735 2 1635.872247 1635.865428 K R 94 110 PSM GLVAVVTGGASGLGLATAK 2756 tr|A2AFQ2|A2AFQ2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3195.18 55.54132 2 1640.946847 1640.946121 K R 10 29 PSM GLVAVVTGGASGLGLATAK 2757 tr|A2AFQ2|A2AFQ2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3201.20 55.71362 2 1640.946847 1640.946121 K R 10 29 PSM LFQTNTELLELTTK 2758 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3223.18 56.35032 2 1649.889247 1649.887603 R T 690 704 PSM GVALPETIEEAENLGR 2759 sp|O08966|S22A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3218.18 56.20407 2 1696.864847 1696.863179 K R 519 535 PSM IIVIMDSYGSDLVER 2760 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3257.11 57.28447 2 1708.871847 1708.870573 K G 224 239 PSM LLGNMIVIVLGHHLGK 2761 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3315.4 58.91335 3 1713.015971 1713.012367 R D 106 122 PSM VTVLEGDILDTQYLR 2762 sp|O35469|3BHS6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3378.10 60.71117 2 1733.914247 1733.919966 K K 56 71 PSM VVYSPYGSLATEILQK 2763 sp|Q63886|UD11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3327.19 59.26808 2 1766.947447 1766.945452 R E 227 243 PSM AAVPSGASTGIYEALELR 2764 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3226.15 56.43518 2 1803.939047 1803.936679 R D 33 51 PSM LLYDLADQLHAAVGASR 2765 sp|Q99LC5|ETFA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3196.5 55.55947 3 1811.960471 1811.952997 K A 233 250 PSM AVCMLSNTTAIAEAWAR 2766 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.3345.5 59.75865 3 1863.902771 1863.897139 R L 374 391 PSM AVCMLSNTTAIAEAWAR 2767 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4 ms_run[1]:scan=1.1.3343.11 59.71777 2 1863.900447 1863.897139 R L 374 391 PSM ASLEAAIADAEQRGEMAIK 2768 sp|P11679|K2C8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3190.9 55.39032 3 1972.999271 1972.988790 R D 335 354 PSM DHGDLAFVDVPNDSSFQIVK 2769 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3318.10 59.00198 3 2202.069971 2202.059313 R N 49 69 PSM NVLSLTDRGEFFNELVGQQR 2770 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3344.11 59.73815 3 2321.180171 2321.176408 K I 221 241 PSM SVTELNGDTITNTMTLGDIVYKR 2771 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3257.10 57.2828 3 2540.285171 2540.279219 K V 100 123 PSM MTEEQTLVMYSGHPLGLFPSSPR 2772 sp|Q8VC12|HUTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3307.6 58.71118 3 2576.257571 2576.240331 K A 148 171 PSM TFHETLNCCGSNALTTLTTTILR 2773 sp|P35762|CD81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.3391.6 61.03297 3 2623.280471 2623.273422 K N 149 172 PSM QIHNFISTSTFSQYTVVDDIAVAK 2774 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3329.19 59.32585 3 2683.361771 2683.349347 K I 137 161 PSM TIYISGQVGLDPSSGQLVPGGVVEEAK 2775 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3391.8 61.03797 3 2699.407871 2699.401777 R Q 30 57 PSM IEFEGQSVDFVDPNKQNLIAEVSTK 2776 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3338.12 59.58272 3 2806.409471 2806.402505 K D 183 208 PSM LSAAAQSTVYAFSARPLTGGEPVSLGSLR 2777 sp|P11352|GPX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3268.21 57.59585 3 2905.538171 2905.529771 R G 6 35 PSM KRPIHLSFDVDGLDPAFTPATGTPVLGGLSYR 2778 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.3341.11 59.66372 4 3396.8042 3396.7822 K E 224 256 PSM MKLPIFIADAFTATAFR 2779 sp|Q9CXN7|PBLD2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 1-UNIMOD:35 ms_run[1]:scan=1.1.3578.2 66.30915 3 1928.017271 1928.022991 - G 1 18 PSM LKLEAELGNMQGLVEDFK 2780 sp|P11679|K2C8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3432.4 62.15292 3 2033.062571 2033.050328 K N 165 183 PSM DLDVAVLVGSMPR 2781 sp|P14152|MDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3587.12 66.56312 2 1370.721447 1370.722786 K R 80 93 PSM EKGEFQILLDALDK 2782 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3451.5 62.688 3 1617.867071 1617.861388 R I 152 166 PSM LIAQACVSIFPDSGNFNVDNIR 2783 sp|P42932|TCPQ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.3519.15 64.62417 3 2449.214171 2449.205994 K V 182 204 PSM LGFAGVVQEISFGTTK 2784 sp|P80316|TCPE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3480.14 63.52165 2 1652.878847 1652.877373 K D 353 369 PSM SALTVQFVQGIFVEK 2785 sp|P62835|RAP1A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3531.16 64.97705 2 1664.917447 1664.913758 K Y 17 32 PSM QLLQANPILEAFGNAK 2786 sp|O08638|MYH11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3498.9 64.0481 2 1725.936447 1725.941370 K T 217 233 PSM ITIIPQDPVLFPGSLR 2787 sp|Q9R1S7|MRP6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3597.16 66.84855 2 1765.011047 1765.013807 R M 1337 1353 PSM TAVDSGIALLTNFQVTK 2788 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3559.7 65.78384 3 1776.972671 1776.962165 R L 1455 1472 PSM AYLPVNESFGFTADLR 2789 sp|P58252|EF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3419.19 61.83595 2 1798.891247 1798.889000 K S 786 802 PSM LENYPIPELGPNDVLLK 2790 sp|Q64442|DHSO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3485.19 63.67258 2 1923.037047 1923.035330 R M 22 39 PSM GHYTEGAELVDSVLDVVR 2791 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3438.7 62.32013 3 1957.979771 1957.974521 K K 104 122 PSM AFIVLNPEFLSHDQEQLIK 2792 sp|Q91VA0|ACSM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3425.6 61.97063 3 2240.188871 2240.184120 K E 509 528 PSM QWVDQSSPVLLDNPVLGSMAK 2793 sp|P70694|DHB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3599.13 66.90242 3 2283.160871 2283.156919 K K 226 247 PSM GETDEEYLWCIEQTLHFK 2794 sp|P50247|SAHH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.3601.16 66.96308 3 2297.040371 2297.031050 K D 104 122 PSM IASVTDIPEEFHVSLLTPTPNPK 2795 sp|G3X982|AOXC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3434.11 62.2151 3 2504.323871 2504.316256 K A 1234 1257 PSM ACQFPVSLLEECSGVTDANFGYSK 2796 sp|P97370|AT1B3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.3574.9 66.21619 3 2678.205971 2678.199254 R G 143 167 PSM DLFQCVSFIIPR 2797 tr|A0A0N4SVU1|A0A0N4SVU1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 5-UNIMOD:4 ms_run[1]:scan=1.1.3760.15 71.49496 2 1493.771447 1493.770071 K F 82 94 PSM LSSFIGAIAIGDLVK 2798 sp|P80314|TCPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3684.12 69.3351 2 1502.872047 1502.870831 R S 26 41 PSM MFGVPVVVAVNVFK 2799 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3703.4 69.869 2 1504.848447 1504.847593 R T 747 761 PSM DVFLGTFLYEYSR 2800 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3755.15 71.3479 2 1608.787647 1608.782410 K R 348 361 PSM QYEMDSQFQGELADDLAGFYR 2801 sp|P97449|AMPN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3705.5 69.92532 3 2482.093571 2482.074705 R S 175 196 PSM GVNLPNAEVDLPGLSEQDLLDLR 2802 sp|P53657|KPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3727.17 70.56113 3 2476.288871 2476.280933 K F 251 274 PSM AVQQPDGLAVLGIFLK 2803 sp|P00920|CAH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3763.17 71.58498 2 1667.965247 1667.961043 K I 133 149 PSM NSDQFVTSVLDGVVLPK 2804 sp|Q91WU0|CES1F_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3656.19 68.53405 2 1816.959247 1816.957080 K D 313 330 PSM VASSDLVNMGISVVSYTLK 2805 sp|O08917|FLOT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3752.14 71.25919 3 1982.049371 1982.039429 K D 134 153 PSM NGPVEGAFTVFSDFLTYK 2806 sp|P10605|CATB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3800.12 72.60368 2 1990.969247 1990.967644 K S 246 264 PSM NMAEQIIQEIYSQVQSK 2807 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3789.17 72.3072 3 2007.999671 2007.993542 K K 265 282 PSM KGTVLLADNVIVPGTPDFLAYVR 2808 sp|O88587|COMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3657.14 68.55895 3 2457.369371 2457.363147 R G 205 228 PSM ADHSSENAFVFGGPFLTDESSLLAFPEATEEEK 2809 sp|Q63880|EST3A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3750.19 71.20544 4 3570.650894 3570.631455 K Q 458 491 PSM QTALAELVK 2810 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.3233.3 56.61915 2 954.5386 954.5381 K H 550 559 PSM LVNADGEAVYCK 2811 sp|P24270|CATA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:4 ms_run[1]:scan=1.1.2181.15 26.87155 2 1337.628247 1337.628552 K F 222 234 PSM HWPFMVVNDAGRPK 2812 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2600.10 38.60565 3 1652.832071 1652.824566 K V 89 103 PSM ATYQDADIYILDDPLSAVDTHVGK 2813 sp|Q8VI47|MRP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3472.18 63.29142 3 2619.279971 2619.270428 R H 772 796 PSM GVSQAVEHINK 2814 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.1865.11 17.96583 3 1180.6302 1180.6192 K T 61 72 PSM HIADLAGNPEVILPVPAFNVINGGSHAGNK 2815 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.3420.7 61.85977 4 3021.5762 3020.5822 R L 133 163 PSM IEEELGSK 2816 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1857.11 17.73922 2 903.456247 903.454927 R A 413 421 PSM GTEFLAAPSSYYK 2817 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2790.11 44.04947 2 1433.698647 1432.687447 R L 285 298 PSM GLKLEETYTNK 2818 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2115.9 24.99695 3 1293.671171 1294.676882 R D 340 351 PSM SQIDELYATIKI 2819 sp|P41216|ACSL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3405.9 61.42159 2 1392.752847 1392.750047 R - 688 700 PSM VLDSGAPIKIPVGPETLGR 2820 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3010.11 50.27878 3 1918.093871 1918.088763 K I 125 144 PSM HQGSLYSLFPDHSVKK 2821 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2302.5 30.26292 4 1841.951294 1841.942433 R Y 130 146 PSM CFYNSDGDFLIVPQK 2822 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3778.13 71.98843 2 1784.8109 1784.8074 R G 146 161 PSM VSDLAGLDVGWK 2823 sp|Q9DBM2|ECHP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3064.12 51.80245 2 1258.663047 1258.655752 R V 516 528 PSM PYTIVYFPVR 2824 sp|P19157|GSTP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.3160.3 54.55897 2 1253.6789 1253.6803 P G 3 13 PSM YVTLIYTNYENGKNDYVK 2825 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2856.14 45.90665 3 2197.065671 2196.073900 K A 104 122 PSM SPAQILIR 2826 sp|Q9DCT1|AKCL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2461.4 34.69402 2 896.543247 896.544351 K F 229 237 PSM TFVSGACDASIK 2827 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4 ms_run[1]:scan=1.1.2275.16 29.52982 2 1254.590647 1254.591438 R L 198 210 PSM DASINPPMCLQDVER 2828 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.3001.19 50.02303 2 1743.791447 1743.792005 R M 92 107 PSM SIQFVDWCPTGFK 2829 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 8-UNIMOD:4 ms_run[1]:scan=1.1.3339.5 59.60232 2 1583.745647 1583.744250 R V 340 353 PSM QDVDVWLWQQEGSSK 2830 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.3718.15 70.29545 2 1786.8141 1786.8157 R V 224 239 PSM SADAAAGEPLPR 2831 sp|P70441|NHRF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.2515.10 36.22897 2 1196.5932 1195.5832 M L 2 14 PSM DQGPEVGVSNR 2832 sp|P58735|S26A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.1963.19 20.7285 2 1156.547847 1156.547265 K S 579 590 PSM QDAFALASQQK 2833 sp|Q8VCH0|THIKB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=1.1.2328.11 30.99193 2 1206.6192 1205.6032 K A 199 210 PSM AHYHDNYGKNDEVEFVR 2834 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.2286.9 29.82437 4 2133.9588 2133.9499 M T 2 19 PSM QQYEHTVQVSR 2835 sp|Q99J08|S14L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:28 ms_run[1]:scan=1.1.2138.21 25.66923 2 1356.6433 1356.6417 K G 276 287 PSM ALQSADVIVLFGAR 2836 sp|Q9QXE0|HACL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3386.6 60.9177 2 1458.814847 1458.819464 R L 272 286 PSM AVAAAAVAAPAGGGGAR 2837 sp|Q99L88|SNTB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.2734.19 42.43973 2 1378.7317 1378.7312 M A 2 19 PSM DILGGNGISDEYHVIR 2838 sp|Q60759|GCDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3038.4 51.07093 3 1757.873471 1756.874413 R H 387 403 PSM VLQATVVAVGSGGK 2839 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2405.17 33.14887 2 1284.740247 1284.740151 K G 41 55 PSM VIAAEGEMNASR 2840 sp|P54116|STOM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2071.20 23.77413 2 1247.592047 1246.597586 K A 221 233 PSM SSSRPVALVTGANK 2841 sp|P48758|CBR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.2338.19 31.274 2 1427.7739 1427.7727 M G 2 16 PSM AGRLPACVVDCGTGYTK 2842 sp|Q99JY9|ARP3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1,7-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.2770.12 43.47685 3 1865.8859 1865.8759 M L 2 19 PSM VIESLGATNLGK 2843 sp|Q9DCY0|KEG1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2458.19 34.62248 2 1200.672047 1200.671403 K V 113 125 PSM IQIWDTAGQER 2844 sp|Q8K386|RAB15_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2651.19 40.08945 2 1315.652647 1315.652064 R Y 59 70 PSM SEIDLLDIR 2845 sp|O35639|ANXA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3180.3 55.1172 2 1072.573247 1072.576440 R H 280 289 PSM NTGIICTIGPASR 2846 sp|P52480|KPYM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:4 ms_run[1]:scan=1.1.2529.14 36.61538 2 1358.696247 1358.697634 R S 44 57 PSM AASAASSEHFEK 2847 sp|O88384|VTI1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=1.1.2069.19 23.71737 2 1275.5711 1275.5726 M L 2 14 PSM ELRDVDGVEEVHELHVWQLAGSR 2848 sp|Q60738|ZNT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2959.12 48.83313 4 2672.335694 2672.330677 K I 354 377 PSM AVSKLWGK 2849 sp|Q9JHC9|ELF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2418.6 33.49503 2 886.518647 887.522888 K H 245 253 PSM AVSKLWGK 2850 sp|Q9JHC9|ELF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2425.5 33.68275 2 886.518647 887.522888 K H 245 253 PSM SQELHELYEGLK 2851 sp|Q8K183|PDXK_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2521.4 36.38968 3 1446.712271 1444.719809 K V 59 71 PSM DGTIEIPSCFK 2852 sp|Q01339|APOH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=1.1.2949.8 48.55283 2 1264.599447 1265.596189 R E 317 328 PSM AFQINTFNLK 2853 sp|P17047|LAMP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.2962.5 48.9114 2 1194.637447 1194.639708 R V 347 357 PSM VITAFNDGLNHLDSLK 2854 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3045.7 51.27727 3 1756.905971 1755.915549 K G 68 84 PSM SNNGLAVHIFLCNSSMENR 2855 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 12-UNIMOD:4 ms_run[1]:scan=1.1.3055.6 51.55283 3 2162.985371 2161.999707 K C 127 146 PSM MSASQLEALCPQVINAALALAAKPQSK 2856 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=1.1.3694.20 69.63544 3 2808.475271 2809.483021 R L 452 479 PSM VDIDDHTDLAIEYEVSAVPTVLAIK 2857 sp|P97493|THIOM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=1.1.3704.12 69.90342 3 2725.389971 2725.406193 K N 116 141 PSM RQVEIAQR 2858 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1670.5 12.47602 3 998.559371 998.562127 R E 101 109 PSM SAAETVTK 2859 sp|Q64433|CH10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1588.10 10.1946 2 805.416647 805.418148 R G 21 29 PSM GASIVEDK 2860 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1741.7 14.4477 2 817.414647 817.418148 R L 77 85 PSM SEVEVKK 2861 sp|O35490|BHMT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1551.10 9.17005 2 817.452047 817.454533 K I 133 140 PSM KPFDDAK 2862 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1602.10 10.58258 2 819.409247 819.412669 R C 205 212 PSM FNNVEAGK 2863 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1723.13 13.9503 2 877.427647 877.429381 K Y 76 84 PSM VIQVPSKK 2864 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1726.14 14.03522 2 897.561047 897.564753 K V 290 298 PSM VACETVCK 2865 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.1676.16 12.65102 2 965.427847 965.431038 K T 55 63 PSM HGGPADEER 2866 sp|P08228|SODC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1544.16 8.981417 2 966.412647 966.415522 K H 72 81 PSM KATADNLIK 2867 sp|P42125|ECI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1742.17 14.4835 2 972.555647 972.560395 R Q 247 256 PSM GAAELMQQK 2868 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:35 ms_run[1]:scan=1.1.1683.10 12.84138 2 990.475247 990.480431 K E 378 387 PSM TSEIQSQAK 2869 sp|P09813|APOA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1624.16 11.19532 2 990.495847 990.498189 K A 54 63 PSM TPVSEHVTK 2870 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1642.13 11.69568 2 996.520447 996.524010 K C 491 500 PSM FQDEATCK 2871 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.1705.18 13.44745 2 997.416847 997.417496 K D 254 262 PSM RQVEIAQR 2872 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1670.20 12.48853 2 998.559247 998.562127 R E 101 109 PSM NRPINVNHYANKK 2873 sp|O70131|NINJ1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.1642.17 11.69902 3 1566.8366 1566.8374 R S 33 46 PSM KVNVVEQEK 2874 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1641.17 11.67092 2 1071.590647 1071.592424 K I 81 90 PSM VHSHQIELTK 2875 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1688.19 12.97722 2 1190.638447 1190.640771 R D 573 583 PSM IICAQQCSHR 2876 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=1.1.1661.21 12.23945 2 1271.585247 1271.586310 K C 213 223 PSM HNLCGETEEER 2877 sp|O35660|GSTM6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.1686.13 12.92508 2 1372.557247 1372.567742 K I 84 95 PSM KFLQPGSQR 2878 sp|P13745|GSTA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1765.4 15.11833 3 1059.581171 1059.582528 K K 196 205 PSM AAEILAR 2879 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1933.8 19.88678 2 742.431647 742.433738 R D 68 75 PSM KLSVSQVVHK 2880 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1820.9 16.68135 3 1123.672871 1123.671343 K A 351 361 PSM KLSVSQVVHK 2881 sp|P07759|SPA3K_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1827.8 16.88127 3 1123.672871 1123.671343 K A 351 361 PSM VHTSPNAIIGK 2882 sp|Q9JLF6|TGM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1915.6 19.37502 3 1135.634171 1135.634957 R F 208 219 PSM DGSPGFSK 2883 sp|Q9QXF8|GNMT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1777.8 15.4644 2 793.358647 793.360633 R F 231 239 PSM GRNDLMEYAK 2884 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:35 ms_run[1]:scan=1.1.1852.9 17.59552 3 1211.561471 1211.560472 K Q 156 166 PSM EKIEDNGNFR 2885 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1833.9 17.05395 3 1220.580671 1220.578565 R L 49 59 PSM QLVSDVR 2886 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1920.9 19.51685 2 815.448247 815.450117 K S 128 135 PSM TAVAPIER 2887 sp|P48962|ADT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1927.13 19.71922 2 855.481647 855.481417 K V 24 32 PSM DNHVVAAGSMER 2888 sp|Q91X91|NADC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1889.10 18.64083 3 1284.590771 1284.588084 K A 172 184 PSM VAVLSQNR 2889 tr|Q80X81|Q80X81_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1879.13 18.36295 2 885.500847 885.503215 K A 181 189 PSM MVATGVCR 2890 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.1848.16 17.48788 2 892.422647 892.425893 K S 41 49 PSM GINLSGGQR 2891 tr|B2RUS7|B2RUS7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1925.14 19.66262 2 900.477047 900.477728 R Q 833 842 PSM AVDQTIEK 2892 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1746.15 14.5908 2 902.470047 902.470912 K N 32 40 PSM GSVLPNSDK 2893 sp|P32020|NLTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1832.14 17.0296 2 915.465847 915.466161 K K 483 492 PSM LIAEGTAPR 2894 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1936.12 19.97318 2 926.517647 926.518531 R R 182 191 PSM LIAEGTAPR 2895 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1930.12 19.80463 2 926.517647 926.518531 R R 182 191 PSM RYEEIVK 2896 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1782.13 15.61148 2 935.506047 935.507632 K E 166 173 PSM VNVVEQEK 2897 sp|P17182|ENOA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1773.16 15.35655 2 943.496247 943.497461 K I 82 90 PSM SCVSLNPGK 2898 sp|Q61830|MRC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.1937.18 20.00528 2 960.466247 960.469866 K N 315 324 PSM IEDNGNFR 2899 sp|A2BIM8|MUP18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1869.17 18.08402 2 963.441047 963.441009 K L 51 59 PSM SGEGCVITR 2900 sp|Q9WV54|ASAH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.1834.19 17.09088 2 977.460247 977.460030 K E 287 296 PSM YALQSQQR 2901 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1830.19 16.97662 2 992.502247 992.503943 R W 182 190 PSM KATQEAFMK 2902 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1751.21 14.7347 2 1052.529847 1052.532466 K R 322 331 PSM KFLQPGSQR 2903 sp|P13745|GSTA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1765.5 15.11917 3 1059.581171 1059.582528 K K 196 205 PSM NVLADCNTR 2904 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.1873.18 18.19883 2 1061.491847 1061.492393 K C 434 443 PSM CCSGSLVER 2905 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.1837.20 17.17735 2 1066.452847 1066.453564 K R 500 509 PSM EATTEQQLR 2906 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1750.18 14.70392 2 1074.528247 1074.530552 K E 387 396 PSM LHPNDEDIHTANER 2907 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1793.20 15.92375 3 1659.760271 1659.760111 K R 81 95 PSM VGGTSDVEVNEK 2908 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1888.20 18.62092 2 1232.586847 1232.588461 K K 406 418 PSM QYDISNPQKPR 2909 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1921.13 19.54813 3 1344.677771 1344.678613 R L 334 345 PSM DSYVGDEAQSKR 2910 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1763.21 15.07628 2 1353.614247 1353.616073 K G 51 63 PSM YKPESDELTAEK 2911 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1934.13 19.91907 3 1408.675271 1408.672190 K I 329 341 PSM IALLEEAKK 2912 sp|P26043|RADI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2125.3 25.2793 3 1013.609471 1013.612097 K K 428 437 PSM DGVDFGK 2913 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2049.4 23.13973 2 736.338647 736.339169 K W 141 148 PSM KEEELQAALAR 2914 sp|O08638|MYH11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2124.6 25.25308 3 1256.674571 1256.672465 K L 1088 1099 PSM VSNLPTVK 2915 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2035.11 22.7535 2 856.500647 856.501818 R K 188 196 PSM IDIVENR 2916 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2091.10 24.32573 2 857.460447 857.460681 R F 266 273 PSM AFAAGADIK 2917 sp|Q8BH95|ECHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2088.8 24.24038 2 862.455047 862.454868 K E 93 102 PSM ACLYAGVK 2918 sp|P15105|GLNA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.2080.10 24.0147 2 880.445247 880.447674 R I 182 190 PSM VLETAEEIQHR 2919 sp|P08032|SPTA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2030.8 22.61055 3 1323.681071 1323.678279 K R 16 27 PSM AVFMAETK 2920 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2104.7 24.68093 2 895.446847 895.447340 K G 394 402 PSM FAQLCEK 2921 tr|A9R9W0|A9R9W0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.1980.11 21.20308 2 894.424447 894.426939 R H 152 159 PSM TQAQIVLR 2922 sp|Q8VCX1|AK1D1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2127.8 25.34075 2 927.548847 927.550165 K F 253 261 PSM YMESDGIK 2923 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1944.14 20.19353 2 941.415847 941.416433 K V 120 128 PSM ELSEIAQR 2924 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2015.12 22.18955 2 944.491647 944.492710 K I 15 23 PSM FNENAVVR 2925 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2041.14 22.92502 2 947.483047 947.482479 R N 270 278 PSM VQVQVVER 2926 sp|O08917|FLOT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2039.15 22.86925 2 955.543647 955.545080 R A 254 262 PSM AAATLMTER 2927 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2009.12 22.02247 2 962.484047 962.485516 R V 297 306 PSM AVEAFETAK 2928 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2023.10 22.41485 2 964.484447 964.486562 K K 331 340 PSM DNHLAPGQQTTLR 2929 sp|P01027|CO3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2020.13 22.33153 3 1449.737471 1449.732440 R I 571 584 PSM AGFAGDDAPR 2930 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1942.15 20.13933 2 975.441047 975.441009 K A 19 29 PSM VIHLGEGSSDSDQAIRDR 2931 sp|Q8C0Z1|F234A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2104.10 24.68343 4 1953.958494 1953.950431 R F 528 546 PSM HVLVTLGEK 2932 sp|Q60605|MYL6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2061.17 23.49325 2 994.581247 994.581131 R M 111 120 PSM ILQEGVDPK 2933 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2019.14 22.30392 2 997.544447 997.544411 R K 561 570 PSM WSVTSCGAR 2934 sp|Q9JJL3|SO1B2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.2133.14 25.51892 2 1022.461247 1022.460364 K G 598 607 PSM YLEQQYGK 2935 tr|L7N264|L7N264_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1956.19 20.52873 2 1027.498447 1027.497461 K S 342 350 PSM TAVCDIPPR 2936 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.2103.17 24.66112 2 1027.514447 1027.512065 K G 351 360 PSM SGEIEPVSVK 2937 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2130.11 25.42968 2 1043.550447 1043.549890 K V 57 67 PSM QHLQIQSSQSDLGK 2938 sp|Q9DCY0|KEG1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2010.15 22.0528 3 1567.798271 1567.795434 K V 99 113 PSM DHENIIIAK 2939 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2037.17 22.8145 2 1051.567247 1051.566209 K M 418 427 PSM HYGGLTGLNK 2940 sp|O70250|PGAM2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1945.14 20.22098 2 1058.550847 1058.550893 R A 91 101 PSM KVFIEDVSK 2941 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2078.15 23.96305 2 1063.591847 1063.591361 K E 58 67 PSM KVINDFVEK 2942 sp|P07758|A1AT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2038.20 22.84517 2 1090.602447 1090.602260 K G 173 182 PSM LVAYTSDQAHSSVER 2943 sp|O88533|DDC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2001.17 21.80285 3 1661.808671 1661.800913 K A 183 198 PSM VLEDNSALDR 2944 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2113.15 24.94458 2 1130.557247 1130.556767 R M 487 497 PSM ALANSLACQGK 2945 tr|A6ZI46|A6ZI46_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.2009.19 22.02832 2 1131.573647 1131.570643 R Y 387 398 PSM VTLTPEEEAR 2946 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2120.17 25.14735 2 1143.577247 1143.577168 K L 306 316 PSM AGHYAASVIIR 2947 sp|P55264|ADK_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.2114.7 24.96658 3 1156.6379 1156.6348 R R 338 349 PSM NEEGTWSVEK 2948 sp|Q63836|SBP2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2122.20 25.20727 2 1177.526247 1177.525132 K V 280 290 PSM ATAVMPDGQFK 2949 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35 ms_run[1]:scan=1.1.2056.19 23.35173 2 1179.559047 1179.559410 K D 17 28 PSM SLSCQMAAFR 2950 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4,6-UNIMOD:35 ms_run[1]:scan=1.1.2115.19 25.0053 2 1185.515647 1185.527064 R G 135 145 PSM CTSIITEDEK 2951 sp|Q9WV54|ASAH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.2046.19 23.06865 2 1194.5462470956602 1194.54381897753 M G 142 152 PSM GRNDLMEYAK 2952 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2119.5 25.10853 3 1195.568171 1195.565557 K Q 156 166 PSM RVPGGYTVINK 2953 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2008.20 22.00125 2 1202.676047 1202.677157 R F 238 249 PSM VRPASSAASVYAGAGGSGSR 2954 sp|P05784|K1C18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1996.18 21.66227 3 1806.898871 1806.897273 R I 27 47 PSM HPQVQEAQVVGVKDER 2955 sp|Q8VCW8|ACSF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1984.21 21.3261 3 1817.944571 1817.938410 K M 532 548 PSM SPQYSQVIHR 2956 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1992.9 21.54312 3 1213.622171 1213.620370 K L 53 63 PSM YNDLGEQHFK 2957 sp|P07724|ALBU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2000.12 21.77035 3 1249.574171 1249.572751 R G 35 45 PSM ISSDLDGHPVPK 2958 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2030.6 22.60887 3 1263.647771 1263.645916 K Q 103 115 PSM TIQVDNTDAEGR 2959 sp|Q9CPY7|AMPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1990.20 21.49647 2 1317.615847 1317.616073 K L 357 369 PSM AVANYDSVEAGEK 2960 sp|P51660|DHB4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2096.20 24.47002 2 1351.635047 1351.625575 K L 69 82 PSM CNTEEHIFVSK 2961 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.2019.9 22.29973 3 1362.626771 1362.623801 K M 327 338 PSM VAQLEAQCQEPCK 2962 sp|Q8VCM7|FIBG_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.2029.21 22.59347 2 1559.710247 1559.707213 K D 153 166 PSM TAESGELHGLTTDEK 2963 sp|P07309|TTHY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2064.21 23.58067 2 1586.745247 1586.742395 K F 69 84 PSM FVHDNYVIR 2964 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2148.6 25.94623 3 1161.594971 1161.593093 K R 1445 1454 PSM SVDEIIR 2965 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2188.8 27.05188 2 830.446647 830.449782 R L 152 159 PSM SKFDNLYGCR 2966 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2144.7 25.8316 3 1258.578671 1258.576457 K E 187 197 PSM AMLSTGFK 2967 sp|B2RQC6|PYR1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2271.7 29.40978 2 853.436647 853.436775 K I 1302 1310 PSM ALDLDPSK 2968 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2204.6 27.49737 2 857.448447 857.449448 K T 333 341 PSM LGNIEFKPESR 2969 sp|P46735|MYO1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2256.9 28.98185 3 1288.679171 1288.677551 K V 281 292 PSM QLIVGVNK 2970 sp|P10126|EF1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2176.3 26.72388 2 869.529247 869.533452 K M 147 155 PSM VGASFLQR 2971 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2294.6 30.04118 2 876.480247 876.481751 R F 140 148 PSM DCTFITK 2972 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.2158.4 26.22555 2 883.4111 883.4104 K G 387 394 PSM DCTFITK 2973 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.2160.10 26.28243 2 883.411647 883.410954 K G 387 394 PSM ADEGISFR 2974 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2225.9 28.09892 2 893.424647 893.424296 K G 121 129 PSM EAYNLGVR 2975 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2197.11 27.30717 2 920.469647 920.471580 R Y 287 295 PSM LADIGACAQIVHK 2976 sp|Q8VCN5|CGL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.2333.12 31.12708 3 1394.736971 1394.734020 K R 165 178 PSM DSQGNLFR 2977 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2212.10 27.72558 2 935.444847 935.446094 K N 88 96 PSM VAIEPGVPR 2978 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2257.8 29.00905 2 936.539247 936.539266 R E 92 101 PSM RFDDAVVQSDMK 2979 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2244.10 28.64053 3 1409.661971 1409.660914 R H 77 89 PSM NSSVGLIQLNRPK 2980 sp|Q8BH95|ECHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2341.5 31.34583 3 1424.811371 1424.809962 K A 44 57 PSM LVVVGAGGVGK 2981 sp|P08556|RASN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2278.5 29.60222 2 954.583847 954.586216 K S 6 17 PSM LNIMTAGSR 2982 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2258.7 29.0363 2 961.501047 961.501500 K G 39 48 PSM HIEVLIDK 2983 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2168.12 26.5069 2 965.554447 965.554582 K Y 143 151 PSM VVVLGSGGVGK 2984 sp|P61226|RAP2B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2217.12 27.87095 2 970.581047 970.581131 K S 6 17 PSM ISSLLQEAK 2985 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2288.7 29.87748 2 987.560447 987.560061 R T 518 527 PSM VDGALCLDK 2986 sp|Q91X72|HEMO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.2237.12 28.44375 2 989.485047 989.485182 K S 401 410 PSM GQALPEVVAK 2987 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2264.10 29.21078 2 1010.576047 1010.576046 R Y 63 73 PSM TFEESFQK 2988 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2178.9 26.78093 2 1014.465447 1014.465826 R A 804 812 PSM TFEESFQK 2989 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2185.13 26.97315 2 1014.465447 1014.465826 R A 804 812 PSM CGIAVAPVSR 2990 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.2213.11 27.75503 2 1028.542847 1028.543700 K W 643 653 PSM RDPVDTDDTATALR 2991 sp|Q99P30|NUDT7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2141.14 25.75045 3 1544.744471 1544.743064 K E 78 92 PSM RIILLAEGR 2992 sp|P50247|SAHH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2273.13 29.47243 2 1039.649447 1039.650214 R L 335 344 PSM DEQNFLQR 2993 sp|P34927|ASGR1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2330.9 31.0427 2 1048.493847 1048.493772 R H 195 203 PSM VVNISSSMGR 2994 sp|O88451|RDH7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2178.12 26.78428 2 1048.532847 1048.533529 R V 158 168 PSM YLGGTDDLTK 2995 sp|Q8VCT4|CES1D_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2249.17 28.78977 2 1081.530447 1081.529155 K K 401 411 PSM LIIVEGCQR 2996 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4 ms_run[1]:scan=1.1.2314.14 30.59677 2 1086.586247 1086.585565 K Q 689 698 PSM FNSSISYDR 2997 sp|Q91YI0|ARLY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2191.14 27.14113 2 1087.493647 1087.493438 K H 24 33 PSM AIAEELAPER 2998 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2305.12 30.3504 2 1097.573047 1097.571688 R G 309 319 PSM WLNENAVEK 2999 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2245.17 28.67505 2 1101.546047 1101.545474 K V 310 319 PSM IQRPPEDSIQPYEK 3000 sp|Q91ZJ5|UGPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2206.16 27.56195 3 1698.859871 1698.857700 K I 78 92 PSM YHTEIVFAR 3001 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2273.18 29.47662 2 1134.577447 1134.582194 R T 684 693 PSM VMIGESIDEK 3002 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:35 ms_run[1]:scan=1.1.2197.18 27.313 2 1135.542047 1135.543091 K R 1282 1292 PSM YATALYSAASK 3003 sp|Q9DB20|ATPO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2223.16 28.0471 2 1144.577447 1144.576440 R E 41 52 PSM YATALYSAASK 3004 sp|Q9DB20|ATPO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2221.17 27.99035 2 1144.577447 1144.576440 R E 41 52 PSM IASGRPYNPSMSRPDAWGVTK 3005 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 11-UNIMOD:35 ms_run[1]:scan=1.1.2263.20 29.19032 4 2305.1392 2305.1272 R G 357 378 PSM FVHDNYVIR 3006 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2154.3 26.11375 3 1161.594971 1161.593093 K R 1445 1454 PSM VVGDVAYDEAK 3007 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2137.20 25.6395 2 1164.565847 1164.566269 K E 252 263 PSM QHGIPIPVTPK 3008 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2287.3 29.84687 3 1185.688871 1185.686993 K S 166 177 PSM EAAENSLVAYK 3009 sp|P62259|1433E_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2250.14 28.81597 2 1193.592047 1193.592818 K A 143 154 PSM RFQINTYVR 3010 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2311.17 30.51588 2 1195.646647 1195.646191 K K 382 391 PSM GIIDSTVSEQR 3011 sp|G5E829|AT2B1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2312.18 30.54433 2 1203.611247 1203.609531 K Q 779 790 PSM EELGAQQPDLK 3012 sp|Q64105|SPRE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2197.20 27.31468 2 1226.611847 1226.614282 K V 53 64 PSM DHGGALGPEEFK 3013 sp|P57780|ACTN4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2202.16 27.44968 2 1255.582447 1255.583316 K A 781 793 PSM AVAGNISDPGLQK 3014 sp|Q64727|VINC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2209.20 27.6492 2 1268.661047 1268.672465 K S 803 816 PSM EDQTEYLEER 3015 sp|P07901|HS90A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2243.20 28.62035 2 1310.563847 1310.562640 K R 192 202 PSM NDIGATVHELSR 3016 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2291.19 29.96917 2 1310.658447 1310.657878 R D 100 112 PSM SSDPTAVVDAQTK 3017 sp|Q8BJ64|CHDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2146.19 25.89945 2 1317.643447 1317.641225 R V 523 536 PSM INVYYNEATGGK 3018 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2312.19 30.54517 2 1327.640447 1327.640831 R Y 47 59 PSM LSMTNDPLEAAR 3019 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:35 ms_run[1]:scan=1.1.2298.20 30.16652 2 1332.635047 1332.634366 K G 244 256 PSM VLIGGDETPEGQK 3020 sp|O70475|UGDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2211.21 27.70627 2 1341.678847 1341.677610 R A 178 191 PSM ALGQNPTNAEVLK 3021 sp|Q60605|MYL6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2298.21 30.16735 2 1353.725247 1353.725229 R V 38 51 PSM IQTQPGYANTLR 3022 sp|Q8VEM8|MPCP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2232.21 28.30955 2 1360.710047 1360.709913 R E 185 197 PSM ENYGELADCCTK 3023 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2225.21 28.10893 2 1458.575647 1458.575530 R Q 106 118 PSM YNPNVLPVQCTGKR 3024 sp|P14094|AT1B1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.2245.15 28.67338 3 1644.844871 1644.840610 K D 205 219 PSM ALSQHPTVNDDLPNR 3025 sp|P97872|FMO5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2142.17 25.78198 3 1675.831271 1675.827797 R I 278 293 PSM LGREEATMEDIVQAAK 3026 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:35 ms_run[1]:scan=1.1.2244.16 28.64555 3 1775.883671 1775.872364 R D 518 534 PSM SQLSHLSHEPPLAIGDHK 3027 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2203.19 27.48007 3 1965.009971 1965.006824 K S 703 721 PSM ILVTHTLHVLPQADR 3028 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2427.4 33.73635 4 1711.983694 1711.973339 R I 806 821 PSM TAALPTFR 3029 sp|Q8BHG3|CC50B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2435.3 33.95761 2 875.486247 875.486502 R K 256 264 PSM AAVSGLWGK 3030 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2432.7 33.87828 2 887.488447 887.486502 K V 10 19 PSM LVIITAGAR 3031 sp|P00342|LDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2414.7 33.38817 2 912.576847 912.575652 K M 91 100 PSM AIGTLIVTK 3032 sp|Q9JLF6|TGM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2446.7 34.27177 2 914.579847 914.580068 K A 521 530 PSM AIILNTPHNPLGK 3033 sp|Q71RI9|KAT3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2528.3 36.57504 3 1386.801371 1386.798334 K V 211 224 PSM VFIEDVSK 3034 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2363.10 31.95775 2 935.496847 935.496398 K E 59 67 PSM DISLSEYK 3035 sp|P35700|PRDX1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2481.13 35.27013 2 953.470647 953.470577 K G 28 36 PSM GTVLQEAKL 3036 sp|Q61009|SCRB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2441.7 34.12971 2 957.548847 957.549496 K - 501 510 PSM AFEVELEK 3037 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2505.7 35.9532 2 963.491447 963.491313 K S 962 970 PSM VNIHGGAVSLGHPIGMSGAR 3038 sp|Q8QZT1|THIL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2372.8 32.2122 4 1929.010094 1929.000299 K I 371 391 PSM HVFGESDELIGQK 3039 sp|P17751|TPIS_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2388.4 32.66198 3 1457.717471 1457.715058 R V 151 164 PSM VLSIGDGIAR 3040 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2546.10 37.08762 2 999.571047 999.571295 R V 74 84 PSM IGYPAPNFK 3041 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2494.12 35.64285 2 1005.529447 1005.528367 K A 8 17 PSM GATYAFTGSHYWR 3042 sp|Q91X72|HEMO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2531.8 36.6607 3 1515.688571 1515.689512 R L 270 283 PSM ATDFVVPGPGK 3043 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2462.10 34.72685 2 1086.572647 1086.570960 R V 141 152 PSM VPAIYGVDTR 3044 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2486.9 35.41022 2 1089.583447 1089.581859 K M 158 168 PSM QNLIAEVSTK 3045 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2426.14 33.71733 2 1101.604047 1101.602989 K D 198 208 PSM QNLIAEVSTK 3046 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2412.13 33.33755 2 1101.604047 1101.602989 K D 198 208 PSM AVGWNEVEGR 3047 sp|P61458|PHS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2357.15 31.79285 2 1115.537247 1115.535972 R D 22 32 PSM STLTDSLVCK 3048 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2413.15 33.367 2 1122.559247 1122.559075 K A 33 43 PSM DVDGLTSVSAGK 3049 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2355.12 31.73348 2 1147.569247 1147.572082 K L 123 135 PSM YISVGYVDNK 3050 sp|P01897|HA1L_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2380.18 32.44868 2 1156.575447 1156.576440 R E 46 56 PSM SWNALAAPSEK 3051 sp|P28271|ACOC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2435.16 33.96847 2 1172.583647 1172.582588 K L 622 633 PSM VVHSYEELEENYTR 3052 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2445.17 34.25173 3 1766.814671 1766.811144 R A 206 220 PSM ASSIVVSGTPIR 3053 sp|P35505|FAAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2408.16 33.23001 2 1185.673847 1185.671737 R R 163 175 PSM ASVGFGGSCFQK 3054 sp|O70475|UGDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2373.19 32.24972 2 1243.566247 1243.565558 K D 268 280 PSM LNIPVNQVNPR 3055 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2513.18 36.18158 2 1262.708047 1262.709519 R D 648 659 PSM LNIPVNQVNPR 3056 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2527.11 36.5547 2 1262.708047 1262.709519 R D 648 659 PSM VLSSMTDAVLAR 3057 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35 ms_run[1]:scan=1.1.2349.18 31.57367 2 1277.665047 1277.664937 R V 130 142 PSM ALIAAQYSGAQVR 3058 sp|Q9D8N0|EF1G_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2461.17 34.70487 2 1346.728847 1346.730649 K V 18 31 PSM ALIAAQYSGAQVR 3059 sp|Q9D8N0|EF1G_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2455.17 34.53493 2 1346.728847 1346.730649 K V 18 31 PSM GYDVIAQAQSGTGK 3060 sp|P10630|IF4A2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2361.19 31.90915 2 1393.685447 1393.683758 K T 70 84 PSM ENTIYLQVQTGK 3061 sp|O08966|S22A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2537.19 36.8393 2 1392.722447 1392.724895 K S 541 553 PSM IAATILTSPDLRK 3062 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2520.7 36.3626 3 1397.826971 1397.824215 R Q 326 339 PSM TYIIGELHPDDR 3063 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2528.6 36.57753 3 1427.705771 1427.704494 K S 78 90 PSM TYIIGELHPDDR 3064 sp|P56395|CYB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2535.7 36.77202 3 1427.705771 1427.704494 K S 78 90 PSM GTFASLSELHCDK 3065 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.2440.6 34.10032 3 1463.677271 1463.671479 K L 84 97 PSM FAQLCEEHGILR 3066 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.2445.11 34.24672 3 1471.727471 1471.724183 R E 153 165 PSM HGSIIYHPSLLPR 3067 sp|Q8K009|AL1L2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2372.18 32.22053 2 1488.821447 1488.820132 K H 122 135 PSM TDPTTLTDDEINR 3068 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2460.21 34.68028 2 1489.694247 1489.689631 K F 505 518 PSM FLEEHPGGEEVLR 3069 sp|P56395|CYB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2382.10 32.49855 3 1510.747271 1510.741607 K E 40 53 PSM YETNVGIQGSQLSR 3070 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2402.21 33.06878 2 1550.772047 1550.768885 K G 1208 1222 PSM TKPYIQVDIGGGQTK 3071 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2362.11 31.93048 3 1603.862471 1603.856972 K T 125 140 PSM GHEVVVIAPEASIHIK 3072 sp|Q63886|UD11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2524.6 36.47227 3 1697.949371 1697.946455 K E 56 72 PSM SVTGQTVLITGAGHGIGR 3073 sp|Q8VCR2|DHB13_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2493.16 35.6178 3 1722.937271 1722.937682 K L 33 51 PSM INGEWHTIILASDKR 3074 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2513.12 36.17658 3 1751.936471 1751.931868 K E 34 49 PSM SLNPELGTDADKEQWK 3075 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2453.19 34.47888 3 1829.885771 1829.879558 K E 213 229 PSM IVYGHLDDPANQEIER 3076 sp|Q99KI0|ACON_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2469.19 34.93117 3 1867.914071 1867.906441 K G 69 85 PSM HGSWGSGLDMHTKPWIR 3077 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2496.17 35.70378 3 1963.955771 1963.947535 K A 328 345 PSM FCETTIGCKDPAQGQLLK 3078 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.2515.12 36.23147 3 2065.005671 2064.997247 K D 161 179 PSM LLEAHEEQNVDSYTEAVK 3079 sp|Q9DB05|SNAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2483.20 35.33307 3 2073.998171 2073.985479 K E 247 265 PSM KTVVVNCNPETVSTDFDECDK 3080 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4,19-UNIMOD:4 ms_run[1]:scan=1.1.2543.20 37.01118 3 2456.087771 2456.083556 K L 1009 1030 PSM GAIFGGFK 3081 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2578.2 37.98412 2 795.427047 795.427925 K S 317 325 PSM HFSVEGQLEFR 3082 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2609.4 38.86193 3 1347.660371 1347.657149 K A 329 340 PSM SLMDEVVK 3083 sp|P09411|PGK1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2593.7 38.40059 2 919.469447 919.468469 K A 354 362 PSM ISDEDWDIIHR 3084 sp|P51660|DHB4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2718.2 41.97515 3 1397.661071 1397.657543 R V 111 122 PSM NIASMVRPGGLLVIDHR 3085 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35 ms_run[1]:scan=1.1.2609.6 38.8636 4 1863.013694 1863.014886 K N 160 177 PSM SGDIGGLWR 3086 sp|P97872|FMO5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2640.7 39.7618 2 959.482847 959.482479 R F 35 44 PSM IGLFGGAGVGK 3087 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2681.3 40.9286 2 974.556247 974.554916 K T 202 213 PSM VFVVGVGMTK 3088 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2689.9 41.15635 2 1035.579047 1035.578688 R F 14 24 PSM VAIIEPGGFR 3089 sp|O88451|RDH7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2676.2 40.79368 2 1057.591447 1057.592030 K T 200 210 PSM HRPELPLAVQGVSLK 3090 sp|Q9R1S7|MRP6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2602.9 38.66292 3 1642.952771 1642.951875 R I 1269 1284 PSM QQLLIGAYAK 3091 sp|P80313|TCPH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2579.5 38.01695 2 1103.631247 1103.633895 K A 431 441 PSM DLMQTPNFR 3092 sp|P13707|GPDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2723.11 42.12517 2 1120.535647 1120.533529 K I 179 188 PSM HGGTIPVVPTAEFQDR 3093 sp|P26443|DHE3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2625.13 39.33216 3 1722.876071 1722.868933 K I 481 497 PSM GILLYGPPGTGK 3094 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2755.8 43.03693 2 1171.660647 1171.660110 R T 240 252 PSM TLADAEGDVFR 3095 sp|Q9EQ20|MMSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2647.15 39.97085 2 1192.580447 1192.572417 K G 130 141 PSM TLADAEGDVFR 3096 sp|Q9EQ20|MMSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2641.14 39.79653 2 1192.580447 1192.572417 K G 130 141 PSM ALADPTVALPAR 3097 sp|Q9JIM1|S29A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 18 ms_run[1]:scan=1.1.2650.13 40.05577 2 1193.6694470956602 1193.67682190333 K S 62 74 PSM LVQAFQFTDK 3098 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2740.13 42.60723 2 1195.625247 1195.623724 R H 159 169 PSM LVQAFQFTDK 3099 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2720.13 42.0408 2 1195.625247 1195.623724 R H 159 169 PSM HIYLGLPAAVR 3100 sp|Q9QXZ6|SO1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2672.9 40.69053 2 1208.703847 1208.702977 R G 599 610 PSM IVEIPFNSTNK 3101 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2659.16 40.3188 2 1260.673047 1260.671403 K Y 477 488 PSM DLNESVSAFQR 3102 tr|Q9JHF5|Q9JHF5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2629.15 39.44965 2 1264.605247 1264.604780 R R 39 50 PSM NMVPQQALVIR 3103 sp|Q6PIC6|AT1A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2710.14 41.76345 2 1267.707847 1267.707077 K E 153 164 PSM GLQGSFEELCR 3104 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.2663.15 40.43443 2 1294.599847 1294.597586 R N 617 628 PSM DITTSVLTVNNK 3105 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2740.17 42.61057 2 1303.699847 1303.698346 K A 202 214 PSM AADTIGYPVMIR 3106 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:35 ms_run[1]:scan=1.1.2711.15 41.7921 2 1321.669847 1321.670023 K S 576 588 PSM GTPLDTEVPLER 3107 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2698.16 41.42093 2 1325.685247 1325.682696 K V 819 831 PSM YALYDATYETK 3108 sp|P18760|COF1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2557.17 37.4075 2 1336.617247 1336.618698 R E 82 93 PSM VIDPATATSVDLR 3109 sp|P80315|TCPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2689.17 41.16302 2 1356.725447 1356.724895 K D 194 207 PSM SCAVAEYGVYVR 3110 sp|Q61646|HPT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.2591.20 38.35447 2 1372.645247 1372.644536 K A 321 333 PSM TTGIVETHFTFK 3111 sp|B2RSH2|GNAI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2556.4 37.36777 3 1379.710871 1379.708516 K D 181 193 PSM GVSMEECVLCAK 3112 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2570.19 37.77291 2 1381.604447 1381.603994 R A 98 110 PSM LGPALATGNVVVMK 3113 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 13-UNIMOD:35 ms_run[1]:scan=1.1.2613.17 38.98822 2 1384.774847 1384.774822 K V 198 212 PSM KLDDFVETGDIR 3114 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2584.16 38.1601 2 1406.704247 1406.704159 R T 391 403 PSM PFETLLSQNQGGK 3115 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2630.19 39.48197 2 1417.720447 1417.720144 K A 129 142 PSM EACDTSFNVNLR 3116 sp|Q91X52|DCXR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.2594.19 38.43947 2 1424.632447 1424.635428 K A 98 110 PSM YLYIKLEEEVR 3117 sp|P14246|GTR2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2754.4 43.00453 3 1453.787471 1453.781681 R A 244 255 PSM RHPDYSVSLLLR 3118 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2558.8 37.42882 3 1454.802071 1454.799397 R L 361 373 PSM GILAADESVGTMGNR 3119 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2601.21 38.64395 2 1489.719047 1489.719492 K L 29 44 PSM FRHIYLGLPAAVR 3120 sp|Q9QXZ6|SO1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2625.7 39.32715 3 1511.874371 1511.872502 R G 597 610 PSM MAEESQNTVLTFR 3121 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2644.18 39.88677 2 1524.712847 1524.724243 R G 225 238 PSM EAYPGDVFYLHSR 3122 sp|Q03265|ATPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2734.8 42.43055 3 1552.734971 1552.731043 R L 335 348 PSM GDPTWVQSTIANER 3123 tr|Q8BGL3|Q8BGL3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2728.21 42.27297 2 1572.753247 1572.753235 K T 61 75 PSM RVIISAPSADAPMFVMGVNHEK 3124 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 16-UNIMOD:35 ms_run[1]:scan=1.1.2701.18 41.50967 3 2384.208971 2384.198072 K Y 116 138 PSM AKLDNNTELSFFAK 3125 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2731.8 42.34543 3 1596.819671 1596.814772 R A 344 358 PSM NAVTQEFGPVPDTAR 3126 sp|Q99KI0|ACON_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2649.21 40.03362 2 1600.785447 1600.784535 R Y 634 649 PSM GISCMNTTVSESPFK 3127 sp|Q9D819|IPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.2702.21 41.5411 2 1656.752047 1656.748743 K C 239 254 PSM ELGEHGLYEYTELK 3128 sp|O35945|AL1A7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2697.11 41.38805 3 1679.811971 1679.804267 R T 477 491 PSM ILIRPLYSNPPLNGAR 3129 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2754.14 43.01288 3 1793.035871 1793.031188 K I 310 326 PSM SQIFSTASDNQPTVTIK 3130 sp|P20029|BIP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2711.21 41.79712 2 1835.927647 1835.926508 K V 449 466 PSM LVQDVANNTNEEAGDGTTTATVLAR 3131 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2670.20 40.64183 3 2559.250571 2559.241253 K S 97 122 PSM VVYRPEHISFEELLK 3132 sp|Q9D6Y7|MSRA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2896.5 47.05552 4 1858.002894 1857.998885 R V 119 134 PSM KGDILTLLNSTNK 3133 sp|P16546|SPTN1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2767.4 43.38263 3 1415.801171 1415.798394 K D 990 1003 PSM FLFPEGIK 3134 sp|Q8K009|AL1L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2963.2 48.93648 2 949.525247 949.527304 R A 189 197 PSM YNLGLDLR 3135 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2823.3 44.94781 2 962.515847 962.518531 K T 528 536 PSM APMFSWPR 3136 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2922.4 47.79815 2 990.473447 990.474557 K L 1310 1318 PSM GRLQFWTETLPR 3137 sp|Q63880|EST3A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2866.5 46.18682 3 1502.802971 1502.799397 K K 542 554 PSM LVLCEVFK 3138 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.2921.3 47.7686 2 1006.552047 1006.552139 K Y 96 104 PSM EAFQLFDR 3139 sp|Q60605|MYL6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2879.5 46.56073 2 1024.496847 1024.497795 K T 14 22 PSM ANTIGISLIK 3140 sp|P13707|GPDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2762.5 43.23783 2 1028.623047 1028.622996 K G 111 121 PSM WASVVVPLGK 3141 tr|G3UXE9|G3UXE9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2868.6 46.2459 2 1054.616447 1054.617516 K E 297 307 PSM AASGLLSIGLR 3142 sp|Q8VCW8|ACSF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2925.6 47.88633 2 1056.627047 1056.629144 K K 112 123 PSM LNNLVLFDK 3143 sp|P62852|RS25_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2866.9 46.19015 2 1074.605447 1074.607346 K A 44 53 PSM ALQFLEQVK 3144 sp|P80317|TCPZ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2789.5 44.01245 2 1074.607847 1074.607346 K V 130 139 PSM ILMVGLDAAGK 3145 sp|P61205|ARF3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2806.6 44.48378 2 1086.610247 1086.610717 R T 20 31 PSM SEFPWEVPK 3146 sp|Q91X83|METK1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2951.6 48.60503 2 1117.544847 1117.544411 R K 384 393 PSM FNIIQPGPIK 3147 sp|Q9CQ62|DECR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2811.4 44.62397 2 1125.654247 1125.654630 R T 235 245 PSM GQFSTDELVAEVEKR 3148 sp|Q68FD5|CLH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2914.4 47.57018 3 1706.849471 1706.847529 R N 838 853 PSM KLNCQVIGASVDSHFCHLAWINTPK 3149 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.2909.6 47.42675 5 2894.451618 2894.431989 K K 68 93 PSM RSPSFADLFR 3150 sp|O08966|S22A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2864.9 46.13215 2 1194.616447 1194.614556 R T 331 341 PSM VFADYEAYVK 3151 sp|Q9ET01|PYGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2791.5 44.0649 2 1203.583047 1203.581191 K C 774 784 PSM TDLLLEPYNK 3152 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1000663, ProteinPilot, ] 18 ms_run[1]:scan=1.1.2761.11 43.2137 2 1204.6436470956603 1204.63395403184 K Y 290 300 PSM AITGIQAFTVGK 3153 sp|Q60759|GCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2834.9 45.26525 2 1204.682247 1204.681573 R - 427 439 PSM FGQAISLLPDR 3154 sp|Q8VBW8|TTC36_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2953.8 48.6621 2 1215.657047 1215.661172 K A 71 82 PSM SLGQWLQEEK 3155 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2765.12 43.3308 2 1216.609847 1216.608802 K V 148 158 PSM FLPGFEAPTYK 3156 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2934.10 48.14868 2 1268.642847 1268.644125 R D 156 167 PSM PMFIVNTNVPR 3157 sp|P34884|MIF_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.2841.10 45.46745 2 1286.6855 1286.6800 M A 2 13 PSM VIVDFSSPNIAK 3158 sp|Q9D0I9|SYRC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2804.13 44.43317 2 1288.703047 1288.702703 K E 194 206 PSM GFVPVAPICTDK 3159 sp|Q8VCR7|ABHEB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2786.9 43.93465 2 1302.665447 1302.664209 R I 130 142 PSM AADTIGYPVMIR 3160 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2878.15 46.53992 2 1305.677047 1305.675108 K S 576 588 PSM GIVNEQFLLQR 3161 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2952.12 48.63772 2 1315.725247 1315.724835 K L 558 569 PSM TSIAIDTIINQK 3162 sp|Q03265|ATPA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2876.17 46.48355 2 1315.735247 1315.734731 K R 219 231 PSM TQAALVLGSLEAR 3163 sp|Q91XD4|FTCD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2907.9 47.37133 2 1327.744847 1327.745965 K K 527 540 PSM TLTIVDTGIGMTK 3164 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2920.11 47.74657 2 1348.725247 1348.727203 R A 88 101 PSM QAQYEFEFAAR 3165 sp|O35632|HYAL2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2762.14 43.24535 2 1358.626047 1358.625515 K Q 174 185 PSM IQDTIEITGTFK 3166 sp|O35488|S27A2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2840.15 45.44287 2 1364.716847 1364.718747 R H 561 573 PSM YWLCAATGPSIK 3167 sp|P68040|RACK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.2847.17 45.64828 2 1365.680447 1365.675108 R I 246 258 PSM GYISPYFINTSK 3168 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2892.14 46.94623 2 1388.697047 1388.697617 R G 222 234 PSM DFTPVCTTELGR 3169 sp|O08709|PRDX6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.2772.16 43.53858 2 1394.652447 1394.650015 R A 42 54 PSM ISIYSNSIEAVAR 3170 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2806.18 44.4938 2 1421.749047 1421.751444 R S 225 238 PSM IPGGIIEDSCVLR 3171 sp|P80318|TCPG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.2901.18 47.2099 2 1427.745247 1427.744250 K G 204 217 PSM IYGVAVYTGMETK 3172 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2823.14 44.95698 2 1430.705047 1430.711553 K M 257 270 PSM FTQAGSEVSALLGR 3173 sp|P56480|ATPB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2961.14 48.8911 2 1434.744447 1434.746693 R I 311 325 PSM LTFSCLGGSDNFK 3174 sp|Q9R0Q7|TEBP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.2870.16 46.31213 2 1444.669247 1444.665666 K H 36 49 PSM GASIVEDKLVEDLK 3175 sp|P26443|DHE3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2761.4 43.20785 3 1514.823071 1514.819189 R T 77 91 PSM VVLAAADLGTEAGVQR 3176 sp|Q64105|SPRE_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2763.18 43.27768 2 1568.852247 1568.852221 K L 64 80 PSM QLLDLELQSQGESR 3177 sp|Q9DBE0|CSAD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2927.21 47.95655 2 1614.822447 1614.821314 K E 54 68 PSM VGVPSDPSANMGALISK 3178 sp|Q8BH00|AL8A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2923.21 47.84117 2 1641.838447 1641.839607 K A 316 333 PSM TGVLQGGPESEVEIVK 3179 sp|P53657|KPYR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2776.18 43.6554 2 1640.863247 1640.862117 R G 164 180 PSM VLNVGDIGGNETVTLR 3180 sp|Q9JLF6|TGM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2960.19 48.86712 2 1655.883447 1655.884249 K Q 737 753 PSM DEQIPDGMCIDAEGK 3181 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2792.14 44.10375 2 1676.700847 1676.702187 K L 199 214 PSM KGVLFGVPGAFTPGCSK 3182 sp|P99029|PRDX5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 15-UNIMOD:4 ms_run[1]:scan=1.1.2894.9 47.00045 3 1720.897571 1720.897063 K T 82 99 PSM IAKEEIFGPVQQIMK 3183 sp|O35945|AL1A7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2955.5 48.71517 3 1729.945571 1729.943678 R F 396 411 PSM TITLEVEPSDTIENVK 3184 tr|A0A0A6YW67|A0A0A6YW67_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2953.21 48.67295 2 1786.918047 1786.920025 K A 12 28 PSM GLGTEVPGNFQGPDPYR 3185 sp|Q91XE8|TM205_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2869.20 46.28662 2 1802.859647 1802.858763 R Q 125 142 PSM YQLQSQENFEPFMK 3186 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 13-UNIMOD:35 ms_run[1]:scan=1.1.2828.20 45.10145 2 1803.814247 1803.813787 K A 7 21 PSM EAFSLFDKDGDGTITTK 3187 sp|P0DP26|CALM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2829.11 45.12232 3 1843.891271 1843.883974 K E 15 32 PSM TCLLNETGDEPFQYKN 3188 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.2874.21 46.4297 2 1927.866247 1927.862193 R - 358 374 PSM SNNGLAVHIFLCNSSMENR 3189 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 12-UNIMOD:4 ms_run[1]:scan=1.1.2889.15 46.85963 3 2162.006471 2161.999707 K C 127 146 PSM AAVPSGASTGIYEALELRDNDK 3190 sp|P17182|ENOA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2956.19 48.7546 3 2276.132471 2276.128455 R T 33 55 PSM AGASIVGVNCHFDPSVSLQTVK 3191 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.2960.17 48.86545 3 2285.153771 2285.147417 K L 208 230 PSM VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK 3192 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 23-UNIMOD:35 ms_run[1]:scan=1.1.2819.8 44.84695 5 3756.891618 3756.862869 R V 1187 1223 PSM VVFIFGPDK 3193 sp|O08709|PRDX6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3005.4 50.12667 2 1020.563447 1020.564418 R K 133 142 PSM LILPGLISSR 3194 sp|P17563|SBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3119.5 53.38906 2 1067.668047 1067.670280 K I 94 104 PSM SPLVFVLCR 3195 sp|Q9CYS6|CB072_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.3096.4 52.72 2 1089.598647 1089.600486 R V 96 105 PSM SELDMLDIR 3196 sp|P14824|ANXA6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3012.5 50.3324 2 1090.530847 1090.532860 R E 282 291 PSM EIRPALELLEPIEQK 3197 sp|Q61598|GDIB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3129.6 53.68068 3 1776.999671 1776.998551 K F 365 380 PSM ISLNTLTLNVK 3198 sp|O08917|FLOT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3005.8 50.13002 2 1214.720647 1214.723438 R S 41 52 PSM ATGYPLAFIAAK 3199 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3065.10 51.829 2 1221.676047 1221.675760 K I 729 741 PSM ATGYPLAFIAAK 3200 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3069.6 51.93982 2 1221.676047 1221.675760 K I 729 741 PSM LSTIALALGVER 3201 sp|Q76MZ3|2AAA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3100.7 52.83905 2 1241.735247 1241.734337 K T 35 47 PSM VWQLYIGDTR 3202 sp|Q9QXF8|GNMT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3026.8 50.73797 2 1249.645047 1249.645522 R S 30 40 PSM TGIGSGLSLSGIVHPELSR 3203 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3077.7 52.17072 3 1879.019471 1879.016326 R S 514 533 PSM APLDIPVPDPVK 3204 sp|P97371|PSME1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3064.12 51.80245 2 1259.703247 1259.712539 K E 59 71 PSM IVLLDSSLEYK 3205 sp|P80318|TCPG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3010.11 50.27878 2 1278.704047 1278.707119 R K 238 249 PSM LQFWTETLPR 3206 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3145.11 54.14903 2 1289.681047 1289.676822 R K 544 554 PSM TLTIDAIQFQR 3207 sp|P52825|CPT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3005.11 50.13251 2 1304.705847 1304.708851 K G 440 451 PSM DVLSVAFSSDNR 3208 sp|P68040|RACK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2997.11 49.904 2 1308.631047 1308.630994 K Q 107 119 PSM LALIQLQVSSIK 3209 sp|Q9JHW2|NIT2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3171.7 54.8726 2 1311.813247 1311.812588 R S 6 18 PSM VFFTDYGQIPK 3210 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2996.12 49.8773 2 1313.666447 1313.665589 K V 338 349 PSM TVQDALSSVQESDIAVVAR 3211 sp|P33622|APOC3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3131.9 53.74138 3 1987.024871 1987.022199 K G 42 61 PSM LLSPGSVMLVSAR 3212 sp|Q64105|SPRE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3015.15 50.42867 2 1328.748447 1328.748607 R S 31 44 PSM AVDSLLNFETVK 3213 sp|Q9DC29|ABCB6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3092.14 52.61103 2 1334.706447 1334.708182 R Y 453 465 PSM GAAAVFNMSYFGK 3214 sp|Q99LB7|SARDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3119.13 53.39573 2 1361.643447 1361.643808 R F 567 580 PSM WTEYGLTFTEK 3215 sp|Q60932|VDAC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2974.12 49.2509 2 1373.650647 1373.650333 R W 77 88 PSM SLNNQFASFIDK 3216 tr|E9Q0F0|E9Q0F0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3000.15 49.99112 2 1382.682247 1382.683030 R V 111 123 PSM LDNNTELSFFAK 3217 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3022.15 50.63293 2 1397.682247 1397.682696 K A 346 358 PSM LDNNTELSFFAK 3218 sp|O88844|IDHC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3016.15 50.45793 2 1397.682247 1397.682696 K A 346 358 PSM LVVGNTEIGIEMK 3219 sp|Q00519|XDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2985.12 49.56473 2 1401.748447 1401.753752 K F 259 272 PSM LTSIDKWFLYK 3220 sp|Q8C196|CPSM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3076.3 52.13865 3 1412.771171 1412.770388 R M 870 881 PSM GGGSVVIVGSVAGFTR 3221 sp|Q99LB2|DHRS4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2968.15 49.08543 2 1461.788847 1461.793977 R F 161 177 PSM AKFEELNMDLFR 3222 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3051.2 51.4404 3 1511.748971 1511.744250 R S 326 338 PSM SQNVMAAASIANIVK 3223 sp|P11983|TCPA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3007.16 50.19508 2 1515.809247 1515.807913 R S 19 34 PSM VVLDDKDYFLFR 3224 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3117.2 53.32922 3 1528.795571 1528.792580 K D 81 93 PSM FWEVISDEHGIDPTGTYHGDSDLQLER 3225 sp|P68372|TBB4B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3159.6 54.53863 4 3115.434494 3115.415923 K I 20 47 PSM FSAPLPPQPWEGVR 3226 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3150.17 54.29993 2 1579.813047 1579.814713 R D 78 92 PSM VAASDWTFLHCLPR 3227 sp|P11725|OTC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.3097.5 52.75003 3 1671.822071 1671.819147 K K 293 307 PSM LSQTFPNADFAEITK 3228 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3057.2 51.60175 3 1680.839771 1680.835902 R L 243 258 PSM NLNQALLDLHALGSAR 3229 sp|P29391|FRIL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3093.4 52.63203 3 1704.926771 1704.927117 K T 106 122 PSM GYGCAGVSSVAYGLLTR 3230 sp|Q60759|GCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.3167.19 54.76822 2 1729.844647 1729.845755 K E 112 129 PSM LLGNMIVIVLGHHLGK 3231 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35 ms_run[1]:scan=1.1.2969.2 49.10252 4 1729.010094 1729.007282 R D 106 122 PSM TSACFEPSLDYMVTK 3232 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.3058.13 51.64219 2 1747.778047 1747.779709 K I 758 773 PSM EVGVYEALKDDSWLK 3233 sp|P14152|MDHC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3162.3 54.61353 3 1750.881971 1750.877767 K G 206 221 PSM MQLIMLCYNPDFEK 3234 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3115.21 53.2879 2 1832.819647 1832.814715 R Q 109 123 PSM TVTNAVVTVPAYFNDSQR 3235 sp|P63017|HSP7C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3031.7 50.87447 3 1981.000571 1980.990505 K Q 138 156 PSM LLQDSGAPDGTLNIIHGQHDAVNFICDHPDIK 3236 sp|Q9EQ20|MMSA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 26-UNIMOD:4 ms_run[1]:scan=1.1.3056.7 51.58312 5 3509.729118 3509.699767 K A 224 256 PSM AISQTPGCVLLDVDAGPSTNR 3237 sp|Q91XD4|FTCD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.3025.6 50.70887 3 2170.073771 2170.068832 R T 26 47 PSM QAGIAQLYGIAGSTNVTGDQVK 3238 sp|Q9QXD6|F16P1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3094.14 52.66958 3 2190.126971 2190.128061 R K 51 73 PSM GNDQVRFELTCYSLAPQIK 3239 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.3104.18 52.96528 3 2238.118571 2238.110303 K V 122 141 PSM GNDQVRFELTCYSLAPQIK 3240 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=1.1.3092.16 52.6127 3 2238.118571 2238.110303 K V 122 141 PSM GNLVSIENAQEQAFVTYHMR 3241 sp|Q61830|MRC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3063.16 51.7776 3 2306.115971 2306.111365 K D 981 1001 PSM LDNASAFQGAVISPHYDSLLVK 3242 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3167.13 54.7632 3 2344.212071 2344.206312 R V 407 429 PSM SVTELNGDTITNTMTLGDIVYKR 3243 sp|P12710|FABPL_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 14-UNIMOD:35 ms_run[1]:scan=1.1.3050.5 51.4252 3 2556.273971 2556.274134 K V 100 123 PSM AITVFSPDGHLFQVEYAQEAVK 3244 sp|Q9CWH6|PSMA8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3306.6 58.68088 3 2448.238871 2448.232526 R K 8 30 PSM YCTAISGDLHILPVAFK 3245 sp|Q01279|EGFR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4 ms_run[1]:scan=1.1.3255.14 57.23568 2 1903.972447 1903.986606 K G 361 378 PSM ASNTSEVYFDGVKVPSENVLGEVGDGFK 3246 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3383.8 60.84722 3 2943.435071 2943.413798 K V 305 333 PSM SSLLDVLAAR 3247 sp|Q7TMS5|ABCG2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3245.4 56.95112 2 1043.597447 1043.597509 K K 86 96 PSM VFGFSLITNK 3248 sp|P23492|PNPH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3175.3 54.98052 2 1124.624847 1124.622996 R V 235 245 PSM IFVWDWQR 3249 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3283.7 58.02275 2 1148.577647 1148.576714 R H 228 236 PSM LLVFSTDAGFHFAGDGK 3250 sp|P09055|ITB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3191.4 55.41405 3 1780.884971 1780.878435 R L 273 290 PSM GPLLVQDVVFTDEMAHFDRER 3251 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3294.6 58.3383 4 2473.218094 2473.205994 R I 48 69 PSM IPDQLVILDMK 3252 sp|Q9D1D4|TMEDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3251.5 57.12 2 1283.713647 1283.715910 R H 117 128 PSM VVDLMAYMASKE 3253 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3201.11 55.70612 2 1355.648847 1355.646510 R - 322 334 PSM VLQPTIFPVVPR 3254 sp|P41216|ACSL1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3208.9 55.90362 2 1364.819047 1364.818007 K L 358 370 PSM HMGPLNTWIGLTDQNGPWK 3255 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3291.13 58.25808 3 2164.060571 2164.052394 R W 203 222 PSM NFVDSPIIVDIPK 3256 sp|P17439|GLCM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3326.13 59.23415 2 1455.798647 1455.797331 R D 414 427 PSM EANLAAAFGKPINF 3257 sp|O08749|DLDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3315.9 58.91751 2 1461.752047 1461.761615 R - 496 510 PSM FYAYNPLAGGLLTGK 3258 sp|Q8CG76|ARK72_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3386.9 60.9227 2 1583.836447 1583.834780 R Y 230 245 PSM VEIEAIAVQGPFIKA 3259 sp|P52760|RIDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3333.14 59.43775 2 1583.891247 1583.892294 R - 121 136 PSM ILCGEGVDQLSLPLR 3260 sp|Q8BH00|AL8A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.3209.18 55.94015 2 1668.886847 1668.886892 R N 352 367 PSM NFINNPLAQADWAAK 3261 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3210.20 55.97104 2 1671.836847 1671.836905 K K 15 30 PSM SGEYSCIFLPEPVGR 3262 sp|P18572|BASI_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:4 ms_run[1]:scan=1.1.3189.16 55.36847 2 1709.809447 1709.808307 R S 198 213 PSM AHCLSEVEHDTMPADLPAIAADFVEDQEVCK 3263 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4,12-UNIMOD:35,30-UNIMOD:4 ms_run[1]:scan=1.1.3397.19 61.20187 4 3512.576094 3512.553422 K N 311 342 PSM YTPEQVAMATVTALHR 3264 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3206.4 55.84178 3 1786.909271 1786.903604 K T 244 260 PSM MQLIMLCYNPDFEK 3265 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35,7-UNIMOD:4 ms_run[1]:scan=1.1.3302.9 58.57397 2 1816.823447 1816.819800 R Q 109 123 PSM TDYDNFLMAHLINEK 3266 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3237.13 56.7404 2 1822.857647 1822.855985 K D 114 129 PSM TDYDNFLMAHLINEK 3267 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3249.3 57.0628 3 1822.865171 1822.855985 K D 114 129 PSM ILFIFIDSDHTDNQR 3268 sp|P09103|PDIA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3201.6 55.70193 3 1832.912471 1832.905713 K I 288 303 PSM LILADALCYAHTFNPK 3269 sp|Q9CPY7|AMPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.3273.8 57.73012 3 1845.948371 1845.944741 R V 369 385 PSM AVCMLSNTTAIAEAWAR 3270 sp|P05213|TBA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.3338.11 59.58105 2 1863.900447 1863.897139 R L 374 391 PSM AGEYSVTYDGFNTFTIPK 3271 sp|A2BIM8|MUP18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3337.15 59.55553 2 2008.945447 2008.941824 K T 96 114 PSM EAPFTHFDPSCLFPACR 3272 sp|P16015|CAH3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=1.1.3370.5 60.47283 3 2050.909871 2050.902953 K D 172 189 PSM VAFTGSTEVGHLIQVAAGSSNLK 3273 sp|P47738|ALDH2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3268.15 57.59083 3 2285.204771 2285.201561 K R 260 283 PSM TYSTINPTDGSVICQVSLAQVSDVDK 3274 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 14-UNIMOD:4 ms_run[1]:scan=1.1.3350.20 59.90933 3 2796.354671 2796.348755 K A 438 464 PSM ETEYDVRDHGDLAFVDVPNDSSFQIVK 3275 sp|Q61176|ARGI1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3216.16 56.14377 4 3094.468894 3094.451974 K N 42 69 PSM LGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLK 3276 sp|P06151|LDHA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:4 ms_run[1]:scan=1.1.3253.4 57.17362 5 3609.842618 3609.815071 R S 178 213 PSM GFLDVVAALR 3277 sp|Q63880|EST3A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3581.3 66.39073 2 1059.606647 1059.607680 R W 201 211 PSM FSVLVPLLAR 3278 sp|Q99P30|NUDT7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3461.3 62.95838 2 1113.689247 1113.691016 K G 40 50 PSM DLELLYPFK 3279 sp|Q9D379|HYEP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3572.3 66.15107 2 1136.610647 1136.611762 K E 278 287 PSM IWVLDYFGGPK 3280 sp|O88668|CREG1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3601.11 66.95892 2 1293.676047 1293.675760 R V 197 208 PSM DIEVQDFLIPK 3281 tr|L7N463|L7N463_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3544.10 65.3486 2 1315.705247 1315.702368 R G 384 395 PSM FFPLEAWQIGK 3282 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3507.4 64.28122 2 1334.701647 1334.702309 R K 100 111 PSM ELLMLENFIGGK 3283 sp|Q8BH00|AL8A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3603.11 67.01775 2 1362.724047 1362.721724 R F 6 18 PSM TWTAADMAALITK 3284 sp|P01901|HA1B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3417.12 61.77287 2 1391.710447 1391.711887 K H 153 166 PSM VINVNLIGTFNVIR 3285 sp|O08756|HCD2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3526.16 64.83027 2 1570.922647 1570.919512 R L 117 131 PSM AVTDEEPFLIFANR 3286 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3468.14 63.17092 2 1620.814847 1620.814772 K Y 3024 3038 PSM AFIITINSFGTELSK 3287 sp|P51863|VA0D1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3494.19 63.9384 2 1639.880247 1639.882124 R E 220 235 PSM ETVVEVPQVTWEDIGGLEDVKR 3288 sp|Q01853|TERA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3429.8 62.08085 3 2497.273871 2497.270034 R E 466 488 PSM YIVFVEGYPLTISGK 3289 sp|Q8VCW8|ACSF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3475.20 63.3807 2 1684.908447 1684.907610 R I 585 600 PSM LFCSLEGLFPASEAR 3290 sp|P13597|ICAM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:4 ms_run[1]:scan=1.1.3460.18 62.94316 2 1695.829047 1695.829043 K I 237 252 PSM DAFQNAYLELGGLGER 3291 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3535.7 65.08543 3 1751.854271 1751.847863 K V 536 552 PSM APFALQVNTLPLNFDK 3292 sp|Q61838|PZP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3556.17 65.70483 2 1786.964647 1786.961771 K A 1358 1374 PSM LGLDFPNLPYLIDGSHK 3293 sp|P10649|GSTM1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3587.9 66.56062 3 1898.004971 1897.993799 K I 53 70 PSM NLQDINTLEVAGDIQLTHVQT 3294 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3446.16 62.55202 3 2321.196371 2321.186304 K - 333 354 PSM FAELVYTGFWHSPECEFVR 3295 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 15-UNIMOD:4 ms_run[1]:scan=1.1.3428.11 62.05387 3 2373.095471 2373.088839 K H 317 336 PSM YNLTPTIFFCATPPDDGNLCR 3296 sp|Q64442|DHSO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4,20-UNIMOD:4 ms_run[1]:scan=1.1.3618.19 67.46515 3 2471.136371 2471.124967 R F 111 132 PSM SIFSAVLDELK 3297 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3708.5 70.00053 2 1220.667247 1220.665255 R V 1090 1101 PSM NALLPEGIPLLLK 3298 sp|O08601|MTP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3638.3 68.03622 2 1389.855447 1389.859538 K Y 479 492 PSM DHPDFPFWDEY 3299 sp|P70694|DHB5_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3657.9 68.55479 2 1466.578847 1466.577896 K - 313 324 PSM LMASLLPIQLFPK 3300 tr|Q8BGL3|Q8BGL3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:35 ms_run[1]:scan=1.1.3648.6 68.30417 2 1485.866647 1485.862909 R S 95 108 PSM QAPANLTGFLWSLR 3301 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3646.5 68.25124 2 1572.843647 1572.841262 K S 312 326 PSM DQVDSAVQELLQLK 3302 sp|Q8CGC7|SYEP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3718.13 70.29379 2 1584.830647 1584.835902 K A 926 940 PSM AFAISGPFNVQFLVK 3303 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3687.12 69.42429 2 1636.901047 1636.897714 K G 1233 1248 PSM TVPFCSTFAAFFTR 3304 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:4 ms_run[1]:scan=1.1.3704.10 69.90009 2 1650.791047 1650.786449 R A 382 396 PSM DAMLNAAFALAADISSK 3305 sp|O35459|ECH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3822.20 73.2102 2 1707.852647 1707.850172 K S 250 267 PSM EVVDSYLPVILDMIK 3306 sp|Q61207|SAP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3823.21 73.23898 2 1732.934247 1732.932110 K G 108 123 PSM AQLGVQAFADALLIIPK 3307 sp|P80317|TCPZ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3784.20 72.16358 2 1767.031447 1767.029457 R V 433 450 PSM TTSLELFMYLNEVAGK 3308 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:35 ms_run[1]:scan=1.1.3706.6 69.94662 2 1830.911047 1830.907353 R H 245 261 PSM GGENIYPAELEDFFLK 3309 sp|Q8VCW8|ACSF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3728.16 70.58978 2 1840.892247 1840.888331 R H 516 532 PSM TVMDDFAQFLDTCCK 3310 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 13-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3690.18 69.51794 2 1849.773647 1849.768493 K A 570 585 PSM TVMDDFAQFLDTCCK 3311 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 13-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3690.19 69.51877 2 1849.773647 1849.768493 K A 570 585 PSM EIFLSQPILLELEAPLK 3312 sp|P62137|PP1A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3790.3 72.33735 2 1952.125047 1952.123417 R I 44 61 PSM VAAFDLDGVLALPSIAGAFR 3313 sp|P34914|HYES_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3820.9 73.14598 3 2002.094771 2002.088763 R R 5 25 PSM FFPEDVSEELIQEITQR 3314 sp|P26043|RADI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3798.5 72.54369 3 2079.025271 2079.016051 K L 84 101 PSM IISLDASEALASLGVVDVVTAR 3315 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3789.19 72.30887 3 2198.221271 2198.215814 K D 624 646 PSM LNLPINIIGLAPLCENMPSGK 3316 sp|Q9CPY7|AMPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 14-UNIMOD:4 ms_run[1]:scan=1.1.3755.13 71.34621 3 2263.219571 2263.206846 K A 322 343 PSM VQDDEVGDGTTSVTVLAAELLR 3317 sp|P80314|TCPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3754.13 71.31686 3 2287.168271 2287.154336 R E 90 112 PSM LRDPAAAASELGYVFQAITLTR 3318 sp|P70697|DCUP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3727.11 70.55611 3 2362.265471 2362.264495 R Q 121 143 PSM ELGSPPGISLETIDAAFSCPGSSR 3319 sp|Q91X72|HEMO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 19-UNIMOD:4 ms_run[1]:scan=1.1.3689.12 69.4835 3 2447.173571 2447.163855 K L 346 370 PSM SNIGIVSQEPVLFDCSIMDNIK 3320 sp|Q9QY30|ABCBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 15-UNIMOD:4 ms_run[1]:scan=1.1.3677.13 69.13198 3 2478.225071 2478.213447 R Y 1154 1176 PSM SVASIGGNIITASPISDLNPVLMASR 3321 sp|Q00519|XDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3728.13 70.58728 3 2582.382971 2582.373788 K A 346 372 PSM VIHDNFGIVEGLMTTVHAITATQK 3322 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3672.15 68.99506 3 2594.359571 2594.352658 K T 161 185 PSM CLGLTEAQTR 3323 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3021.5 50.59553 2 1130.5371 1130.5385 K E 920 930 PSM GNDVLVIECNLR 3324 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=1.1.2873.16 46.39712 2 1400.708047 1400.708199 K A 1248 1260 PSM KIGFTGSTEVGK 3325 sp|Q8R0Y6|AL1L1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2020.6 22.32568 3 1222.656371 1222.655752 R H 645 657 PSM KADIGVAMGIVGSDVSK 3326 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 8-UNIMOD:35 ms_run[1]:scan=1.1.2421.7 33.57663 3 1661.869871 1661.865822 K Q 727 744 PSM CCSGSLVER 3327 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.2405.13 33.14552 2 1050.4272 1049.4262 K R 500 509 PSM CCSGSLVER 3328 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4 ms_run[1]:scan=1.1.2412.11 33.33588 2 1050.4272 1049.4262 K R 500 509 PSM CGPGYPTPLEAMK 3329 tr|A0A0R4J135|A0A0R4J135_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3287.11 58.1432 2 1403.6302 1402.6252 K G 8 21 PSM RIPGGPQMIQLSLDGK 3330 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2859.11 45.9894 3 1708.933271 1708.929425 K R 382 398 PSM INAQLVEAK 3331 sp|Q9QZW0|AT11C_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2134.11 25.54528 2 984.559847 984.560395 R M 611 620 PSM QGFIDLPEFPFGLEPR 3332 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:28 ms_run[1]:scan=1.1.3933.9 76.20098 2 1843.9156 1843.9140 K V 259 275 PSM CQYYAVSFSK 3333 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3111.10 53.16398 2 1234.5307 1234.5323 R E 448 458 PSM CQYYAVSFSK 3334 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3105.9 52.98722 2 1234.5307 1234.5323 R E 448 458 PSM MLQDVQMPSK 3335 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 1-UNIMOD:35 ms_run[1]:scan=1.1.2217.18 27.87597 2 1192.572247 1191.562780 R K 497 507 PSM SDSRDPASDQMK 3336 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.1871.21 18.14427 2 1377.5821 1377.5825 M Q 2 14 PSM ADVVESWIGEK 3337 sp|P08032|SPTA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2860.8 46.01565 2 1231.609647 1231.608468 K E 1933 1944 PSM KYFDQVDISNGLDWSLDHK 3338 sp|Q64374|RGN_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3114.12 53.25198 3 2279.093771 2279.085862 K I 145 164 PSM VDFPQDQLATLTGR 3339 sp|P08249|MDHM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3175.8 54.98886 2 1559.794847 1559.794371 K I 216 230 PSM ITGTNAEVMPAQWEFQIGPCEGIR 3340 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:35,20-UNIMOD:4 ms_run[1]:scan=1.1.3355.20 60.05187 3 2719.275671 2719.273422 K M 190 214 PSM CIEEAIDK 3341 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:4 ms_run[1]:scan=1.1.2026.14 22.50382 2 976.4551 976.4530 K L 269 277 PSM ADMVIEAVFEDLGVK 3342 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:35 ms_run[1]:scan=1.1.3745.13 71.06502 2 1650.816447 1650.817475 K H 441 456 PSM SQVFSTAADGQTQVEIK 3343 sp|P38647|GRP75_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2597.21 38.52803 2 1808.894447 1807.895208 K V 469 486 PSM FVVNFQNSFNGNDIAFHFNPR 3344 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3512.14 64.42302 3 2484.170171 2483.177077 R F 44 65 PSM CGGDIAFHLNPR 3345 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.2921.11 47.77528 2 1338.6115 1338.6134 R F 258 270 PSM HIDSASMYQNEK 3346 sp|P70694|DHB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1875.16 18.25352 3 1421.630171 1421.624529 R E 48 60 PSM AAVVLENGVLSR 3347 sp|P16331|PH4H_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.3493.11 63.90215 2 1268.7081 1268.7083 M K 2 14 PSM IGGHGAEYGAEALER 3348 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2227.16 28.1625 3 1528.742171 1528.727020 K M 18 33 PSM VADALANAAGHLDDLPGALSALSDLHAHK 3349 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3353.4 59.98053 5 2863.465118 2862.462420 K L 63 92 PSM VADALANAAGHLDDLPGALSALSDLHAHK 3350 tr|Q91VB8|Q91VB8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3352.12 59.9588 4 2863.462094 2862.462420 K L 63 92 PSM SKVDQVQDIVTGNPTVIK 3351 sp|Q3UQ44|IQGA2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.2675.7 40.7735 3 1941.0542 1940.0572 K M 949 967 PSM TAAVLLQNDPNPDVLSK 3352 sp|Q02357|ANK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2876.20 46.48605 2 1793.951047 1793.952329 R T 184 201 PSM SLSCQMAAFR 3353 sp|P34927|ASGR1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=1.1.2492.14 35.58782 2 1169.539447 1169.532149 R G 135 145 PSM YPIEHGIITNWDDMEK 3354 sp|P68033|ACTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.2878.16 46.54075 3 1959.9142 1959.9032 K I 71 87 PSM NGAPIIMSFPHFYQADEK 3355 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3464.14 63.05363 3 2064.966071 2063.977498 K F 331 349 PSM TRSDPVVIVSAAR 3356 tr|Q80X81|Q80X81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=1.1.2208.12 27.61465 3 1369.7674 1369.7672 N T 3 16 PSM IRQEEIEIEVVQR 3357 sp|Q60634|FLOT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2520.13 36.36762 3 1639.888271 1639.889334 K K 252 265 PSM SIAATDHEPTDARK 3358 sp|P16406|AMPE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.1680.21 12.76418 2 1511.740847 1510.737585 R S 208 222 PSM VDREQLVQK 3359 sp|P61982|1433G_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.2183.14 26.92213 2 1155.6218 1155.6243 M A 2 11 PSM ASGNAQIGK 3360 sp|Q61171|PRDX2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.1898.14 18.89747 2 886.4481 886.4503 M S 2 11 PSM ACQFPVSLLEECSGVTDANFGYSK 3361 sp|P97370|AT1B3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.3562.18 65.88113 3 2679.202571 2678.199254 R G 143 167 PSM CSGIASAAATAVEVAR 3362 sp|Q91X91|NADC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:385,1-UNIMOD:4 ms_run[1]:scan=1.1.3410.15 61.57253 2 1515.7363 1515.7346 R S 111 127 PSM IRVDILENQAMDTR 3363 sp|P15626|GSTM2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2734.11 42.43307 3 1673.850671 1672.856654 R I 95 109 PSM ADVAFHFNPR 3364 sp|Q9JL15|LEG8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2391.2 32.74348 3 1172.576771 1172.572691 R F 59 69 PSM AAQESLHVK 3365 sp|Q8VBT2|SDHL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.2046.14 23.06448 2 1023.5317 1023.5344 M T 2 11 PSM SQAEFDK 3366 sp|P31786|ACBP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.2112.8 24.91 2 865.3827 865.3812 M A 2 9 PSM QFYDQALQQAVMDDDANNAK 3367 sp|P35762|CD81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:28 ms_run[1]:scan=1.1.3612.14 67.28488 3 2266.9841 2266.9796 K A 125 145 PSM MDNLSPEEVQLR 3368 sp|O09044|SNP23_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.3272.10 57.7026 2 1471.6960 1471.6972 - A 1 13 PSM GITINAAHVEYSTAAR 3369 sp|Q8BFR5|EFTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2427.14 33.7447 3 1672.860071 1672.853283 R H 105 121 PSM AYHSFLVEPISCHAWNK 3370 sp|Q9WV32|ARC1B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1,12-UNIMOD:4 ms_run[1]:scan=1.1.3079.13 52.23314 3 2099.9992 2099.9882 M D 2 19 PSM ERPDLPPIQYEPVLCSR 3371 sp|Q01405|SC23A_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 15-UNIMOD:4 ms_run[1]:scan=1.1.2961.12 48.88943 3 2069.050871 2068.041161 K T 47 64 PSM SLNDKFASFIDK 3372 sp|P04104|K2C1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3000.15 49.99112 2 1383.690647 1383.703431 K V 194 206 PSM SAGGAVPPPPNPAVSFPAPR 3373 sp|Q8BI08|MAL2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=1.1.3283.11 58.0261 3 1926.9968 1926.9947 M V 2 22 PSM DVQIGDIVTVGECRPLSK 3374 sp|P62281|RS11_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 13-UNIMOD:4 ms_run[1]:scan=1.1.3025.2 50.70552 3 1984.017371 1985.025176 R T 119 137 PSM VLEFIAVSQLR 3375 sp|Q8CGK3|LONM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3231.4 56.56557 2 1273.727047 1273.739423 R G 490 501 PSM TAVTAAGTPCQGWAAQEPHR 3376 sp|P20918|PLMN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=1.1.2328.15 30.9986 3 2106.985871 2107.985771 K H 493 513 PSM LDAAGGLQSLR 3377 sp|Q9DCQ2|ASPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2534.15 36.75022 2 1100.591847 1099.598572 R V 141 152 PSM KVITAFNDGLNHLDSLK 3378 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.2818.5 44.81498 3 1884.998171 1884.010512 K G 67 84 PSM VITAFNDGLNHLDSLK 3379 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=1.1.3061.7 51.71427 3 1756.903571 1755.915549 K G 68 84 PSM TIFPLFMKSPR 3380 sp|Q9CWL8|CTBL1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:35 ms_run[1]:scan=1.1.3231.7 56.56807 2 1350.735247 1351.732229 R K 381 392 PSM GGLDNAR 3381 sp|P15105|GLNA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1608.7 10.74073 2 701.342447 701.345652 K R 292 299 PSM GPAALRK 3382 sp|Q61176|ARGI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1573.8 9.775283 2 711.435847 711.439158 K A 27 34 PSM FIDEHATKR 3383 sp|P08003|PDIA4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1649.5 11.88757 3 1115.571371 1115.572357 K S 623 632 PSM TRTLDCEPK 3384 sp|P15105|GLNA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:4 ms_run[1]:scan=1.1.1670.9 12.47935 3 1118.536271 1118.539008 K C 44 53 PSM SKDSVPK 3385 sp|P00329|ADH1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1542.9 8.921233 2 759.409047 759.412669 K L 325 332 PSM EAHKSEIAHR 3386 sp|P07724|ALBU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1537.8 8.781116 3 1176.600671 1176.599969 R Y 25 35 PSM ILQSTAGK 3387 sp|Q9WVL0|MAAI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1666.12 12.37223 2 816.464847 816.470518 K Y 145 153 PSM SSDFTDR 3388 sp|Q02013|AQP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1727.13 14.0616 2 826.343047 826.345711 R M 235 242 PSM QASEGPLK 3389 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1688.10 12.96972 2 828.430847 828.434132 K G 262 270 PSM MVQEAEK 3390 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1601.6 10.56088 2 833.393247 833.395304 R Y 518 525 PSM KISAYMK 3391 sp|O35660|GSTM6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1737.14 14.3405 2 839.454047 839.457510 R T 193 200 PSM HGDDLRR 3392 sp|P11679|K2C8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1543.15 8.9534 2 867.430847 867.431113 K T 302 309 PSM LQGPQTAR 3393 sp|P13707|GPDA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1700.14 13.30497 2 869.469247 869.471915 K E 297 305 PSM MAHWSNK 3394 sp|P10649|GSTM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1651.15 11.95238 2 872.394847 872.396307 K - 212 219 PSM DMDELKK 3395 sp|Q8VDN2|AT1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1743.17 14.51082 2 877.420047 877.421519 R E 31 38 PSM NTVHVLAK 3396 sp|P25688|URIC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1688.12 12.97138 2 880.510047 880.513051 K L 73 81 PSM LTGLDAGHSATRK 3397 sp|P58735|S26A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1708.16 13.53055 3 1325.701271 1325.705162 R D 566 579 PSM TGTLTQNR 3398 sp|Q64436|ATP4A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1632.15 11.4154 2 889.460247 889.461744 K M 387 395 PSM HHLDGETEEER 3399 sp|P10649|GSTM1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1596.16 10.42172 3 1350.579971 1350.580021 K I 84 95 PSM AVDQTIEK 3400 sp|O35114|SCRB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1739.14 14.39757 2 902.470047 902.470912 K N 32 40 PSM CDVDIRK 3401 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 1-UNIMOD:4 ms_run[1]:scan=1.1.1698.13 13.24802 2 904.442047 904.443651 K D 285 292 PSM STMKPVQK 3402 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1552.14 9.200784 2 917.498047 917.500438 R V 338 346 PSM RGSVSLGNK 3403 sp|Q64442|DHSO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1618.19 11.02873 2 916.507447 916.509029 R V 167 176 PSM KAEAQIAAK 3404 sp|P05202|AATM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1582.17 10.03278 2 928.531047 928.534181 R N 82 91 PSM ATQEAFMK 3405 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:35 ms_run[1]:scan=1.1.1729.17 14.11937 2 940.428647 940.432418 K R 323 331 PSM AHVTHHPR 3406 tr|G3UZP7|G3UZP7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.1523.2 8.47505 2 953.4914 953.4939 K S 211 219 PSM LGECPRDK 3407 sp|Q9JJL3|SO1B2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:4 ms_run[1]:scan=1.1.1589.18 10.22865 2 973.461047 973.465115 R C 518 526 PSM AAQPLRSEK 3408 sp|Q9JJL3|SO1B2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1582.18 10.03362 2 998.547647 998.550893 K T 10 19 PSM KSSTPEEVK 3409 sp|P18760|COF1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.1551.15 9.174233 2 1003.5140 1003.5181 R K 22 31 PSM VVSETNDTR 3410 sp|P05784|K1C18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1603.16 10.61765 2 1019.481647 1019.488353 R V 411 420 PSM SDTSGHFER 3411 sp|Q07076|ANXA7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1631.17 11.38888 2 1034.440447 1034.441737 R L 288 297 PSM TQQHYYDK 3412 sp|Q9ET01|PYGL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1611.18 10.83177 2 1081.480847 1081.482873 R C 71 79 PSM DSVQIHDTTGK 3413 sp|Q8VCM7|FIBG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1740.20 14.43103 2 1199.573847 1199.578230 K D 166 177 PSM SGSDEVQAGQQR 3414 sp|P01027|CO3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1652.20 11.9847 2 1260.568847 1260.569457 K K 1571 1583 PSM ALVSSVR 3415 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1874.9 18.21962 2 730.432447 730.433738 K Q 213 220 PSM TSVNVVR 3416 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1792.8 15.8855 2 773.436047 773.439552 R H 683 690 PSM ASREEILAQAK 3417 sp|Q8VDD5|MYH9_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1912.12 19.2965 3 1214.656871 1214.661900 R E 1659 1670 PSM KGEHLSDAFAR 3418 sp|Q64471|GSTT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1883.10 18.47243 3 1229.615771 1229.615285 R V 37 48 PSM LLRENLK 3419 sp|P49429|HPPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.1796.13 16.00208 2 884.5423 884.5438 K S 298 305 PSM AGDEFVEK 3420 sp|Q61425|HCDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1892.10 18.725 2 893.412847 893.413063 K T 88 96 PSM DKPHVNVGTIGHVDHGK 3421 sp|Q8BFR5|EFTU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1845.12 17.39937 4 1808.930894 1808.928179 R T 54 71 PSM FLEQQNK 3422 tr|E9Q0F0|E9Q0F0_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1776.12 15.43915 2 906.455647 905.460681 R V 125 132 PSM VGEFSGANK 3423 sp|P10639|THIO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1787.15 15.7508 2 907.438847 907.439946 K E 86 95 PSM NSDYSVPK 3424 sp|Q9QZW0|AT11C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1880.14 18.39198 2 908.423047 908.423962 R F 844 852 PSM IIAPPERK 3425 sp|P60710|ACTB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1762.2 15.03252 3 922.559771 922.560002 K Y 329 337 PSM TDVGGSGLSR 3426 sp|Q9D7B6|ACAD8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1828.15 16.91587 2 947.462047 947.467223 R L 91 101 PSM VSNLPTVKK 3427 sp|P30115|GSTA3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1791.3 15.85292 3 984.597071 984.596781 R F 188 197 PSM VDVSPTSQR 3428 sp|Q99KI0|ACON_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1818.15 16.62885 2 987.497247 987.498523 R L 556 565 PSM LSKEDIER 3429 sp|P63017|HSP7C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1786.4 15.714 3 988.516271 988.518925 R M 510 518 PSM KLFGTPNQK 3430 sp|Q01279|EGFR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1824.19 16.8043 2 1031.575247 1031.576380 K T 479 488 PSM LLCGGGAAADR 3431 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 3-UNIMOD:4 ms_run[1]:scan=1.1.1896.19 18.8448 2 1059.513247 1059.513128 K G 386 397 PSM KFLQPGSQR 3432 sp|P13745|GSTA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1766.18 15.15833 2 1059.580247 1059.582528 K K 196 205 PSM VNIKPQVDR 3433 sp|P50247|SAHH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1854.20 17.6615 2 1067.606847 1067.608743 K Y 319 328 PSM TTTGSYIANR 3434 sp|Q60692|PSB6_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1885.18 18.5348 2 1082.537447 1082.535637 R V 53 63 PSM QLQQVGTVSK 3435 sp|Q922Q1|MARC2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1880.21 18.39782 2 1086.605647 1086.603323 R V 50 60 PSM VSVEPQDSHQDAQPR 3436 sp|Q8BXB6|SO2B1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1841.17 17.28923 3 1691.790371 1691.786326 K G 20 35 PSM LIENTDAACK 3437 sp|Q9DCM2|GSTK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 9-UNIMOD:4 ms_run[1]:scan=1.1.1857.20 17.74672 2 1133.538847 1133.538674 K Y 168 178 PSM LKETEYDVR 3438 sp|Q61176|ARGI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1873.19 18.19967 2 1151.582247 1151.582253 K D 40 49 PSM SGETTTAEEIK 3439 sp|Q8VCW8|ACSF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1832.21 17.03545 2 1164.549847 1164.551013 K A 560 571 PSM SGETTTAEEIK 3440 sp|Q8VCW8|ACSF2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1838.21 17.20682 2 1164.549847 1164.551013 K A 560 571 PSM DSYVGDEAQSK 3441 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1873.21 18.20133 2 1197.515047 1197.514961 K R 51 62 PSM NPVTNPTTQEK 3442 sp|Q9JJL3|SO1B2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1792.20 15.89552 2 1227.609047 1227.609531 K Q 301 312 PSM SHGQDYLVGNR 3443 sp|P10648|GSTA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1891.8 18.69525 3 1244.593571 1244.589798 K L 142 153 PSM VQEVQQVSTNK 3444 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1803.19 16.20523 2 1258.652647 1258.651730 R R 479 490 PSM DGASEEETNLSK 3445 sp|Q8VCT4|CES1D_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1906.21 19.1326 2 1278.558647 1278.557555 K M 481 493 PSM TCVADESAANCDK 3446 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:4,11-UNIMOD:4 ms_run[1]:scan=1.1.1792.21 15.89635 2 1439.564647 1439.565694 K S 76 89 PSM TFRPPYYHR 3447 sp|O09173|HGD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1991.2 21.50947 4 1235.622894 1235.619976 K N 328 337 PSM IHAALASLR 3448 sp|Q8VE09|TT39C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2069.3 23.70402 3 950.567171 950.566150 R E 567 576 PSM YHGNVTLLR 3449 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2058.3 23.3958 3 1071.588971 1071.582528 K A 2432 2441 PSM DGVDFGK 3450 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2043.3 22.97183 2 736.338647 736.339169 K W 141 148 PSM VLAAVYK 3451 tr|A6ZI46|A6ZI46_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2064.3 23.56565 2 762.463047 762.463976 K A 264 271 PSM SVDDVIK 3452 sp|P24549|AL1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2026.5 22.49632 2 774.411047 774.412334 K R 413 420 PSM SSGIVGIR 3453 sp|Q9DCP2|S38A3_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2085.7 24.15343 2 787.453047 787.455202 K A 119 127 PSM THEQLTPLVR 3454 sp|P09813|APOA2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2091.6 24.3224 3 1192.658771 1192.656421 K S 68 78 PSM VAQAPWK 3455 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2014.9 22.15898 2 798.436647 798.438824 K A 1101 1108 PSM KHTLSYVDIK 3456 sp|Q8K2B3|SDHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1969.8 20.88852 3 1202.665271 1202.665923 R T 624 634 PSM AGIFQSAK 3457 sp|Q9CPQ1|COX6C_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2012.10 22.1041 2 820.443447 820.444303 K - 69 77 PSM SDLLMPR 3458 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:35 ms_run[1]:scan=1.1.2117.11 25.05597 2 846.427047 846.426939 R G 115 122 PSM SDLLMPR 3459 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:35 ms_run[1]:scan=1.1.2129.11 25.40088 2 846.427047 846.426939 R G 115 122 PSM LGQSLVSR 3460 sp|Q9DCQ2|ASPD_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2022.11 22.38705 2 858.493247 858.492316 R L 21 29 PSM ALAPEYAK 3461 sp|P09103|PDIA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1958.7 20.57563 2 861.458447 861.459619 K A 60 68 PSM HSIFTPQTNPR 3462 sp|P20918|PLMN_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2029.8 22.58262 3 1296.657071 1296.657484 R A 513 524 PSM FLEEATR 3463 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2045.12 23.03502 2 864.434847 864.434132 R V 1151 1158 PSM LAVSQVPR 3464 sp|P40142|TKT_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2100.7 24.56903 2 868.512047 868.513051 R S 587 595 PSM YISGSSFK 3465 sp|P70694|DHB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2004.9 21.88073 2 887.437247 887.438883 R D 305 313 PSM FAQLCEK 3466 tr|A9R9W0|A9R9W0_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:4 ms_run[1]:scan=1.1.1974.11 21.03148 2 894.424447 894.426939 R H 152 159 PSM VLDSGAPIK 3467 sp|P56480|ATPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2059.12 23.43197 2 898.510447 898.512383 K I 125 134 PSM TIEEVVGR 3468 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2131.8 25.45612 2 901.486447 901.486896 K A 431 439 PSM TTTSAVMVHCLR 3469 sp|Q8VCT4|CES1D_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 10-UNIMOD:4 ms_run[1]:scan=1.1.2128.8 25.36952 3 1374.675371 1374.674790 K Q 275 287 PSM EQVLSVSR 3470 sp|P17047|LAMP2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2054.13 23.28938 2 916.497447 916.497795 K A 339 347 PSM ATQEAFMK 3471 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1957.11 20.5505 2 924.436247 924.437503 K R 323 331 PSM QLQQVIAK 3472 sp|E9PV24|FIBA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1981.11 21.23182 2 926.551647 926.554916 K E 204 212 PSM FLQPGSQR 3473 sp|P13745|GSTA1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1942.13 20.13765 2 931.486647 931.487565 K K 197 205 PSM LYEQLSGK 3474 sp|P70296|PEBP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2055.12 23.31725 2 936.490447 936.491647 K - 180 188 PSM AVVGVVAGGGR 3475 sp|P62918|RL8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2041.13 22.92418 2 940.545047 940.545414 R I 164 175 PSM ELSEIAQR 3476 sp|Q91Y97|ALDOB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2021.15 22.36182 2 944.491647 944.492710 K I 15 23 PSM ADGYVLEGK 3477 sp|P62242|RS8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2105.10 24.71168 2 950.467247 950.470912 R E 185 194 PSM AAATLMTER 3478 sp|P04919|B3AT_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2015.15 22.19207 2 962.484047 962.485516 R V 297 306 PSM AVEAFETAK 3479 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2029.15 22.58845 2 964.484447 964.486562 K K 331 340 PSM EQNLAQLR 3480 sp|Q8VCW8|ACSF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2084.11 24.12812 2 970.518847 970.519593 K Y 239 247 PSM ALELEQER 3481 sp|P26041|MOES_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2103.14 24.65862 2 986.502247 986.503275 R K 372 380 PSM SAINEVVTR 3482 sp|P62900|RL31_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2122.13 25.20142 2 987.533447 987.534909 R E 15 24 PSM QSDLDTLAK 3483 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2118.12 25.08548 2 989.502247 989.502940 K E 145 154 PSM SSQIGAVVSR 3484 sp|Q91XF0|PNPO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2037.14 22.812 2 1002.543647 1002.545808 K Q 164 174 PSM ESSSIYISK 3485 sp|O70475|UGDH_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2030.15 22.61638 2 1012.506447 1012.507691 R Y 347 356 PSM IAGNMGLAMK 3486 sp|P32020|NLTP_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 9-UNIMOD:35 ms_run[1]:scan=1.1.2074.16 23.85382 2 1020.513047 1020.509623 K L 525 535 PSM TAVCDIPPR 3487 sp|P68372|TBB4B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:4 ms_run[1]:scan=1.1.2128.15 25.37535 2 1027.509247 1027.512065 K G 351 360 PSM SVGEVMAIGR 3488 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:35 ms_run[1]:scan=1.1.2111.18 24.8896 2 1033.523447 1033.522630 K T 794 804 PSM NGRVEIIANDQGNR 3489 sp|P20029|BIP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1946.12 20.24683 3 1554.782171 1554.786266 K I 48 62 PSM NSVFQQGMK 3490 sp|Q6PIC6|AT1A3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2092.16 24.35802 2 1037.497847 1037.496415 R N 932 941 PSM HGGPADEERHVGDLGNVTAGK 3491 sp|P08228|SODC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2056.16 23.34922 4 2115.016494 2115.009343 K D 72 93 PSM LRDADPILR 3492 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2074.3 23.84297 3 1067.609171 1067.608743 R C 1318 1327 PSM SVEAAAELSAK 3493 sp|Q9D0J8|PTMS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2104.14 24.68677 2 1074.555047 1074.555704 K D 5 16 PSM AQYEDIANR 3494 tr|E9Q1Z0|E9Q1Z0_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2034.16 22.7296 2 1078.504447 1078.504337 K S 317 326 PSM VIEASEIQAK 3495 sp|P17563|SBP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2090.16 24.30332 2 1086.593047 1086.592090 K C 121 131 PSM VATRWDIQK 3496 sp|O35490|BHMT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.2047.5 23.08478 3 1115.6092 1115.6082 R Y 275 284 PSM SAAGEFADDPCSSVKR 3497 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 11-UNIMOD:4 ms_run[1]:scan=1.1.2119.17 25.11855 3 1695.757871 1695.752249 K G 106 122 PSM GIIDSTAGEQR 3498 sp|Q6Q477|AT2B4_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2094.14 24.41148 2 1145.562047 1145.567666 K Q 768 779 PSM QNGQWGPEER 3499 sp|O08573|LEG9_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1993.21 21.58092 2 1199.531447 1199.531949 K K 77 87 PSM HESFVSEVQAK 3500 sp|P08032|SPTA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2027.21 22.53778 2 1259.613447 1259.614616 K S 92 103 PSM TLNVKPLVTHR 3501 sp|Q64442|DHSO_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1994.9 21.59878 3 1276.762871 1276.761555 K F 315 326 PSM GAVHQLCQSLAGK 3502 sp|Q8BVI4|DHPR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2084.21 24.13647 2 1367.697447 1367.697969 K N 152 165 PSM AVTEQGAELSNEER 3503 sp|P68254|1433T_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2051.21 23.21037 2 1531.713447 1531.711430 K N 28 42 PSM EMSSLSSEGEVQNR 3504 sp|B2RX12|MRP3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2129.21 25.40922 2 1551.687847 1551.683500 R T 901 915 PSM RPQPEEGATYEGIQK 3505 sp|Q8R0Y6|AL1L1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.1991.20 21.52448 3 1701.835571 1701.832213 R K 191 206 PSM LFAEGDTPVPHAR 3506 sp|Q91X91|NADC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2306.14 30.38397 2 1408.712447 1408.709913 K R 285 298 PSM SLGLYGK 3507 sp|P19157|GSTP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2154.2 26.11292 2 736.411447 736.411940 R N 76 83 PSM ALGGVIMK 3508 sp|Q9JJL3|SO1B2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2263.3 29.17613 2 787.461447 787.462596 K S 40 48 PSM QHGIPIPVTPK 3509 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2273.2 29.46327 3 1185.688871 1185.686993 K S 166 177 PSM VQVSVFK 3510 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2275.5 29.52063 2 805.468447 805.469790 K G 349 356 PSM VKYETELAMR 3511 sp|P05784|K1C18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2187.9 27.02485 3 1238.634071 1238.632909 R Q 159 169 PSM SVDEIIR 3512 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2194.9 27.22112 2 830.446647 830.449782 R L 152 159 PSM RTIAQDYGVLK 3513 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2271.6 29.40895 3 1262.698571 1262.698286 K A 110 121 PSM FAEIIEK 3514 sp|Q9CPY7|AMPL_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2282.8 29.71383 2 848.463647 848.464370 R N 215 222 PSM LEGHGDPLHLEEVKR 3515 sp|P28230|CXB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2143.12 25.80673 4 1727.899694 1727.895482 R H 108 123 PSM LSPDAIPGK 3516 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2139.11 25.68992 2 896.492847 896.496733 K W 1576 1585 PSM TIEEVVGR 3517 sp|P47738|ALDH2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2137.12 25.63282 2 901.486447 901.486896 K A 431 439 PSM MFDVGGQR 3518 sp|B2RSH2|GNAI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2215.8 27.81 2 908.417447 908.417436 K S 198 206 PSM LVADFMAK 3519 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:35 ms_run[1]:scan=1.1.2222.8 28.01162 2 909.460247 909.462990 K K 332 340 PSM VAIEPGVPR 3520 sp|Q64442|DHSO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2263.8 29.18032 2 936.539247 936.539266 R E 92 101 PSM TGTVALEVR 3521 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2186.13 27.00055 2 944.528447 944.529095 K L 928 937 PSM IDPSAPLDK 3522 sp|P28474|ADHX_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2205.8 27.52718 2 954.498647 954.502212 K V 160 169 PSM VCLEQSLK 3523 sp|P70694|DHB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:4 ms_run[1]:scan=1.1.2189.13 27.08422 2 975.504047 975.505917 R Q 97 105 PSM GIVVYTGDR 3524 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2247.10 28.72657 2 978.514047 978.513445 R T 256 265 PSM LTAAVDELR 3525 sp|Q99MZ7|PECR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2329.3 31.01062 2 986.539247 986.539660 R A 55 64 PSM YTVGLGQTR 3526 sp|P54869|HMCS2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2169.15 26.538 2 993.523247 993.524344 K M 84 93 PSM LDVVPPSNR 3527 sp|P97792|CXAR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2199.12 27.36335 2 995.535447 995.539994 R A 227 236 PSM AHVYVEEVPWKR 3528 sp|P25688|URIC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2315.13 30.62443 3 1511.793671 1511.788498 R F 108 120 PSM SLHTLFGDK 3529 sp|P07724|ALBU_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2235.2 28.37855 3 1016.527871 1016.529095 K L 89 98 PSM HVLQQFADNDVSR 3530 sp|P51660|DHB4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2233.15 28.33272 3 1527.743771 1527.743004 R F 542 555 PSM LPQPVQVDPVTHCK 3531 sp|P09055|ITB1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 13-UNIMOD:4 ms_run[1]:scan=1.1.2333.14 31.12875 3 1616.839271 1616.834462 K E 679 693 PSM AFEEEQALR 3532 sp|P49429|HPPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2220.13 27.9582 2 1091.524447 1091.524738 K G 370 379 PSM AIAEELAPER 3533 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2294.16 30.04953 2 1097.573047 1097.571688 R G 309 319 PSM VTVVDVNEAR 3534 sp|O70475|UGDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2209.18 27.64753 2 1100.581447 1100.582588 R I 32 42 PSM VTVAGLAGKDPVQCSR 3535 sp|Q99LX0|PARK7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 14-UNIMOD:4 ms_run[1]:scan=1.1.2320.14 30.76938 3 1656.864071 1656.861740 K D 33 49 PSM EALLSSAVDHGSDEAR 3536 sp|P80314|TCPB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2279.12 29.6353 3 1655.778371 1655.775092 R F 139 155 PSM VEDDTLQGLK 3537 sp|P50544|ACADV_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2284.13 29.77265 2 1116.563447 1116.566269 K E 129 139 PSM LFAYPDTHR 3538 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2195.5 27.24592 3 1118.548571 1118.550893 R H 355 364 PSM KEYWQNLR 3539 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2186.6 26.99472 3 1135.578071 1135.577443 R I 349 357 PSM GSQVLVTVDPK 3540 sp|P53657|KPYR_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2327.15 30.9666 2 1141.633847 1141.634289 K F 180 191 PSM IPGEDAVLLKPRPK 3541 sp|B2RX12|MRP3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.2264.5 29.20662 4 1531.9096 1531.9081 K S 279 293 PSM QQLEVFMKK 3542 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2219.3 27.92098 3 1149.623771 1149.621616 R N 143 152 PSM VDATADYICK 3543 sp|Q91V92|ACLY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 9-UNIMOD:4 ms_run[1]:scan=1.1.2242.17 28.5894 2 1154.532647 1154.527775 K V 221 231 PSM SEAILTCDVR 3544 sp|P32507|NECT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2311.16 30.51505 2 1162.562247 1162.565223 R S 268 278 PSM LAAIQESGVER 3545 sp|Q60692|PSB6_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2164.18 26.3997 2 1171.621847 1171.619701 R Q 209 220 PSM VIATFACSGEK 3546 sp|Q9JLJ2|AL9A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2221.18 27.99118 2 1181.574847 1181.575060 R E 39 50 PSM GLETTATYDPK 3547 sp|Q9R0H0|ACOX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2155.19 26.1543 2 1194.577247 1194.576833 R T 149 160 PSM ATISNDGATILK 3548 sp|P80313|TCPH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2335.19 31.18878 2 1202.652047 1202.650667 K L 56 68 PSM FAAATGATPIAGR 3549 sp|P14206|RSSA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2272.14 29.44443 2 1202.640047 1202.640771 K F 90 103 PSM DLSSSDLSTASK 3550 sp|Q61838|PZP_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2190.17 27.11563 2 1209.574247 1209.572476 R I 1240 1252 PSM LFVSGACDASAK 3551 sp|P62874|GBB1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2210.20 27.67718 2 1224.579647 1224.580873 R L 198 210 PSM DQVANSAFVER 3552 sp|P07901|HS90A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2292.17 29.99502 2 1234.593047 1234.594215 K L 501 512 PSM GFGNIATNEDAK 3553 sp|Q8K0E8|FIBB_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2194.21 27.23113 2 1235.575247 1235.578230 K K 292 304 PSM TCAELVQEAAR 3554 sp|Q8VDK1|NIT1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:4 ms_run[1]:scan=1.1.2207.19 27.59243 2 1246.594447 1246.597586 K L 62 73 PSM TFVSGACDASIK 3555 sp|P62880|GBB2_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2267.20 29.3057 2 1254.590647 1254.591438 R L 198 210 PSM CLSCDLNPER 3556 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 1-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.2232.19 28.30788 2 1262.538447 1262.538357 K C 438 448 PSM RTIAQDYGVLK 3557 sp|P35700|PRDX1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2272.15 29.44527 2 1262.696847 1262.698286 K A 110 121 PSM ISVYYNEATGGK 3558 sp|P99024|TBB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2314.20 30.60178 2 1300.631047 1300.629932 R Y 47 59 PSM SEPIPESNEGPVK 3559 sp|P27773|PDIA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2153.20 26.10073 2 1381.675847 1381.672525 K V 367 380 PSM MCHPSVDGFTPR 3560 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 1-UNIMOD:35,2-UNIMOD:4 ms_run[1]:scan=1.1.2150.14 26.01047 3 1418.608871 1418.607105 R L 815 827 PSM EIYTMDSTTDIK 3561 sp|P11438|LAMP1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:35 ms_run[1]:scan=1.1.2253.21 28.90733 2 1431.645247 1431.643927 K A 129 141 PSM LFGGSFTHQASVAK 3562 sp|O89023|TPP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2307.7 30.39925 3 1448.744471 1448.741213 R V 245 259 PSM TRPTVAAGAVGLAQR 3563 sp|P45952|ACADM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2166.11 26.4498 3 1466.832371 1466.831760 R A 280 295 PSM IWHHTFYNELR 3564 sp|P60710|ACTB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2291.13 29.96417 3 1514.744471 1514.741882 K V 85 96 PSM IGGHGAEYGAEALER 3565 sp|P01942|HBA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2203.12 27.47423 3 1528.729571 1528.727020 K M 18 33 PSM ESNTELAEDCEIK 3566 sp|O08677|KNG1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 10-UNIMOD:4 ms_run[1]:scan=1.1.2228.21 28.1955 2 1536.662447 1536.661368 K H 330 343 PSM KYTAAQLHLHWGQR 3567 sp|Q9WVT6|CAH14_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2185.6 26.9673 4 1707.900494 1707.895757 R G 102 116 PSM YTTPEDATPEPGEDPR 3568 sp|Q6R0H7|GNAS1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2277.20 29.58757 2 1773.775047 1773.769338 R V 1057 1073 PSM KHLEINPDHPIVETLR 3569 sp|P11499|HS90B_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2333.19 31.13293 3 1910.042471 1910.037396 K Q 624 640 PSM GVFIVAAK 3570 sp|Q8BWT1|THIM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2383.2 32.5202 2 803.489447 803.490525 R R 6 14 PSM SERPPIFEIR 3571 sp|Q91ZX7|LRP1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2499.6 35.77987 3 1242.675971 1242.672071 R M 785 795 PSM SDLLMPR 3572 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2374.7 32.26817 2 830.431247 830.432024 R G 115 122 PSM SDLLMPR 3573 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2362.4 31.92463 2 830.431247 830.432024 R G 115 122 PSM SDLLMPR 3574 sp|P00329|ADH1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2368.5 32.09547 2 830.431247 830.432024 R G 115 122 PSM ALEVLVAK 3575 sp|Q9JII6|AK1A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2410.4 33.27487 2 841.527647 841.527304 K G 146 154 PSM DIQELVK 3576 sp|P11609|CD1D1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2423.2 33.62707 2 843.469247 843.470183 R M 98 105 PSM FLHGVIVAADSR 3577 sp|O55234|PSB5_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2401.6 33.02745 3 1283.701571 1283.698620 K A 67 79 PSM DGLILTSR 3578 sp|Q99LX0|PARK7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2475.8 35.09267 2 873.489847 873.491982 K G 149 157 PSM FGELALTK 3579 sp|Q8BMS1|ECHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2514.3 36.19605 2 877.489047 877.490919 K E 327 335 PSM ERFAQLCEEHGILR 3580 sp|A2BIM8|MUP18_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 7-UNIMOD:4 ms_run[1]:scan=1.1.2391.5 32.74598 4 1756.873294 1756.867888 K E 151 165 PSM FSVSPVVR 3581 sp|P58252|EF2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2410.5 33.2757 2 889.500647 889.502152 K V 499 507 PSM TFIAIKPDGVQR 3582 sp|P15532|NDKA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2400.5 32.99788 3 1343.761871 1343.756135 R G 7 19 PSM AHVYVEEVPWK 3583 sp|P25688|URIC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2531.6 36.65903 3 1355.690771 1355.687387 R R 108 119 PSM GQVYILGR 3584 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2411.6 33.3041 2 904.514047 904.513051 K E 356 364 PSM GQVYILGR 3585 sp|P16460|ASSY_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2404.3 33.10975 2 904.514047 904.513051 K E 356 364 PSM NLLSVAYK 3586 sp|O70456|1433S_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2544.6 37.0278 2 906.516847 906.517468 R N 42 50 PSM ELLEVVNK 3587 sp|Q91X83|METK1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2411.7 33.30493 2 942.539247 942.538597 R N 345 353 PSM QMALVLDR 3588 sp|Q8VC30|TKFC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2524.4 36.46893 2 944.507647 944.511337 K I 373 381 PSM GADSSIFPR 3589 sp|P98197|AT11A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2352.7 31.64603 2 948.465647 948.466495 K V 579 588 PSM DAQLFIQK 3590 sp|P24270|CATA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2484.7 35.35075 2 961.523647 961.523282 K K 469 477 PSM QTALAELVK 3591 sp|P07724|ALBU_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2528.7 36.57837 2 971.565047 971.565147 K H 550 559 PSM GEVGLLVCK 3592 sp|O35488|S27A2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 8-UNIMOD:4 ms_run[1]:scan=1.1.2414.10 33.39067 2 973.526847 973.526653 K I 420 429 PSM NDLMEYAK 3593 sp|P16460|ASSY_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2347.5 31.50892 2 982.440847 982.442982 R Q 158 166 PSM EQTAHAFVNVLTR 3594 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2528.8 36.5792 3 1484.775671 1484.773576 K G 1519 1532 PSM EFSVYMTK 3595 sp|P05202|AATM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2508.3 36.03712 2 1003.468647 1003.468469 K D 397 405 PSM RLVPGGGATEIELAK 3596 sp|P42932|TCPQ_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2433.10 33.90835 3 1509.852971 1509.851492 K Q 407 422 PSM EYWQNLR 3597 sp|O35490|BHMT1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2470.9 34.95097 2 1007.485047 1007.482479 K I 350 357 PSM EGMTAFVEK 3598 sp|Q8BH95|ECHM_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2346.5 31.48355 2 1010.476447 1010.474283 R R 274 283 PSM LLDAAGANLR 3599 sp|Q91Z53|GRHPR_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2360.6 31.87033 2 1012.565447 1012.566543 K V 67 77 PSM LISEVIGER 3600 sp|P13707|GPDA_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2464.9 34.78168 2 1014.570247 1014.570960 K L 131 140 PSM VLENSLVLK 3601 tr|A2CEK7|A2CEK7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2529.5 36.6037 2 1013.611447 1013.612097 R F 65 74 PSM STALQLIQR 3602 sp|Q9QY30|ABCBB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2534.13 36.74855 2 1028.596647 1028.597844 K F 462 471 PSM LLSNTVMPR 3603 sp|P26231|CTNA1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2361.13 31.90415 2 1029.563647 1029.564101 K F 578 587 PSM IVLQIDNAR 3604 sp|P05784|K1C18_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2465.11 34.81147 2 1040.598847 1040.597844 R L 143 152 PSM MNLSAIQDR 3605 sp|Q8VEH3|ARL8A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2358.16 31.82218 2 1046.516847 1046.517879 K E 147 156 PSM THINIVVIGHVDSGK 3606 sp|P10126|EF1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2388.9 32.66617 3 1587.879671 1587.873290 K S 6 21 PSM QGLSSSIFTK 3607 sp|Q9DBF1|AL7A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2509.7 36.06418 2 1066.565647 1066.565875 K D 453 463 PSM LAANAFLAQR 3608 sp|O70475|UGDH_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2545.9 37.05863 2 1073.597447 1073.598178 K I 221 231 PSM VLLPEYGGTK 3609 sp|Q64433|CH10_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2491.14 35.55922 2 1075.591447 1075.591361 K V 71 81 PSM VPAIYGVDTR 3610 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2498.10 35.75478 2 1089.583447 1089.581859 K M 158 168 PSM ALLEVVQSGGK 3611 sp|Q9Z2U0|PSA7_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=1.1.2504.14 35.93047 2 1099.6229 1099.6232 K N 194 205 PSM LFDSICNNK 3612 sp|B2RSH2|GNAI1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:4 ms_run[1]:scan=1.1.2351.18 31.62788 2 1109.518847 1109.517545 K W 249 258 PSM SDPVVIVSAAR 3613 tr|Q80X81|Q80X81_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2451.13 34.4169 2 1112.616847 1112.618973 R T 5 16 PSM LCAATATILDKPEDR 3614 sp|O35215|DOPD_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:4 ms_run[1]:scan=1.1.2397.12 32.9195 3 1672.853171 1672.845421 R V 23 38 PSM TKLPWDAVGR 3615 sp|P54869|HMCS2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2498.2 35.74812 3 1141.626671 1141.624393 R L 117 127 PSM YEELQTLAGK 3616 sp|P11679|K2C8_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2411.17 33.31327 2 1150.588647 1150.587004 K H 292 302 PSM TPVPSDIAISR 3617 sp|Q922D8|C1TC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2483.14 35.32805 2 1154.628447 1154.629538 K S 314 325 PSM SIYYITGESK 3618 sp|P11499|HS90B_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2415.5 33.41687 2 1159.577447 1159.576105 K E 482 492 PSM TSTADYAMFR 3619 sp|Q8VCM7|FIBG_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2525.6 36.50085 2 1161.505647 1161.512459 R V 282 292 PSM VVHSYEELEENYTR 3620 sp|Q05920|PYC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2438.14 34.05038 3 1766.814671 1766.811144 R A 206 220 PSM YSPEGVLYTR 3621 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2505.16 35.9607 2 1183.590447 1183.587339 K G 1218 1228 PSM YLSAQKPLLNDSQFR 3622 sp|P52825|CPT2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2538.18 36.86735 3 1778.937671 1778.931534 R K 64 79 PSM EWPANLDLKK 3623 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2520.3 36.35927 3 1212.650171 1212.650273 K E 832 842 PSM NAGVEGSLIVEK 3624 sp|P63038|CH60_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2387.15 32.64342 2 1214.651647 1214.650667 K I 482 494 PSM IMGTSPLQIDR 3625 sp|Q8C196|CPSM_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:35 ms_run[1]:scan=1.1.2414.18 33.39735 2 1245.641047 1245.638723 K A 1075 1086 PSM CQYYAVSFSK 3626 sp|P28843|DPP4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 1-UNIMOD:4 ms_run[1]:scan=1.1.2536.15 36.80732 2 1251.560447 1251.559410 R E 448 458 PSM FAHTNIESLVK 3627 sp|P27773|PDIA3_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2401.4 33.02578 3 1257.673571 1257.671737 R E 184 195 PSM LNIPVNQVNPR 3628 sp|Q8VDN2|AT1A1_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2513.19 36.18242 2 1262.708047 1262.709519 R D 648 659 PSM VLQATVVAVGSGGK 3629 sp|Q64433|CH10_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2397.17 32.92367 2 1284.740247 1284.740151 K G 41 55 PSM GHQLLSADVDIK 3630 sp|P46460|NSF_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2378.15 32.38903 2 1294.688447 1294.688115 R E 416 428 PSM VGDPQELNGITR 3631 sp|P19096|FAS_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2366.17 32.04853 2 1297.652447 1297.662629 K S 299 311 PSM VSLCGGGYCISK 3632 sp|O88451|RDH7_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.2454.16 34.5052 2 1299.596047 1299.595143 R Y 168 180 PSM ASLQELDLSSNK 3633 sp|Q91VI7|RINI_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2539.15 36.89373 2 1303.662247 1303.661960 K L 222 234 PSM VTQPEVDTPLGR 3634 sp|Q63880|EST3A_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2409.18 33.25903 2 1310.685847 1310.683030 K V 34 46 PSM IVEVNGVCMEGK 3635 sp|P70441|NHRF1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 8-UNIMOD:4 ms_run[1]:scan=1.1.2409.19 33.25986 2 1333.640447 1333.637008 R Q 194 206 PSM VTLEYRPVIDK 3636 sp|Q8K2B3|SDHA_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2431.19 33.86053 2 1331.747247 1331.744902 K T 637 648 PSM ACEQPLGYICK 3637 sp|Q61830|MRC1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 2-UNIMOD:4,10-UNIMOD:4 ms_run[1]:scan=1.1.2503.18 35.90505 2 1337.614047 1337.610793 R M 477 488 PSM VSVISVEEPPQR 3638 sp|Q9DCW4|ETFB_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2475.20 35.10268 2 1338.714647 1338.714330 K S 222 234 PSM AGEMTEVLPNQR 3639 sp|Q99J08|S14L2_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2381.20 32.47872 2 1343.651447 1343.650350 R Y 330 342 PSM SDFQVNLNNASR 3640 sp|P30999|CTND1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2476.19 35.13068 2 1363.648447 1363.648041 K S 847 859 PSM MMCLEEDASER 3641 sp|O08966|S22A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 3-UNIMOD:4 ms_run[1]:scan=1.1.2350.20 31.60242 2 1369.527847 1369.531222 K R 320 331 PSM QQNAFATVNAGMK 3642 sp|G3X982|AOXC_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2369.20 32.13665 2 1378.670847 1378.666334 R V 434 447 PSM VVDLMAYMASKE 3643 tr|A0A1D5RLD8|A0A1D5RLD8_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=1.1.2436.19 33.99862 2 1387.642047 1387.636340 R - 322 334 PSM LYLGHNYVTAIR 3644 sp|Q921I1|TRFE_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2546.9 37.08678 3 1418.769971 1418.767034 R N 332 344 PSM LQAFQGYQVTMK 3645 sp|P11725|OTC_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 11-UNIMOD:35 ms_run[1]:scan=1.1.2523.6 36.452 2 1428.707647 1428.707137 R T 278 290 PSM AIEINPDSAQPYK 3646 sp|Q99L47|F10A1_MOUSE 1 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2502.18 35.8763 2 1444.724047 1444.719809 R W 173 186 PSM GTFASLSELHCDK 3647 tr|A8DUK4|A8DUK4_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 11-UNIMOD:4 ms_run[1]:scan=1.1.2426.10 33.714 3 1463.677271 1463.671479 K L 84 97 PSM AQGSVALSVTQDPAR 3648 sp|Q78JT3|3HAO_MOUSE 0 userFasta.uniprot_mouse_20200318 userFasta.uniprot_mouse_20200318 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=1.1.2360.19 31.88117 2 1498.776247 1498.773970 R K 267 282 PSM AQGSVALSVTQDPAR 3649 sp|Q78JT3|3HAO_MOUSE 0