MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000115 -- main2
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20210709\20210709121707905487^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\20110305_MM_08__Fr.12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20210709\20210709121707905487^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\20110305_MM_08__Fr.12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20210204
MTD	software[1]-setting	enzymes=Trypsin
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=GG (K),GG (N-term),Gln->pyro-Glu (Q),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20210204
MTD	software[2]-setting	CLE=[RK]|{P}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),GG (K),GG (N-term),Gln->pyro-Glu (Q)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=500
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20210204
MTD	software[3]-setting	search_enzyme_number=1
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=GG (K),GG (N-term),Gln->pyro-Glu (Q),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:121, GG,]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:121, GG,]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:28, Gln->pyro-Glu,]
MTD	variable_mod[3]-site	Q
MTD	variable_mod[3]-position	Q
MTD	variable_mod[4]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[4]-site	M
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null		0.12	51.0	6	3	0
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	45.0	null	49-UNIMOD:4	0.07	45.0	7	3	0
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	45.0	null	239-UNIMOD:4,64-UNIMOD:35	0.16	45.0	11	3	1
PRT	sp|Q9H2J7-3|S6A15_HUMAN	Isoform 3 of Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	3	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	3	1	0
PRT	sp|Q9Y487|VPP2_HUMAN	V-type proton ATPase 116 kDa subunit a2 OS=Homo sapiens OX=9606 GN=ATP6V0A2 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	3	2	1
PRT	sp|Q02978-2|M2OM_HUMAN	Isoform 2 of Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	4	2	0
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0	null	171-UNIMOD:35	0.04	39.0	5	2	0
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	3	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|Q00325-2|MPCP_HUMAN	Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:35,135-UNIMOD:4,150-UNIMOD:35	0.09	38.0	9	2	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	null	251-UNIMOD:4	0.09	38.0	10	4	0
PRT	sp|Q9C0C7-6|AMRA1_HUMAN	Isoform 6 of Activating molecule in BECN1-regulated autophagy protein 1 OS=Homo sapiens OX=9606 GN=AMBRA1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	3	2	1
PRT	sp|Q8N8G2-2|VGLL2_HUMAN	Isoform 2 of Transcription cofactor vestigial-like protein 2 OS=Homo sapiens OX=9606 GN=VGLL2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	null	85-UNIMOD:4	0.15	37.0	6	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	null	349-UNIMOD:4	0.01	37.0	7	3	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	null	633-UNIMOD:4,560-UNIMOD:35,571-UNIMOD:4	0.07	37.0	13	4	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	37.0	null	249-UNIMOD:4	0.03	37.0	3	2	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null	581-UNIMOD:35,927-UNIMOD:35	0.09	36.0	17	7	1
PRT	sp|Q15008-3|PSMD6_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null	113-UNIMOD:35,149-UNIMOD:4,227-UNIMOD:4	0.23	36.0	13	6	2
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null	191-UNIMOD:35,197-UNIMOD:35	0.02	36.0	2	1	0
PRT	sp|P06732|KCRM_HUMAN	Creatine kinase M-type OS=Homo sapiens OX=9606 GN=CKM PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q15544|TAF11_HUMAN	Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	2	1	0
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	302-UNIMOD:35,309-UNIMOD:35,311-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|Q8NBM4-3|UBAC2_HUMAN	Isoform 3 of Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	2	1	0
PRT	sp|P30825|SL7A1_HUMAN	High affinity cationic amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	null	365-UNIMOD:35	0.02	35.0	3	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	1503-UNIMOD:35	0.02	35.0	8	3	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	3	2	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	337-UNIMOD:35	0.08	34.0	8	3	0
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	4	1	0
PRT	sp|O15260-3|SURF4_HUMAN	Isoform 3 of Surfeit locus protein 4 OS=Homo sapiens OX=9606 GN=SURF4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null	32-UNIMOD:4,44-UNIMOD:35	0.18	34.0	7	2	0
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null	674-UNIMOD:35	0.08	34.0	7	4	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null	706-UNIMOD:35,715-UNIMOD:35	0.01	34.0	2	1	0
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	3	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	null	438-UNIMOD:4	0.04	33.0	16	4	1
PRT	sp|Q9HCU9|BRMS1_HUMAN	Breast cancer metastasis-suppressor 1 OS=Homo sapiens OX=9606 GN=BRMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	1	0
PRT	sp|Q96S55-4|WRIP1_HUMAN	Isoform 4 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	null	141-UNIMOD:35	0.10	33.0	5	2	1
PRT	sp|P67775-2|PP2AA_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	null	133-UNIMOD:4	0.06	33.0	3	1	0
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	null	235-UNIMOD:4	0.06	32.0	4	2	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	null	46-UNIMOD:4,54-UNIMOD:35,14-UNIMOD:35	0.41	32.0	3	2	1
PRT	sp|Q8N3C0|ASCC3_HUMAN	Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	4	1	0
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	257-UNIMOD:4,285-UNIMOD:4	0.04	32.0	13	4	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	314-UNIMOD:4,1112-UNIMOD:35	0.06	32.0	8	5	2
PRT	sp|Q00325|MPCP_HUMAN	Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	0
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	4	1	0
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.18	31.0	4	2	0
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null	122-UNIMOD:4,104-UNIMOD:4	0.01	31.0	3	2	1
PRT	sp|Q9P035-2|HACD3_HUMAN	Isoform 2 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	48-UNIMOD:121,1-UNIMOD:35,6-UNIMOD:121,63-UNIMOD:121,11-UNIMOD:121,64-UNIMOD:121	0.53	31.0	26	6	2
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null	68-UNIMOD:35,75-UNIMOD:35	0.05	31.0	2	1	0
PRT	sp|P00390-2|GSHR_HUMAN	Isoform Cytoplasmic of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	1	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null	289-UNIMOD:4,346-UNIMOD:35	0.04	31.0	2	2	2
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	1	0
PRT	sp|Q15631|TSN_HUMAN	Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	3	1	0
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null	244-UNIMOD:4,246-UNIMOD:4	0.01	30.0	2	1	0
PRT	sp|Q9Y289|SC5A6_HUMAN	Sodium-dependent multivitamin transporter OS=Homo sapiens OX=9606 GN=SLC5A6 PE=2 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null	3859-UNIMOD:35	0.00	30.0	2	1	0
PRT	sp|Q8N7G0|PO5F2_HUMAN	POU domain, class 5, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU5F2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	4	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	3	1	0
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	null	163-UNIMOD:4	0.05	30.0	3	1	0
PRT	sp|P56134-4|ATPK_HUMAN	Isoform 4 of ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null	26-UNIMOD:35	0.51	29.0	4	2	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|P41970|ELK3_HUMAN	ETS domain-containing protein Elk-3 OS=Homo sapiens OX=9606 GN=ELK3 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	3	1	0
PRT	sp|Q9UBM7|DHCR7_HUMAN	7-dehydrocholesterol reductase OS=Homo sapiens OX=9606 GN=DHCR7 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	3	1	0
PRT	sp|Q9Y4C2-2|TCAF1_HUMAN	Isoform 2 of TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null	695-UNIMOD:35	0.03	29.0	6	3	2
PRT	sp|P24390|ERD21_HUMAN	ER lumen protein-retaining receptor 1 OS=Homo sapiens OX=9606 GN=KDELR1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	3	1	0
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	4	2	1
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.08	29.0	5	2	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	3	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9NRG0|CHRC1_HUMAN	Chromatin accessibility complex protein 1 OS=Homo sapiens OX=9606 GN=CHRAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	55-UNIMOD:4	0.12	28.0	2	1	0
PRT	sp|P61803|DAD1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Homo sapiens OX=9606 GN=DAD1 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	3	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	97-UNIMOD:4	0.09	28.0	4	2	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	327-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	232-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	3	2	1
PRT	sp|O14735|CDIPT_HUMAN	CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	122-UNIMOD:35	0.06	28.0	3	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	3	1	0
PRT	sp|P53992-2|SC24C_HUMAN	Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	4	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	11	1	0
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:4	0.03	28.0	4	2	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|P61619|S61A1_HUMAN	Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null	471-UNIMOD:35	0.05	28.0	3	2	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	4	1	0
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	3	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	6	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	2	1	0
PRT	sp|P13646-2|K1C13_HUMAN	Isoform 2 of Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q8TB61-5|S35B2_HUMAN	Isoform 5 of Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens OX=9606 GN=SLC35B2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9Y2I1-2|NISCH_HUMAN	Isoform 2 of Nischarin OS=Homo sapiens OX=9606 GN=NISCH	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	6	3	1
PRT	sp|P12235|ADT1_HUMAN	ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|P61457|PHS_HUMAN	Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.24	26.0	7	2	0
PRT	sp|O14744-4|ANM5_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null	329-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|Q9BTW9-5|TBCD_HUMAN	Isoform 5 of Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	4	1	0
PRT	sp|Q9UM00-1|TMCO1_HUMAN	Isoform 3 of Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	3	1	0
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null	84-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.19	26.0	2	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|O14579|COPE_HUMAN	Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	null	148-UNIMOD:4,151-UNIMOD:35	0.07	26.0	2	1	0
PRT	sp|Q14534|ERG1_HUMAN	Squalene monooxygenase OS=Homo sapiens OX=9606 GN=SQLE PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	null	166-UNIMOD:4	0.02	26.0	3	1	0
PRT	sp|O75694|NU155_HUMAN	Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|Q15714-2|T22D1_HUMAN	Isoform 2 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	3	1	0
PRT	sp|Q53GQ0-2|DHB12_HUMAN	Isoform 2 of Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	null	153-UNIMOD:35	0.08	25.0	1	1	1
PRT	sp|P43003-2|EAA1_HUMAN	Isoform 2 of Excitatory amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC1A3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|Q9GZT8|NIF3L_HUMAN	NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001476, X!Tandem, ]	25.0	null	298-UNIMOD:4,337-UNIMOD:4	0.14	25.0	2	1	0
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|Q9Y330|ZBT12_HUMAN	Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZBTB12 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8NAM6|ZSCA4_HUMAN	Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZSCAN4 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	98-UNIMOD:4	0.06	24.0	2	1	0
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P62854|RS26_HUMAN	40S ribosomal protein S26 OS=Homo sapiens OX=9606 GN=RPS26 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:4,77-UNIMOD:4	0.25	24.0	3	2	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	403-UNIMOD:35,405-UNIMOD:35	0.01	24.0	4	2	0
PRT	sp|Q9UKB1-2|FBW1B_HUMAN	Isoform A of F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	220-UNIMOD:35	0.03	24.0	2	2	2
PRT	sp|O94979-5|SC31A_HUMAN	Isoform 5 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	82-UNIMOD:4	0.03	24.0	2	1	0
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q8TEL6-3|TP4AP_HUMAN	Isoform 3 of Short transient receptor potential channel 4-associated protein OS=Homo sapiens OX=9606 GN=TRPC4AP	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	null	645-UNIMOD:4	0.01	24.0	2	1	0
PRT	sp|Q96RE7|NACC1_HUMAN	Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	2	1	0
PRT	sp|Q9P2X0|DPM3_HUMAN	Dolichol-phosphate mannosyltransferase subunit 3 OS=Homo sapiens OX=9606 GN=DPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	2	1	0
PRT	sp|Q7LG56-2|RIR2B_HUMAN	Isoform 2 of Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q13535-2|ATR_HUMAN	Isoform 2 of Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q7Z3U7-2|MON2_HUMAN	Isoform 2 of Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q7L523|RRAGA_HUMAN	Ras-related GTP-binding protein A OS=Homo sapiens OX=9606 GN=RRAGA PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q9Y6M7-5|S4A7_HUMAN	Isoform 5 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null	543-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	2	1	0
PRT	sp|Q99735-2|MGST2_HUMAN	Isoform 2 of Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.19	23.0	1	1	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0	null	102-UNIMOD:121	0.06	23.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	3	1	0
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null	357-UNIMOD:28	0.02	22.0	1	1	1
PRT	sp|Q9NZL4|HPBP1_HUMAN	Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9UPE1-2|SRPK3_HUMAN	Isoform 2 of SRSF protein kinase 3 OS=Homo sapiens OX=9606 GN=SRPK3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null	73-UNIMOD:35,76-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null	415-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O95562|SFT2B_HUMAN	Vesicle transport protein SFT2B OS=Homo sapiens OX=9606 GN=SFT2D2 PE=1 SV=1	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9Y4C2|TCAF1_HUMAN	TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK	1	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=3845	18.977	3	3222.2743	3222.2743	R	S	580	620
PSM	FSSCGGGGGSFGAGGGFGSR	2	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:4	ms_run[2]:scan=6022	25.633	2	1764.7274	1764.7274	R	S	46	66
PSM	GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK	3	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=3827	18.928	3	3222.2743	3222.2743	R	S	580	620
PSM	SCTVLNVEGDALGAGLLQNYVDR	4	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:4	ms_run[2]:scan=11453	41.662	2	2463.2064	2463.2064	R	T	238	261
PSM	SCTVLNVEGDALGAGLLQNYVDR	5	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4	ms_run[2]:scan=11447	41.645	2	2463.2064	2463.2064	R	T	238	261
PSM	FNLIDDSSGNLASVTYK	6	sp|Q9H2J7-3|S6A15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9179	34.75	2	1842.9	1842.9000	R	R	535	552
PSM	FNLIDDSSGNLASVTYK	7	sp|Q9H2J7-3|S6A15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9180	34.753	2	1842.9	1842.9000	R	R	535	552
PSM	GSLGGGFSSGGFSGGSFSR	8	sp|P13645|K1C10_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7764	30.73	2	1706.7649	1706.7649	K	G	41	60
PSM	SCTVLNVEGDALGAGLLQNYVDR	9	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4	ms_run[2]:scan=11446	41.643	3	2463.2064	2463.2064	R	T	238	261
PSM	FTEGFQNIVDAYGVGSYR	10	sp|Q9Y487|VPP2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10433	38.533	2	2021.9483	2021.9483	K	E	375	393
PSM	GSNNVALGYDEGSIIVK	11	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7718	30.6	2	1734.8788	1734.8788	R	L	253	270
PSM	FSSCGGGGGSFGAGGGFGSR	12	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=6025	25.641	2	1764.7274	1764.7274	R	S	46	66
PSM	GSLGGGFSSGGFSGGSFSR	13	sp|P13645|K1C10_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7752	30.694	2	1706.7649	1706.7649	K	G	41	60
PSM	NDLSPASSGNAVYDFFIGR	14	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11734	42.522	2	2028.9541	2028.9541	R	E	354	373
PSM	AVVVNAAQLASYSQSK	15	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7110	28.814	2	1634.8628	1634.8628	R	Q	140	156
PSM	DAFQNAYLELGGLGER	16	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10738	39.472	2	1751.8479	1751.8479	K	V	505	521
PSM	LMNETTAVALAYGIYK	17	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:35	ms_run[2]:scan=9349	35.253	2	1772.9019	1772.9019	R	Q	170	186
PSM	SADGSAPAGEGEGVTLQR	18	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4398	20.59	2	1700.7966	1700.7966	K	N	31	49
PSM	AEYEGDGIPTVFVAVAGR	19	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10328	38.216	2	1849.921	1849.9210	K	S	314	332
PSM	AVVVNAAQLASYSQSK	20	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7098	28.782	2	1634.8628	1634.8628	R	Q	140	156
PSM	GWAPTFLGYSMQGLCK	21	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=9958	37.087	2	1830.8433	1830.8433	K	F	121	137
PSM	IINEPTAAAIAYGLDR	22	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9209	34.842	2	1686.8941	1686.8941	R	T	117	133
PSM	IINEPTAAAIAYGLDR	23	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9210	34.844	2	1686.8941	1686.8941	R	T	117	133
PSM	IINEPTAAAIAYGLDR	24	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9232	34.911	2	1686.8941	1686.8941	R	T	117	133
PSM	LMNETTAVALAYGIYK	25	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:35	ms_run[2]:scan=9351	35.258	2	1772.9019	1772.9019	R	Q	170	186
PSM	QQEGGSQASVYTSATEGR	26	sp|Q9C0C7-6|AMRA1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4163	19.892	2	1854.8344	1854.8344	R	G	363	381
PSM	SCTVLNVEGDALGAGLLQNYVDR	27	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4	ms_run[2]:scan=11439	41.621	3	2463.2064	2463.2064	R	T	238	261
PSM	CVLFTYFQGDISSVVDEHFSR	28	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=12306	44.271	3	2505.1635	2505.1635	R	A	85	106
PSM	DAFQNAYLELGGLGER	29	sp|P05023-3|AT1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10739	39.474	2	1751.8479	1751.8479	K	V	505	521
PSM	FLGDEQDQITFVTR	30	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8821	33.693	2	1667.8155	1667.8155	K	A	418	432
PSM	GSLGGGFSSGGFSGGSFSR	31	sp|P13645|K1C10_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7749	30.687	2	1706.7649	1706.7649	K	G	41	60
PSM	SCTVLNVEGDALGAGLLQNYVDR	32	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=11456	41.673	2	2463.2064	2463.2064	R	T	238	261
PSM	TPEQCPSVVSLLSESYNPHVR	33	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=9560	35.873	3	2398.1587	2398.1587	R	Y	629	650
PSM	VLYSNMLGEENTYLWR	34	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35	ms_run[2]:scan=9431	35.497	2	2002.9459	2002.9459	K	T	145	161
PSM	NIAFFSTNCVEGTAR	35	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	37.0	9-UNIMOD:4	ms_run[1]:scan=8582	33.024096666666665	2	1685.783588	1685.783155	R	G	241	256
PSM	AEYEGDGIPTVFVAVAGR	36	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10342	38.257	2	1849.921	1849.9210	K	S	314	332
PSM	ETDDTLVLSFVGQTR	37	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10272	38.05	2	1679.8366	1679.8366	R	V	420	435
PSM	GAEILEVLHSLPAVR	38	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11141	40.703	2	1602.9093	1602.9093	K	Q	204	219
PSM	GSNNVALGYDEGSIIVK	39	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7717	30.597	2	1734.8788	1734.8788	R	L	253	270
PSM	LLDMGETDLMLAALR	40	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=9292	35.088	2	1692.8426	1692.8426	R	T	188	203
PSM	LSVEALNSLTGEFK	41	sp|P06732|KCRM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10259	38.01	2	1506.793	1506.7930	K	G	157	171
PSM	RLIQSITGTSVSQNVVIAMSGISK	42	sp|Q15544|TAF11_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10569	38.956	3	2488.3683	2488.3683	K	V	136	160
PSM	SADGSAPAGEGEGVTLQR	43	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4395	20.582	2	1700.7966	1700.7966	K	N	31	49
PSM	VHTVMTLEQQDMVCYTAQTLVR	44	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=7350	29.519	3	2654.2502	2654.2502	R	I	298	320
PSM	VQVAQILGPLSITNK	45	sp|Q8NBM4-3|UBAC2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10198	37.819	2	1579.9297	1579.9297	R	T	35	50
PSM	ETDDTLVLSFVGQTR	46	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10267	38.036	2	1679.8366	1679.8366	R	V	420	435
PSM	ETDDTLVLSFVGQTR	47	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10294	38.116	2	1679.8366	1679.8366	R	V	420	435
PSM	FLGDEQDQITFVTR	48	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8822	33.695	2	1667.8155	1667.8155	K	A	418	432
PSM	GWAPTFLGYSMQGLCK	49	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=9957	37.084	2	1830.8433	1830.8433	K	F	121	137
PSM	IVEMEDVGLLFAR	50	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35	ms_run[2]:scan=9806	36.624	2	1506.7752	1506.7752	K	L	61	74
PSM	IVEMEDVGLLFAR	51	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35	ms_run[2]:scan=9807	36.627	2	1506.7752	1506.7752	K	L	61	74
PSM	LLDMGETDLMLAALR	52	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=9269	35.023	2	1692.8426	1692.8426	R	T	188	203
PSM	QQEGGSQASVYTSATEGR	53	sp|Q9C0C7-6|AMRA1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4161	19.887	2	1854.8344	1854.8344	R	G	363	381
PSM	SCTVLNVEGDALGAGLLQNYVDR	54	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=11451	41.657	3	2463.2064	2463.2064	R	T	238	261
PSM	VIYAMAEDGLLFK	55	sp|P30825|SL7A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=9312	35.142	2	1484.7585	1484.7585	R	F	361	374
PSM	HFLLEEDKPEEPTAHAFVSTLTR	56	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=8564	32.97313166666667	4	2666.333496	2666.334031	R	G	1516	1539
PSM	AVFVDLEPTVIDEVR	57	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10564	38.938	2	1700.8985	1700.8985	R	T	30	45
PSM	ETDDTLVLSFVGQTR	58	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10331	38.224	2	1679.8366	1679.8366	R	V	420	435
PSM	FLGDEQDQITFVTR	59	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8830	33.72	2	1667.8155	1667.8155	K	A	418	432
PSM	GFSSGSAVVSGGSR	60	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4109	19.731	2	1253.6	1253.6000	R	R	21	35
PSM	LAGFLDLTEQEFR	61	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11234	40.984	2	1537.7777	1537.7777	K	I	427	440
PSM	LAGFLDLTEQEFR	62	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11238	40.998	2	1537.7777	1537.7777	K	I	427	440
PSM	LAGFLDLTEQEFR	63	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11257	41.057	2	1537.7777	1537.7777	K	I	427	440
PSM	LCLISTFLEDGIR	64	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=12429	44.651	2	1535.8018	1535.8018	R	M	31	44
PSM	LLGNTFVALSDLR	65	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11027	40.352	2	1417.7929	1417.7929	R	C	326	339
PSM	MQGQEAVLAMSSR	66	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3686	18.52	2	1438.6544	1438.6544	R	S	706	719
PSM	SGGGGGGGLGSGGSIR	67	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3320	17.437	2	1231.5905	1231.5905	R	S	14	30
PSM	SGGGGGGGLGSGGSIR	68	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3327	17.458	2	1231.5905	1231.5905	R	S	14	30
PSM	TPEQCPSVVSLLSESYNPHVR	69	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=9549	35.841	3	2398.1587	2398.1587	R	Y	629	650
PSM	VLYDAEISQIHQSVTDTNVILSMDNSR	70	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	23-UNIMOD:35	ms_run[2]:scan=9660	36.176	3	3063.4819	3063.4819	K	N	315	342
PSM	VLYSNMLGEENTYLWR	71	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35	ms_run[2]:scan=9422	35.469	2	2002.9459	2002.9459	K	T	145	161
PSM	YVITIEDFYSVPR	72	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10927	40.046	2	1600.8137	1600.8137	R	T	934	947
PSM	NIAFFSTNCVEGTAR	73	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:4	ms_run[1]:scan=8584	33.029140000000005	2	1685.783588	1685.783155	R	G	241	256
PSM	GISHVIVDEIHER	74	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6233	26.259	2	1502.7841	1502.7841	R	D	504	517
PSM	GWAPTFLGYSMQGLCK	75	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=9936	37.02	2	1830.8433	1830.8433	K	F	121	137
PSM	GWAPTFLGYSMQGLCK	76	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=9939	37.028	2	1830.8433	1830.8433	K	F	121	137
PSM	LLHVAVSDVNDDVR	77	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6183	26.121	2	1550.8053	1550.8053	R	R	602	616
PSM	LLLYDTLQGELQER	78	sp|Q9HCU9|BRMS1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10589	39.019	2	1689.8938	1689.8938	K	I	150	164
PSM	MLEGGEDPLYVAR	79	sp|Q96S55-4|WRIP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=6832	28.002	2	1464.6919	1464.6919	R	R	141	154
PSM	MLEGGEDPLYVAR	80	sp|Q96S55-4|WRIP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=6863	28.095	2	1464.6919	1464.6919	R	R	141	154
PSM	QITQVYGFYDECLR	81	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4	ms_run[2]:scan=9023	34.288	2	1790.8298	1790.8298	R	K	122	136
PSM	QITQVYGFYDECLR	82	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4	ms_run[2]:scan=9028	34.304	2	1790.8298	1790.8298	R	K	122	136
PSM	TPEQCPSVVSLLSESYNPHVR	83	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=9542	35.819	3	2398.1587	2398.1587	R	Y	629	650
PSM	TPEQCPSVVSLLSESYNPHVR	84	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=9556	35.863	3	2398.1587	2398.1587	R	Y	629	650
PSM	TPEQCPSVVSLLSESYNPHVR	85	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4	ms_run[2]:scan=9562	35.878	3	2398.1587	2398.1587	R	Y	629	650
PSM	VLAGAVIGDGQSAVASNIANTTYR	86	sp|Q9C0C7-6|AMRA1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8621	33.129	3	2347.2132	2347.2132	R	L	719	743
PSM	HFLLEEDKPEEPTAHAFVSTLTR	87	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=8571	32.99436666666667	4	2666.333496	2666.334031	R	G	1516	1539
PSM	AIYDTPCIQAESEK	88	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=5943	25.412	2	1623.745	1623.7450	R	W	229	243
PSM	AVFVDLEPTVIDEVR	89	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10560	38.927	2	1700.8985	1700.8985	R	T	30	45
PSM	CVLFTYFQGDISSVVDEHFSR	90	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4	ms_run[2]:scan=12310	44.286	3	2505.1635	2505.1635	R	A	85	106
PSM	FNLIDDSSGNLASVTYK	91	sp|Q9H2J7-3|S6A15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9188	34.778	2	1842.9	1842.9000	R	R	535	552
PSM	GAEILEVLHSLPAVR	92	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11139	40.697	2	1602.9093	1602.9093	K	Q	204	219
PSM	GFSSGSAVVSGGSR	93	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4116	19.75	2	1253.6	1253.6000	R	R	21	35
PSM	IEGCIIGFDEYMNLVLDDAEEIHSK	94	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=11450	41.654	3	2925.3412	2925.3412	R	T	43	68
PSM	IGLFYMDNDLITR	95	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=9946	37.052	2	1585.781	1585.7810	R	N	108	121
PSM	IGLFYMDNDLITR	96	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=9947	37.054	2	1585.781	1585.7810	R	N	108	121
PSM	IVGLSTALANAR	97	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7756	30.708	2	1184.6877	1184.6877	R	D	1486	1498
PSM	LCLISTFLEDGIR	98	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=12428	44.649	2	1535.8018	1535.8018	R	M	31	44
PSM	LCLISTFLEDGIR	99	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=12435	44.666	2	1535.8018	1535.8018	R	M	31	44
PSM	LCLTDEEVVFVR	100	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=9502	35.697	2	1478.7439	1478.7439	R	L	256	268
PSM	SCTVLNVEGDALGAGLLQNYVDR	101	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=11438	41.618	3	2463.2064	2463.2064	R	T	238	261
PSM	TTPSYVAFTDTER	102	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6730	27.717	2	1486.694	1486.6940	R	L	37	50
PSM	VIYAMAEDGLLFK	103	sp|P30825|SL7A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35	ms_run[2]:scan=9324	35.176	2	1484.7585	1484.7585	R	F	361	374
PSM	VQVAQILGPLSITNK	104	sp|Q8NBM4-3|UBAC2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10208	37.85	2	1579.9297	1579.9297	R	T	35	50
PSM	VVVEEVQVVELK	105	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7977	31.346195	2	1368.786333	1368.786432	R	V	294	306
PSM	VLYSNMLGEENTYLWR	106	sp|Q00325|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10678	39.28994333333333	2	1987.954578	1986.950948	K	T	146	162
PSM	IVGLSTALANAR	107	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7741	30.66453	2	1184.687530	1184.687721	R	D	1486	1498
PSM	AAVESLGFILFR	108	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12343	44.386	2	1321.7394	1321.7394	R	T	617	629
PSM	AIYDTPCIQAESEK	109	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=5942	25.41	2	1623.745	1623.7450	R	W	229	243
PSM	CVLFTYFQGDISSVVDEHFSR	110	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=12290	44.225	3	2505.1635	2505.1635	R	A	85	106
PSM	CVLFTYFQGDISSVVDEHFSR	111	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=12308	44.277	3	2505.1635	2505.1635	R	A	85	106
PSM	FGVVLDEIKPSSAPELQAVR	112	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9268	35.021	3	2154.1685	2154.1685	K	M	66	86
PSM	IGLFYMDNDLITR	113	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=9948	37.057	2	1585.781	1585.7810	R	N	108	121
PSM	IHAYSQLLESYR	114	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7398	29.659	2	1478.7518	1478.7518	R	S	262	274
PSM	ILTFDQLALDSPK	115	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10064	37.402	2	1459.7922	1459.7922	K	G	91	104
PSM	IVALSSSLSNAK	116	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5985	25.528	2	1188.6714	1188.6714	R	D	1487	1499
PSM	IVGLSTALANAR	117	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7758	30.714	2	1184.6877	1184.6877	R	D	1486	1498
PSM	LCLTDEEVVFVR	118	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=9498	35.686	2	1478.7439	1478.7439	R	L	256	268
PSM	LENPDEACAVSQK	119	sp|Q5T4S7-5|UBR4_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=3679	18.498	2	1459.6613	1459.6613	R	H	115	128
PSM	LESEGSPETLTNLR	120	sp|Q9P035-2|HACD3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6373	26.66	2	1544.7682	1544.7682	R	K	78	92
PSM	LIFAGKQLEDGR	121	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:121	ms_run[2]:scan=6411	26.761	2	1459.7783	1459.7783	R	T	43	55
PSM	LIFAGKQLEDGR	122	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:121	ms_run[2]:scan=6412	26.763	2	1459.7783	1459.7783	R	T	43	55
PSM	LLLYDTLQGELQER	123	sp|Q9HCU9|BRMS1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10591	39.024	2	1689.8938	1689.8938	K	I	150	164
PSM	MEEADALIESLCR	124	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9283	35.061	2	1551.6909	1551.6909	R	D	560	573
PSM	MLEGGEDPLYVAR	125	sp|Q96S55-4|WRIP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=6830	27.997	2	1464.6919	1464.6919	R	R	141	154
PSM	NEVSLVAEGFLPEDGSGR	126	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9803	36.613	2	1874.901	1874.9010	K	I	53	71
PSM	NLAMGVNLTSMSK	127	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5415	23.548	2	1396.669	1396.6690	R	I	65	78
PSM	QEPQPQGPPPAAGAVASYDYLVIGGGSGGLASAR	128	sp|P00390-2|GSHR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10243	37.959	3	3237.6055	3237.6055	R	R	5	39
PSM	RLIQSITGTSVSQNVVIAMSGISK	129	sp|Q15544|TAF11_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10568	38.953	3	2488.3683	2488.3683	K	V	136	160
PSM	SADGSAPAGEGEGVTLQR	130	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4421	20.657	2	1700.7966	1700.7966	K	N	31	49
PSM	SGALLACGIVNSGVR	131	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=7824	30.897	2	1472.7769	1472.7769	K	N	283	298
PSM	VAPPGLTQIPQIQK	132	sp|P05026-2|AT1B1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7606	30.278	2	1488.8664	1488.8664	R	T	72	86
PSM	VIYAMAEDGLLFK	133	sp|P30825|SL7A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:35	ms_run[2]:scan=9342	35.231	2	1484.7585	1484.7585	R	F	361	374
PSM	VHTVMTLEQQDMVCYTAQTLVR	134	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=7352	29.524711666666665	3	2654.251403	2654.250244	R	I	298	320
PSM	AAVESLGFILFR	135	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12351	44.411	2	1321.7394	1321.7394	R	T	617	629
PSM	DAGVIAGLNVLR	136	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9518	35.745	2	1196.6877	1196.6877	K	I	105	117
PSM	DGGSGNSTIIVSR	137	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4271	20.215	2	1261.6262	1261.6262	R	S	2359	2372
PSM	EAVTEILGIEPDR	138	sp|Q15631|TSN_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9327	35.187	2	1440.746	1440.7460	R	E	117	130
PSM	EEACDCLFEVVNK	139	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8437	32.623	2	1611.6909	1611.6909	R	G	241	254
PSM	EEACDCLFEVVNK	140	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8444	32.64	2	1611.6909	1611.6909	R	G	241	254
PSM	GFSSGSAVVSGGSR	141	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4104	19.718	2	1253.6	1253.6000	R	R	21	35
PSM	GISHVIVDEIHER	142	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6222	26.229	2	1502.7841	1502.7841	R	D	504	517
PSM	ISGFELDPDPFVR	143	sp|Q9Y289|SC5A6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10548	38.89	2	1490.7405	1490.7405	R	H	241	254
PSM	IVALSSSLSNAK	144	sp|O75643|U520_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5981	25.518	2	1188.6714	1188.6714	R	D	1487	1499
PSM	LSSIIDCTGTASYHGFLPVLVR	145	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=10881	39.907	3	2405.2413	2405.2413	K	N	343	365
PSM	MSTSPEAFLALR	146	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=9017	34.274	2	1337.6649	1337.6649	R	S	3859	3871
PSM	NLAMGVNLTSMSK	147	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5416	23.551	2	1396.669	1396.6690	R	I	65	78
PSM	QEPQPQGPPPAAGAVASYDYLVIGGGSGGLASAR	148	sp|P00390-2|GSHR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10241	37.953	3	3237.6055	3237.6055	R	R	5	39
PSM	RLSLGYSQADVGIAVGALFGK	149	sp|Q8N7G0|PO5F2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11685	42.372	3	2121.1582	2121.1582	K	V	137	158
PSM	TAVVVGTITDDVR	150	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6995	28.477	2	1344.7249	1344.7249	K	V	50	63
PSM	TAVVVGTITDDVR	151	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7004	28.502	2	1344.7249	1344.7249	K	V	50	63
PSM	VDNAYWLWTFQGR	152	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11355	41.363	2	1654.7892	1654.7892	K	L	677	690
PSM	VIGSGCNLDSAR	153	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=4056	19.58	2	1247.5928	1247.5928	R	F	158	170
PSM	VLYSNMLGEENTYLWR	154	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35	ms_run[2]:scan=9437	35.516	2	2002.9459	2002.9459	K	T	145	161
PSM	VNEIVETNRPDSK	155	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3169	16.999	2	1499.758	1499.7580	K	N	311	324
PSM	HFLLEEDKPEEPTAHAFVSTLTR	156	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8570	32.99180833333333	4	2666.333496	2666.334031	R	G	1516	1539
PSM	CVLFTYFQGDISSVVDEHFSR	157	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=12331	44.349	3	2505.1635	2505.1635	R	A	85	106
PSM	DAGVIAGLNVLR	158	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9524	35.761	2	1196.6877	1196.6877	K	I	105	117
PSM	DFSPSGIFGAFQR	159	sp|P56134-4|ATPK_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11340	41.314	2	1427.6834	1427.6834	R	E	28	41
PSM	FGVVLDEIKPSSAPELQAVR	160	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9260	34.996	3	2154.1685	2154.1685	K	M	66	86
PSM	FLENALAVSTK	161	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7306	29.392	2	1191.6499	1191.6499	R	Y	1126	1137
PSM	FLENALAVSTK	162	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7308	29.397	2	1191.6499	1191.6499	R	Y	1126	1137
PSM	GAEILEVLHSLPAVR	163	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11170	40.789	2	1602.9093	1602.9093	K	Q	204	219
PSM	GISHVIVDEIHER	164	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6227	26.241	2	1502.7841	1502.7841	R	D	504	517
PSM	GISHVIVDEIHER	165	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6262	26.34	2	1502.7841	1502.7841	R	D	504	517
PSM	GYAFNHSADFETVR	166	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6264	26.346	2	1612.727	1612.7270	R	M	201	215
PSM	HVTRPVVSLPSTSEAAAASAFLASSVSAK	167	sp|P41970|ELK3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10159	37.697	3	2840.5032	2840.5032	K	I	193	222
PSM	LLGNTFVALSDLR	168	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11026	40.35	2	1417.7929	1417.7929	R	C	326	339
PSM	LLVSGFWGVAR	169	sp|Q9UBM7|DHCR7_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10651	39.206	2	1203.6764	1203.6764	K	H	394	405
PSM	LSSIIDCTGTASYHGFLPVLVR	170	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=10894	39.944	3	2405.2413	2405.2413	K	N	343	365
PSM	LWDEVMQAVAR	171	sp|Q9Y4C2-2|TCAF1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35	ms_run[2]:scan=7530	30.047	2	1332.6496	1332.6496	R	L	690	701
PSM	MQGQEAVLAMSSR	172	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3688	18.525	2	1438.6544	1438.6544	R	S	706	719
PSM	MQIFVKTLTGK	173	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,6-UNIMOD:121	ms_run[2]:scan=6311	26.48	2	1394.7592	1394.7592	-	T	1	12
PSM	MQIFVKTLTGK	174	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,6-UNIMOD:121	ms_run[2]:scan=6312	26.483	2	1394.7592	1394.7592	-	T	1	12
PSM	MSTSPEAFLALR	175	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=8987	34.189	2	1337.6649	1337.6649	R	S	3859	3871
PSM	RLSLGYSQADVGIAVGALFGK	176	sp|Q8N7G0|PO5F2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11690	42.386	3	2121.1582	2121.1582	K	V	137	158
PSM	SLDLDSIIAEVK	177	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11320	41.251	2	1301.7078	1301.7078	R	A	344	356
PSM	TGEAETITSHYLFALGVYR	178	sp|P24390|ERD21_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11182	40.825	3	2127.0637	2127.0637	K	T	141	160
PSM	TQLIQLSTLLR	179	sp|Q8TC07-2|TBC15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10876	39.893	2	1284.7765	1284.7765	K	L	480	491
PSM	VLQGDLVMNVYR	180	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:35	ms_run[2]:scan=7172	28.995	2	1421.7337	1421.7337	K	D	1496	1508
PSM	VYQGLYCVAIR	181	sp|Q15008-3|PSMD6_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=8054	31.566	2	1340.6911	1340.6911	K	D	143	154
PSM	YFPTQALNFAFK	182	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10926	40.043	2	1445.7343	1445.7343	R	D	81	93
PSM	YFPTQALNFAFK	183	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10929	40.052	2	1445.7343	1445.7343	R	D	81	93
PSM	VEIIANDQGNR	184	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=4122	19.769953333333333	2	1227.621430	1227.620764	R	I	50	61
PSM	IVGLSTALANAR	185	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=7739	30.659679999999998	2	1184.687530	1184.687721	R	D	1486	1498
PSM	SLGYAYVNFQQPADAER	186	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8084	31.649559999999997	2	1927.907302	1927.906441	R	A	51	68
PSM	FSQEVQITEAR	187	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=5396	23.494873333333334	2	1307.655138	1306.651730	R	C	149	160
PSM	AGGIETIANEYSDR	188	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6996	28.479	2	1494.6951	1494.6951	R	C	20	34
PSM	ATELFVQCLATYSYR	189	sp|Q9NRG0|CHRC1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=10453	38.594	2	1820.8767	1820.8767	K	H	48	63
PSM	CVLFTYFQGDISSVVDEHFSR	190	sp|Q8N8G2-2|VGLL2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=12335	44.361	3	2505.1635	2505.1635	R	A	85	106
PSM	DFSPSGIFGAFQR	191	sp|P56134-4|ATPK_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11356	41.365	2	1427.6834	1427.6834	R	E	28	41
PSM	EAVTEILGIEPDR	192	sp|Q15631|TSN_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9318	35.161	2	1440.746	1440.7460	R	E	117	130
PSM	ETDDTLVLSFVGQTR	193	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10289	38.102	2	1679.8366	1679.8366	R	V	420	435
PSM	FLEEYLSSTPQR	194	sp|P61803|DAD1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7808	30.856	2	1468.7198	1468.7198	R	L	12	24
PSM	GATQQILDEAER	195	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6179	26.111	2	1329.6525	1329.6525	R	S	330	342
PSM	GISHVIVDEIHER	196	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6200	26.173	3	1502.7841	1502.7841	R	D	504	517
PSM	GLCAIAQAESLR	197	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=7439	29.78	2	1287.6605	1287.6605	R	Y	95	107
PSM	GLCAIAQAESLR	198	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=7441	29.785	2	1287.6605	1287.6605	R	Y	95	107
PSM	IEVQDTSGGTTALRPSASTQALSSSVSSSK	199	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6081	25.822	3	2951.4684	2951.4684	R	L	740	770
PSM	IHAYSQLLESYR	200	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7406	29.684	2	1478.7518	1478.7518	R	S	262	274
PSM	IISYAQGFMLLR	201	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:35	ms_run[2]:scan=10169	37.727	2	1426.7643	1426.7643	K	Q	319	331
PSM	ILTFDQLALDSPK	202	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10059	37.389	2	1459.7922	1459.7922	K	G	91	104
PSM	IVEMEDVGLLFAR	203	sp|Q15758-3|AAAT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35	ms_run[2]:scan=9817	36.656	2	1506.7752	1506.7752	K	L	61	74
PSM	LCLQSIAFISR	204	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=9960	37.092	2	1306.7067	1306.7067	R	L	231	242
PSM	LCLQSIAFISR	205	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=9963	37.1	2	1306.7067	1306.7067	R	L	231	242
PSM	LCLTDEEVVFVR	206	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=9516	35.74	2	1478.7439	1478.7439	R	L	256	268
PSM	LESEGSPETLTNLR	207	sp|Q9P035-2|HACD3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6374	26.662	2	1544.7682	1544.7682	R	K	78	92
PSM	LLVSGFWGVAR	208	sp|Q9UBM7|DHCR7_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10683	39.305	2	1203.6764	1203.6764	K	H	394	405
PSM	LYLNETFSELR	209	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9392	35.378	2	1383.7034	1383.7034	K	L	1557	1568
PSM	MIDLSGNPVLR	210	sp|O14735|CDIPT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=7341	29.494	2	1229.6438	1229.6438	K	I	122	133
PSM	MIDLSGNPVLR	211	sp|O14735|CDIPT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=7381	29.611	2	1229.6438	1229.6438	K	I	122	133
PSM	RPTELLSNPQFIVDGATR	212	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8511	32.823	3	2013.0643	2013.0643	K	T	87	105
PSM	SLDLDSIIAEVK	213	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11329	41.279	2	1301.7078	1301.7078	R	A	344	356
PSM	SPVESTTEPPAVR	214	sp|P53992-2|SC24C_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3962	19.325	2	1368.6885	1368.6885	K	A	205	218
PSM	SPVESTTEPPAVR	215	sp|P53992-2|SC24C_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3979	19.37	2	1368.6885	1368.6885	K	A	205	218
PSM	THINIVVIGHVDSGK	216	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12689	45.461	3	1587.8733	1587.8733	K	S	6	21
PSM	TTFFHHEYPWILSASDDQTIR	217	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9859	36.781	3	2563.2132	2563.2132	R	V	98	119
PSM	TTNFAGILSQGLR	218	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10008	37.235	2	1376.7412	1376.7412	R	I	866	879
PSM	TWIEVSGSSAK	219	sp|P61619|S61A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6020	25.629	2	1163.5823	1163.5823	K	D	378	389
PSM	TWIEVSGSSAK	220	sp|P61619|S61A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6024	25.639	2	1163.5823	1163.5823	K	D	378	389
PSM	VAPPGLTQIPQIQK	221	sp|P05026-2|AT1B1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7607	30.28	2	1488.8664	1488.8664	R	T	72	86
PSM	VIGSGCNLDSAR	222	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=4054	19.574	2	1247.5928	1247.5928	R	F	158	170
PSM	VLQGDLVMNVYR	223	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:35	ms_run[2]:scan=7168	28.985	2	1421.7337	1421.7337	K	D	1496	1508
PSM	VLYDAEISQIHQSVTDTNVILSMDNSR	224	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0	23-UNIMOD:35	ms_run[2]:scan=9663	36.184	3	3063.4819	3063.4819	K	N	315	342
PSM	VNILEVASGAVLR	225	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11299	41.188	2	1339.7823	1339.7823	R	S	47	60
PSM	VNILEVASGAVLR	226	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11300	41.19	2	1339.7823	1339.7823	R	S	47	60
PSM	VNILEVASGAVLR	227	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11317	41.243	2	1339.7823	1339.7823	R	S	47	60
PSM	YVITIEDFYSVPR	228	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10928	40.049	2	1600.8137	1600.8137	R	T	934	947
PSM	AAYFGIYDTAK	229	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7768	30.74322	2	1218.591712	1218.592090	R	G	189	200
PSM	DSLIIIDELGR	230	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10460	38.61521	2	1242.680778	1242.681967	K	G	742	753
PSM	THINIVVIGHVDSGK	231	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=7089	28.755423333333333	3	1587.873214	1587.873290	K	S	6	21
PSM	VDNAYWLWTFQGR	232	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=11371	41.410513333333334	2	1654.789213	1654.789226	K	L	677	690
PSM	AGGIETIANEYSDR	233	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6993	28.471	2	1494.6951	1494.6951	R	C	20	34
PSM	AIITALGVER	234	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7454	29.823	2	1041.6182	1041.6182	K	R	1872	1882
PSM	ALEEANADLEVK	235	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5539	23.904	2	1300.6511	1300.6511	R	I	112	124
PSM	AWSGTFDELLSK	236	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10103	37.522	2	1352.6612	1352.6612	R	Q	133	145
PSM	DFSPSGIFGAFQR	237	sp|P56134-4|ATPK_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11336	41.302	2	1427.6834	1427.6834	R	E	28	41
PSM	EDVLTLLLPVMGDSK	238	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35	ms_run[2]:scan=11949	43.176	2	1644.8644	1644.8644	R	S	336	351
PSM	ESFSLVQVQPGVDIIR	239	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10117	37.568	2	1785.9625	1785.9625	R	T	689	705
PSM	ESFSLVQVQPGVDIIR	240	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10120	37.577	2	1785.9625	1785.9625	R	T	689	705
PSM	GAEILEVLHSLPAVR	241	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11164	40.77	2	1602.9093	1602.9093	K	Q	204	219
PSM	GATQQILDEAER	242	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6156	26.041	2	1329.6525	1329.6525	R	S	330	342
PSM	LLHVAVSDVNDDVR	243	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6184	26.124	2	1550.8053	1550.8053	R	R	602	616
PSM	LLVSGFWGVAR	244	sp|Q9UBM7|DHCR7_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10630	39.144	2	1203.6764	1203.6764	K	H	394	405
PSM	LPVGTTATLYFR	245	sp|Q9NZ01|TECR_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8818	33.684	2	1337.7343	1337.7343	K	D	68	80
PSM	LSVEALNSLTGEFK	246	sp|P06732|KCRM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10260	38.013	2	1506.793	1506.7930	K	G	157	171
PSM	QAWVITGGDDSGIR	247	sp|Q9NNW5|WDR6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7562	30.144	2	1473.7212	1473.7212	R	L	310	324
PSM	SFCPGGTDSVSPPPSVITQENLGR	248	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=7761	30.722	3	2501.1857	2501.1857	K	V	312	336
PSM	SYGATATSPGER	249	sp|Q8TB61-5|S35B2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2428	14.752	2	1195.5469	1195.5469	R	F	4	16
PSM	TEDFIIDTLELR	250	sp|Q01780-2|EXOSX_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11459	41.681	2	1463.7508	1463.7508	R	S	335	347
PSM	TGEAETITSHYLFALGVYR	251	sp|P24390|ERD21_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11171	40.791	3	2127.0637	2127.0637	K	T	141	160
PSM	TTNFAGILSQGLR	252	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10013	37.249	2	1376.7412	1376.7412	R	I	866	879
PSM	VPLSTVLLDPTR	253	sp|Q9Y2I1-2|NISCH_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9230	34.906	2	1309.7606	1309.7606	R	S	435	447
PSM	WGSNELPAEEGK	254	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5417	23.553	2	1315.6044	1315.6044	R	T	36	48
PSM	YEELQITAGR	255	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5949	25.431	2	1178.5932	1178.5932	K	H	377	387
PSM	YEELQITAGR	256	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5957	25.449	2	1178.5932	1178.5932	K	H	377	387
PSM	VEIIANDQGNR	257	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=4121	19.767205	2	1227.621430	1227.620764	R	I	50	61
PSM	TLSDYNIQKESTLHLVLR	258	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:121	ms_run[1]:scan=8251	32.100755	3	2243.189534	2243.190995	R	L	55	73
PSM	AAYFGIYDTAK	259	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7766	30.73902	2	1218.591712	1218.592090	R	G	189	200
PSM	AAYFGVYDTAK	260	sp|P12235|ADT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=6952	28.35633	2	1204.576685	1204.576440	R	G	189	200
PSM	TIFTGHTAVVEDVSWHLLHESLFGSVADDQK	261	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12705	45.51551	4	3439.689656	3437.689185	K	L	221	252
PSM	AAVESLGFILFR	262	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12341	44.381	2	1321.7394	1321.7394	R	T	617	629
PSM	AAVESLGFILFR	263	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12362	44.444	2	1321.7394	1321.7394	R	T	617	629
PSM	ALEEANADLEVK	264	sp|P13646-2|K1C13_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5534	23.891	2	1300.6511	1300.6511	R	I	112	124
PSM	AVGWNELEGR	265	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6932	28.3	2	1129.5516	1129.5516	R	D	22	32
PSM	AWSGTFDELLSK	266	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10087	37.474	2	1352.6612	1352.6612	R	Q	133	145
PSM	DGGSGNSTIIVSR	267	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4272	20.217	2	1261.6262	1261.6262	R	S	2359	2372
PSM	DRDPEAQFEMPYVVR	268	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35	ms_run[2]:scan=6738	27.74	3	1866.857	1866.8570	K	L	320	335
PSM	FEELCSDLFR	269	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=9300	35.11	2	1314.5914	1314.5914	R	S	247	257
PSM	FEELCSDLFR	270	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=9302	35.115	2	1314.5914	1314.5914	R	S	247	257
PSM	GLCAIAQAESLR	271	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=7447	29.804	2	1287.6605	1287.6605	R	Y	95	107
PSM	GYAFNHSADFETVR	272	sp|P61160|ARP2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6257	26.325	3	1612.727	1612.7270	R	M	201	215
PSM	KEELTLEGIR	273	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6269	26.362	2	1186.6558	1186.6558	K	Q	238	248
PSM	KEELTLEGIR	274	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6281	26.393	2	1186.6558	1186.6558	K	Q	238	248
PSM	LCLISTFLEDGIR	275	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=12465	44.76	2	1535.8018	1535.8018	R	M	31	44
PSM	LDGNLLTQPGQAR	276	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6068	25.78	2	1381.7314	1381.7314	R	M	153	166
PSM	LDHHPEWFNVYNK	277	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7096	28.777	3	1697.795	1697.7950	K	V	60	73
PSM	LDHHPEWFNVYNK	278	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7097	28.78	3	1697.795	1697.7950	K	V	60	73
PSM	LPFTPLSYIQGLSHR	279	sp|Q9UM00-1|TMCO1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11531	41.905	3	1727.9359	1727.9359	K	N	117	132
PSM	LWDEVMQAVAR	280	sp|Q9Y4C2-2|TCAF1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35	ms_run[2]:scan=7536	30.068	2	1332.6496	1332.6496	R	L	690	701
PSM	LYLNETFSELR	281	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9389	35.37	2	1383.7034	1383.7034	K	L	1557	1568
PSM	NAENAIEALK	282	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6189	26.142	2	1071.556	1071.5560	R	E	111	121
PSM	NAENAIEALK	283	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6190	26.144	2	1071.556	1071.5560	R	E	111	121
PSM	THINIVVIGHVDSGK	284	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6261	26.338	3	1587.8733	1587.8733	K	S	6	21
PSM	TQLIQLSTLLR	285	sp|Q8TC07-2|TBC15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10868	39.868	2	1284.7765	1284.7765	K	L	480	491
PSM	TQLIQLSTLLR	286	sp|Q8TC07-2|TBC15_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10896	39.953	2	1284.7765	1284.7765	K	L	480	491
PSM	VLQGDLVMNVYR	287	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:35	ms_run[2]:scan=7179	29.017	2	1421.7337	1421.7337	K	D	1496	1508
PSM	VLYSNMLGEENTYLWR	288	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35	ms_run[2]:scan=9440	35.524	2	2002.9459	2002.9459	K	T	145	161
PSM	YATDTFAGLCHQLTNALVER	289	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=10957	40.139	3	2279.1005	2279.1005	R	K	75	95
PSM	YEELQVTVGR	290	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6119	25.935	2	1192.6088	1192.6088	K	H	375	385
PSM	YFNSYTLTGR	291	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6855	28.07	2	1220.5826	1220.5826	K	M	18	28
PSM	DGPNALTPPPTTPEWIK	292	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=8677	33.27708666666666	2	1833.935368	1832.930865	R	F	75	92
PSM	SYELPDGQVITIGNER	293	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=9110	34.549881666666664	2	1790.887111	1789.884643	K	F	241	257
PSM	ALHQGDSLECTAMTVQILLK	294	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=10240	37.949775	3	2244.130737	2243.128990	R	L	139	159
PSM	DSLIIIDELGR	295	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10458	38.60978	2	1242.680778	1242.681967	K	G	742	753
PSM	THINIVVIGHVDSGK	296	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7448	29.806215	3	1587.873214	1587.873290	K	S	6	21
PSM	VDNAYWLWTFQGR	297	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11367	41.39941833333334	2	1654.789213	1654.789226	K	L	677	690
PSM	ALLSSGAVLYK	298	sp|Q14534|ERG1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7491	29.932798333333334	2	1120.648631	1120.649211	R	A	546	557
PSM	TNIAIFCETR	299	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4	ms_run[1]:scan=7520	30.016704999999998	2	1223.596708	1223.596858	K	A	160	170
PSM	LLEVYDQLFK	300	sp|O75694|NU155_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10692	39.333243333333336	2	1266.685555	1266.685990	R	S	1299	1309
PSM	AAECNIVVTQPR	301	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=4658	21.352	2	1356.682	1356.6820	R	R	435	447
PSM	EMLGGEIIPR	302	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:35	ms_run[2]:scan=6501	26.98	2	1129.5801	1129.5801	K	S	580	590
PSM	FGVVLDEIKPSSAPELQAVR	303	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9282	35.059	3	2154.1685	2154.1685	K	M	66	86
PSM	GISHVIVDEIHER	304	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6201	26.175	3	1502.7841	1502.7841	R	D	504	517
PSM	GISHVIVDEIHER	305	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6202	26.177	3	1502.7841	1502.7841	R	D	504	517
PSM	GSDQNASLYWLAR	306	sp|Q96S55-4|WRIP1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9030	34.31	2	1479.7106	1479.7106	R	M	128	141
PSM	HFSISFLSSLLGTENASVR	307	sp|Q15714-2|T22D1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12473	44.784	3	2064.064	2064.0640	R	L	20	39
PSM	HVTRPVVSLPSTSEAAAASAFLASSVSAK	308	sp|P41970|ELK3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10161	37.702	3	2840.5032	2840.5032	K	I	193	222
PSM	ISYSLFTALR	309	sp|Q53GQ0-2|DHB12_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10437	38.547	2	1169.6445	1169.6445	R	V	26	36
PSM	LAGFLDLTEQEFR	310	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11228	40.967	2	1537.7777	1537.7777	K	I	427	440
PSM	LCLISTFLEDGIR	311	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=12446	44.701	2	1535.8018	1535.8018	R	M	31	44
PSM	LDEFGEQLSK	312	sp|P16615-5|AT2A2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6134	25.978	2	1164.5663	1164.5663	K	V	253	263
PSM	LDHHPEWFNVYNK	313	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7102	28.793	3	1697.795	1697.7950	K	V	60	73
PSM	LGIYTVLFER	314	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11365	41.394	2	1209.6758	1209.6758	R	L	48	58
PSM	LGIYTVLFER	315	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11368	41.402	2	1209.6758	1209.6758	R	L	48	58
PSM	LLEVYDQLFK	316	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10677	39.287	2	1266.686	1266.6860	R	S	1240	1250
PSM	LPFTPLSYIQGLSHR	317	sp|Q9UM00-1|TMCO1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11526	41.891	3	1727.9359	1727.9359	K	N	117	132
PSM	LWDEVMQAVAR	318	sp|Q9Y4C2-2|TCAF1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35	ms_run[2]:scan=7537	30.07	2	1332.6496	1332.6496	R	L	690	701
PSM	NQLQSVAAACK	319	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=4103	19.716	2	1188.5921	1188.5921	R	V	95	106
PSM	NQLQSVAAACK	320	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=4105	19.721	2	1188.5921	1188.5921	R	V	95	106
PSM	QITQVYGFYDECLR	321	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:4	ms_run[2]:scan=9042	34.345	2	1790.8298	1790.8298	R	K	122	136
PSM	RLSLGYSQADVGIAVGALFGK	322	sp|Q8N7G0|PO5F2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11695	42.403	3	2121.1582	2121.1582	K	V	137	158
PSM	SDPNRETDDTLVLSFVGQTR	323	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9543	35.822	3	2249.0924	2249.0924	R	V	415	435
PSM	SLDLDSIIAEVK	324	sp|P04264|K2C1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11316	41.24	2	1301.7078	1301.7078	R	A	344	356
PSM	SPVESTTEPPAVR	325	sp|P53992-2|SC24C_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3960	19.32	2	1368.6885	1368.6885	K	A	205	218
PSM	TGEAETITSHYLFALGVYR	326	sp|P24390|ERD21_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11176	40.809	3	2127.0637	2127.0637	K	T	141	160
PSM	THINIVVIGHVDSGK	327	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6254	26.318	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	328	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10814	39.701	3	1587.8733	1587.8733	K	S	6	21
PSM	TLTGKTITLEVEPSDTIENVK	329	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:121	ms_run[2]:scan=7906	31.145	3	2401.2588	2401.2588	K	A	7	28
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	330	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35	ms_run[2]:scan=9458	35.577	4	3198.6019	3198.6019	R	L	148	178
PSM	TTTNVLGDSLGAGIVEHLSR	331	sp|P43003-2|EAA1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9996	37.201	3	2039.0647	2039.0647	R	H	435	455
PSM	WGSNELPAEEGK	332	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5408	23.528	2	1315.6044	1315.6044	R	T	36	48
PSM	YFNSYTLTGR	333	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6858	28.079	2	1220.5826	1220.5826	K	M	18	28
PSM	YVITIEDFYSVPR	334	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10932	40.06	2	1600.8137	1600.8137	R	T	934	947
PSM	HFLLEEDKPEEPTAHAFVSTLTR	335	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8578	33.014556666666664	4	2666.333496	2666.334031	R	G	1516	1539
PSM	AAYFGVYDTAK	336	sp|P12235|ADT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=6954	28.360425	2	1204.576685	1204.576440	R	G	189	200
PSM	THINIVVIGHVDSGK	337	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7090	28.758218333333335	3	1587.873214	1587.873290	K	S	6	21
PSM	TNIAIFCETR	338	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=7521	30.01936	2	1223.596708	1223.596858	K	A	160	170
PSM	VVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTER	339	sp|Q9GZT8|NIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001476, X!Tandem, ]	25.0	5-UNIMOD:4,44-UNIMOD:4	ms_run[1]:scan=12811	45.846354999999996	5	5410.5526	5410.5499	K	G	294	345
PSM	AAYFGIYDTAK	340	sp|P05141|ADT2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7777	30.770761666666665	2	1218.591712	1218.592090	R	G	189	200
PSM	VEIIANDQGNR	341	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=4133	19.804958333333335	2	1227.621430	1227.620764	R	I	50	61
PSM	AAAAAAAAAASGAAIPPLIPPRR	342	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7847	30.973	3	2054.1749	2054.1749	R	V	124	147
PSM	AAAAAAAAAASGAAIPPLIPPRR	343	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7852	30.987	3	2054.1749	2054.1749	R	V	124	147
PSM	AELNEFLTR	344	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7782	30.783	2	1091.5611	1091.5611	K	E	19	28
PSM	AGGIETIANEYSDR	345	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7010	28.522	2	1494.6951	1494.6951	R	C	20	34
PSM	ALDTMNFDVIK	346	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=7706	30.563	2	1281.6275	1281.6275	R	G	68	79
PSM	ASVGATSGLVEAAAVAMAAR	347	sp|Q9Y330|ZBT12_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10943	40.094	3	1801.9356	1801.9356	R	G	286	306
PSM	CLFTLLGHLDYIR	348	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=11915	43.075	3	1619.8494	1619.8494	R	T	85	98
PSM	DPVYTFSISQNPFPIENR	349	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10471	38.649	3	2123.0324	2123.0324	K	D	459	477
PSM	DVVQAYPEVR	350	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5456	23.666	2	1174.5982	1174.5982	R	I	529	539
PSM	EAVTEILGIEPDR	351	sp|Q15631|TSN_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9332	35.2	2	1440.746	1440.7460	R	E	117	130
PSM	EIIDLVLDR	352	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10062	37.397	2	1084.6128	1084.6128	K	I	78	87
PSM	GDFILVGDLMR	353	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:35	ms_run[2]:scan=9587	35.959	2	1250.6329	1250.6329	K	S	918	929
PSM	GISHVIVDEIHER	354	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6220	26.225	3	1502.7841	1502.7841	R	D	504	517
PSM	GLQEGYENSR	355	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3097	16.799	2	1151.5207	1151.5207	R	C	1089	1099
PSM	GLQEGYENSR	356	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3108	16.829	2	1151.5207	1151.5207	R	C	1089	1099
PSM	HSKDEIISLLVLEQFMIGGHCNDK	357	sp|Q8NAM6|ZSCA4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	21-UNIMOD:4	ms_run[2]:scan=12244	44.09	4	2782.3782	2782.3782	K	A	78	102
PSM	ISAVSVAER	358	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4276	20.231	2	930.51345	930.5134	R	V	448	457
PSM	LCLTDEEVVFVR	359	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=9520	35.751	2	1478.7439	1478.7439	R	L	256	268
PSM	LDGNLLTQPGQAR	360	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6091	25.851	2	1381.7314	1381.7314	R	M	153	166
PSM	LDGNLLTQPGQAR	361	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6094	25.86	2	1381.7314	1381.7314	R	M	153	166
PSM	LEHTAQTYSELQGER	362	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4319	20.361	3	1760.8329	1760.8329	K	I	458	473
PSM	LHYCVSCAIHSK	363	sp|P62854|RS26_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4307	20.324	3	1473.6857	1473.6857	K	V	71	83
PSM	LLEVYDQLFK	364	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10671	39.267	2	1266.686	1266.6860	R	S	1240	1250
PSM	LPFTPLSYIQGLSHR	365	sp|Q9UM00-1|TMCO1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11511	41.842	3	1727.9359	1727.9359	K	N	117	132
PSM	LPGLQATVR	366	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5863	25.131	2	953.56581	953.5658	K	L	322	331
PSM	LVVSGSSDNTIR	367	sp|Q9UKB1-2|FBW1B_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4374	20.52	2	1246.6517	1246.6517	R	L	381	393
PSM	LWDEVMQAVAR	368	sp|Q9Y4C2-2|TCAF1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35	ms_run[2]:scan=7559	30.135	2	1332.6496	1332.6496	R	L	690	701
PSM	NEALAALLR	369	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8880	33.867	2	969.56073	969.5607	R	D	203	212
PSM	NPAVLSAASFDGR	370	sp|O94979-5|SC31A_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7094	28.768	2	1303.6521	1303.6521	R	I	315	328
PSM	QAWVITGGDDSGIR	371	sp|Q9NNW5|WDR6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7557	30.13	2	1473.7212	1473.7212	R	L	310	324
PSM	QSGESIDIITR	372	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6232	26.257	2	1217.6252	1217.6252	K	A	93	104
PSM	RPTEICADPQFIIGGATR	373	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=7974	31.334	3	2001.0102	2001.0102	K	T	77	95
PSM	SDPNRETDDTLVLSFVGQTR	374	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9548	35.838	3	2249.0924	2249.0924	R	V	415	435
PSM	SEGVVAVLLTK	375	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9373	35.321	2	1114.6598	1114.6598	R	K	225	236
PSM	SFCPGGTDSVSPPPSVITQENLGR	376	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=7759	30.716	3	2501.1857	2501.1857	K	V	312	336
PSM	SPLGEVAIR	377	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6271	26.366	2	940.53418	940.5342	R	D	476	485
PSM	SYGATATSPGER	378	sp|Q8TB61-5|S35B2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2430	14.757	2	1195.5469	1195.5469	R	F	4	16
PSM	TTPSYVAFTDTER	379	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6731	27.719	2	1486.694	1486.6940	R	L	37	50
PSM	VAEVLSECR	380	sp|Q8TEL6-3|TP4AP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=4338	20.417	2	1061.5175	1061.5175	K	L	638	647
PSM	VMVQPINLIFR	381	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=10656	39.223	2	1344.7588	1344.7588	K	Y	13	24
PSM	VPLSTVLLDPTR	382	sp|Q9Y2I1-2|NISCH_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9242	34.94	2	1309.7606	1309.7606	R	S	435	447
PSM	VTLGTQPTVLR	383	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6146	26.011	2	1183.6925	1183.6925	K	T	629	640
PSM	VVEGTPLIDGR	384	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5812	24.968	2	1154.6295	1154.6295	K	R	280	291
PSM	VVQSMTQLVR	385	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=3840	18.965	2	1175.6332	1175.6332	R	R	1108	1118
PSM	VVQSMTQLVR	386	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=3843	18.972	2	1175.6332	1175.6332	R	R	1108	1118
PSM	ESTLHLVLR	387	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10158	37.694375	2	1067.615718	1066.613494	K	L	64	73
PSM	ALHQGDSLECTAMTVQILLK	388	sp|O14579|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=10239	37.94680833333333	3	2243.127637	2243.128990	R	L	139	159
PSM	AVLAASSSYFR	389	sp|Q96RE7|NACC1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7012	28.52682833333333	2	1170.604552	1170.603323	R	D	46	57
PSM	MQIFVKTLTGK	390	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,6-UNIMOD:121	ms_run[1]:scan=6314	26.487759999999998	2	1396.767147	1394.759172	-	T	1	12
PSM	AAAAAAAAAASGAAIPPLIPPRR	391	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7848	30.976	3	2054.1749	2054.1749	R	V	124	147
PSM	ASVGATSGLVEAAAVAMAAR	392	sp|Q9Y330|ZBT12_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10920	40.023	3	1801.9356	1801.9356	R	G	286	306
PSM	AVGWNELEGR	393	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6931	28.298	2	1129.5516	1129.5516	R	D	22	32
PSM	DAVTYTEHAK	394	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2555	15.128	2	1133.5353	1133.5353	R	R	69	79
PSM	DVVQAYPEVR	395	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5464	23.691	2	1174.5982	1174.5982	R	I	529	539
PSM	ELQSQIQEAR	396	sp|Q9P2X0|DPM3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3842	18.969	2	1200.6099	1200.6099	R	A	73	83
PSM	ELQSQIQEAR	397	sp|Q9P2X0|DPM3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3844	18.975	2	1200.6099	1200.6099	R	A	73	83
PSM	EQSEVGSMGALLF	398	sp|P61619|S61A1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:35	ms_run[2]:scan=10138	37.634	2	1382.6388	1382.6388	K	-	464	477
PSM	ESTLHLVLR	399	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=462	4.1258	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	400	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6310	26.478	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	401	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11601	42.12	2	1066.6135	1066.6135	K	L	64	73
PSM	FGVVLDEIKPSSAPELQAVR	402	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9256	34.986	3	2154.1685	2154.1685	K	M	66	86
PSM	FSQEVQVPEAR	403	sp|Q7LG56-2|RIR2B_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5319	23.274	2	1288.6412	1288.6412	R	C	59	70
PSM	GATQQILDEAER	404	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6155	26.038	2	1329.6525	1329.6525	R	S	330	342
PSM	GWAPTFLGYSMQGLCK	405	sp|Q00325-2|MPCP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=9953	37.07	2	1830.8433	1830.8433	K	F	121	137
PSM	HFSISFLSSLLGTENASVR	406	sp|Q15714-2|T22D1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12459	44.743	3	2064.064	2064.0640	R	L	20	39
PSM	HVTRPVVSLPSTSEAAAASAFLASSVSAK	407	sp|P41970|ELK3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10136	37.628	4	2840.5032	2840.5032	K	I	193	222
PSM	IESWLETHALLEK	408	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8897	33.919	3	1567.8246	1567.8246	R	A	1142	1155
PSM	ISDSYSPQAQSR	409	sp|Q13535-2|ATR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3290	17.351	2	1337.6212	1337.6212	R	C	560	572
PSM	ISDSYSPQAQSR	410	sp|Q13535-2|ATR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3293	17.359	2	1337.6212	1337.6212	R	C	560	572
PSM	ISGFELDPDPFVR	411	sp|Q9Y289|SC5A6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10539	38.861	2	1490.7405	1490.7405	R	H	241	254
PSM	ISLADIAQK	412	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7113	28.823	2	957.5495	957.5495	R	L	279	288
PSM	KLGPEGELLIR	413	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6854	28.068	3	1223.7238	1223.7238	R	F	19	30
PSM	LCLTDEEVVFVR	414	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=9563	35.881	2	1478.7439	1478.7439	R	L	256	268
PSM	LGELPSWILMR	415	sp|P56134-4|ATPK_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35	ms_run[2]:scan=10732	39.452	2	1329.7115	1329.7115	K	D	17	28
PSM	LHYCVSCAIHSK	416	sp|P62854|RS26_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4310	20.332	3	1473.6857	1473.6857	K	V	71	83
PSM	LLTSGYLQR	417	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6191	26.146	2	1049.5869	1049.5869	R	E	177	186
PSM	LLTSGYLQR	418	sp|Q96FW1|OTUB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6221	26.227	2	1049.5869	1049.5869	R	E	177	186
PSM	LPGLQATVR	419	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5849	25.094	2	953.56581	953.5658	K	L	322	331
PSM	MATHTLITGLEEYVR	420	sp|P46379-4|BAG6_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=9552	35.848	3	1748.8767	1748.8767	R	E	674	689
PSM	MIDLSGNPVLR	421	sp|O14735|CDIPT_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=7358	29.545	2	1229.6438	1229.6438	K	I	122	133
PSM	MWFQWSEQR	422	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=8851	33.783	2	1312.5659	1312.5659	R	D	44	53
PSM	MWFQWSEQR	423	sp|O15260-3|SURF4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35	ms_run[2]:scan=8921	33.991	2	1312.5659	1312.5659	R	D	44	53
PSM	NDQGESLIR	424	sp|Q7Z3U7-2|MON2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4393	20.577	2	1030.5043	1030.5043	R	T	915	924
PSM	RPTEICADPQFIIGGATR	425	sp|P17655|CAN2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=7990	31.384	3	2001.0102	2001.0102	K	T	77	95
PSM	RPTELLSNPQFIVDGATR	426	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8514	32.83	3	2013.0643	2013.0643	K	T	87	105
PSM	RVHNLITDFLALMPMK	427	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=11337	41.305	3	1930.0169	1930.0169	R	V	391	407
PSM	SIIFANYIAR	428	sp|Q7L523|RRAGA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9397	35.395	2	1166.6448	1166.6448	R	D	25	35
PSM	SIIFANYIAR	429	sp|Q7L523|RRAGA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9402	35.409	2	1166.6448	1166.6448	R	D	25	35
PSM	SPLGEVAIR	430	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6270	26.364	2	940.53418	940.5342	R	D	476	485
PSM	THINIVVIGHVDSGK	431	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11787	42.682	3	1587.8733	1587.8733	K	S	6	21
PSM	TPHVLVLGSGVYR	432	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7232	29.174	3	1396.7827	1396.7827	R	I	932	945
PSM	VAEVLSECR	433	sp|Q8TEL6-3|TP4AP_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=4348	20.443	2	1061.5175	1061.5175	K	L	638	647
PSM	VESECSAPGEQPK	434	sp|Q9Y6M7-5|S4A7_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=2017	13.358	2	1416.6191	1416.6191	K	F	539	552
PSM	VLNTNIDGR	435	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4199	19.993	2	1000.5302	1000.5302	R	R	15	24
PSM	VLNTNIDGR	436	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4202	20	2	1000.5302	1000.5302	R	R	15	24
PSM	VMVQPINLIFR	437	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=10646	39.192	2	1344.7588	1344.7588	K	Y	13	24
PSM	VNEIVETNRPDSK	438	sp|Q15008-3|PSMD6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3170	17.001	2	1499.758	1499.7580	K	N	311	324
PSM	VTLGTQPTVLR	439	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6144	26.007	2	1183.6925	1183.6925	K	T	629	640
PSM	VTLGTQPTVLR	440	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6180	26.114	2	1183.6925	1183.6925	K	T	629	640
PSM	VTPPAVTGSPEFER	441	sp|Q99735-2|MGST2_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6019	25.626	2	1485.7464	1485.7464	K	V	35	49
PSM	WGSNELPAEEGK	442	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5436	23.608	2	1315.6044	1315.6044	R	T	36	48
PSM	YYEVLGAAATTDYNNNHEGREEDQR	443	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5947	25.422	3	2914.2754	2914.2754	R	L	291	316
PSM	YYEVLGAAATTDYNNNHEGREEDQR	444	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5960	25.458	3	2914.2754	2914.2754	R	L	291	316
PSM	ESTLHLVLR	445	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9487	35.655275	2	1067.615428	1066.613494	K	L	64	73
PSM	ESTLHLVLR	446	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:121	ms_run[1]:scan=8017	31.465336666666666	2	1180.656264	1180.656421	K	L	64	73
PSM	AAAAAAAAAASGAAIPPLIPPR	447	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8686	33.30249666666667	3	1898.072976	1898.073781	R	R	124	146
PSM	CGHSEQYFFLEVGR	448	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=9080	34.45965833333333	3	1727.771383	1727.772590	R	S	285	299
PSM	HGVQELEIELQSQLSK	449	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9550	35.84345666666667	3	1836.956746	1836.958142	R	K	375	391
PSM	DAVTYTEHAK	450	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=2586	15.227229999999999	2	1134.539420	1133.535303	R	R	69	79
PSM	THINIVVIGHVDSGK	451	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7451	29.814776666666667	3	1588.876185	1587.873290	K	S	6	21
PSM	NYGSYSTQASAAAATAELLKK	452	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0	21-UNIMOD:121	ms_run[1]:scan=7944	31.253141666666668	3	2259.121091	2258.117890	K	Q	82	103
PSM	VVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTER	453	sp|Q9GZT8|NIF3L_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001476, X!Tandem, ]	23.0	5-UNIMOD:4,44-UNIMOD:4	ms_run[1]:scan=12813	45.85201	5	5410.5526	5410.5499	K	G	294	345
PSM	EGIPPDQQR	454	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=3402	17.684626666666666	2	1038.509722	1038.509423	K	L	34	43
PSM	DSLIIIDELGR	455	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=10493	38.71781	2	1242.680778	1242.681967	K	G	742	753
PSM	AIITALGVER	456	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7446	29.801	2	1041.6182	1041.6182	K	R	1872	1882
PSM	AIYDTPCIQAESEK	457	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:4	ms_run[2]:scan=5963	25.465	2	1623.745	1623.7450	R	W	229	243
PSM	ALDTMNFDVIK	458	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:35	ms_run[2]:scan=7679	30.485	2	1281.6275	1281.6275	R	G	68	79
PSM	AVGWNELEGR	459	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6944	28.333	2	1129.5516	1129.5516	R	D	22	32
PSM	CLFTLLGHLDYIR	460	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=11903	43.038	3	1619.8494	1619.8494	R	T	85	98
PSM	CLFTLLGHLDYIR	461	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=11918	43.083	3	1619.8494	1619.8494	R	T	85	98
PSM	DEFAQLFQYK	462	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10183	37.77	2	1287.6136	1287.6136	R	A	402	412
PSM	DEFAQLFQYK	463	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10196	37.813	2	1287.6136	1287.6136	R	A	402	412
PSM	DEFAQLFQYK	464	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10204	37.836	2	1287.6136	1287.6136	R	A	402	412
PSM	DGETLEELMK	465	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:35	ms_run[2]:scan=5618	24.138	2	1179.5329	1179.5329	R	L	212	222
PSM	DISEASVFDAYVLPK	466	sp|P62854|RS26_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10737	39.469	2	1652.8298	1652.8298	R	L	52	67
PSM	DRDPEAQFEMPYVVR	467	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:35	ms_run[2]:scan=6741	27.747	3	1866.857	1866.8570	K	L	320	335
PSM	DVVQAYPEVR	468	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5455	23.664	2	1174.5982	1174.5982	R	I	529	539
PSM	DVVQAYPEVR	469	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5565	23.981	2	1174.5982	1174.5982	R	I	529	539
PSM	EFSFLDILR	470	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12929	46.191	2	1138.6023	1138.6023	R	L	522	531
PSM	EMLGGEIIPR	471	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=6586	27.267	2	1129.5801	1129.5801	K	S	580	590
PSM	EMQESVQVNGRVPLPHIPR	472	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:28	ms_run[2]:scan=9130	34.607	3	2168.1161	2168.1161	R	T	355	374
PSM	EQEAGLLQFLR	473	sp|Q9NZL4|HPBP1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10948	40.111	2	1302.6932	1302.6932	R	L	218	229
PSM	ESTLHLVLR	474	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7366	29.571	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	475	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7696	30.535	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	476	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8046	31.548	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	477	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8789	33.597	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	478	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9128	34.603	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	479	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10906	39.982	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	480	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11258	41.059	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	481	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14413	52.554	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	482	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8886	33.887	2	1066.6135	1066.6135	K	L	64	73
PSM	ESTLHLVLR	483	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10246	37.97	2	1066.6135	1066.6135	K	L	64	73
PSM	FFQEENTEK	484	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4167	19.903	2	1170.5193	1170.5193	K	L	193	202
PSM	FQSLGVAFYR	485	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8774	33.554	2	1186.6135	1186.6135	R	G	70	80
PSM	GISHVIVDEIHER	486	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6224	26.235	3	1502.7841	1502.7841	R	D	504	517
PSM	HFSISFLSSLLGTENASVR	487	sp|Q15714-2|T22D1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12463	44.755	3	2064.064	2064.0640	R	L	20	39
PSM	HFTEDIQTR	488	sp|Q9UPE1-2|SRPK3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3573	18.182	2	1145.5465	1145.5465	K	Q	343	352
PSM	HSKDEIISLLVLEQFMIGGHCNDK	489	sp|Q8NAM6|ZSCA4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	21-UNIMOD:4	ms_run[2]:scan=12270	44.166	4	2782.3782	2782.3782	K	A	78	102
PSM	IEGDMIVCAAYAHELPK	490	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7540	30.078	3	1931.9121	1931.9121	R	Y	69	86
PSM	IEVQDTSGGTTALRPSASTQALSSSVSSSK	491	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6085	25.833	3	2951.4684	2951.4684	R	L	740	770
PSM	ISAVSVAER	492	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4274	20.226	2	930.51345	930.5134	R	V	448	457
PSM	ISLADIAQK	493	sp|O43242-2|PSMD3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7114	28.825	2	957.5495	957.5495	R	L	279	288
PSM	LDGNLLTQPGQAR	494	sp|Q9BTW9-5|TBCD_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6062	25.764	2	1381.7314	1381.7314	R	M	153	166
PSM	LDHHPEWFNVYNK	495	sp|P61457|PHS_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7117	28.836	3	1697.795	1697.7950	K	V	60	73
PSM	LGAEPFPLR	496	sp|Q9Y4C2-2|TCAF1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7736	30.653	2	998.55492	998.5549	R	L	701	710
PSM	LLHVAVSDVNDDVR	497	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6164	26.065	3	1550.8053	1550.8053	R	R	602	616
PSM	LNDMYGDYK	498	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=4033	19.516	2	1133.4699	1133.4699	R	Y	412	421
PSM	LNDMYGDYK	499	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=4035	19.521	2	1133.4699	1133.4699	R	Y	412	421
PSM	LPGEAPVIQR	500	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5150	22.792	2	1078.6135	1078.6135	R	L	791	801
PSM	MLEGGEDPLYVAR	501	sp|Q96S55-4|WRIP1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7563	30.146	2	1448.697	1448.6970	R	R	141	154
PSM	QSGESIDIITR	502	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6236	26.266	2	1217.6252	1217.6252	K	A	93	104
PSM	QYLFSLYECR	503	sp|Q15008-3|PSMD6_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=9642	36.123	2	1377.6387	1377.6387	R	Y	219	229
PSM	RLSLGYSQADVGIAVGALFGK	504	sp|Q8N7G0|PO5F2_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11711	42.45	3	2121.1582	2121.1582	K	V	137	158
PSM	RPTELLSNPQFIVDGATR	505	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8512	32.826	3	2013.0643	2013.0643	K	T	87	105
PSM	RVHNLITDFLALMPMK	506	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=11344	41.325	3	1930.0169	1930.0169	R	V	391	407
PSM	SPVESTTEPPAVR	507	sp|P53992-2|SC24C_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3965	19.333	2	1368.6885	1368.6885	K	A	205	218
PSM	THINIVVIGHVDSGK	508	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6253	26.315	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	509	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6313	26.486	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	510	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10370	38.341	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	511	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11222	40.947	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	512	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7841	30.954	3	1587.8733	1587.8733	K	S	6	21
PSM	THINIVVIGHVDSGK	513	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12529	44.962	3	1587.8733	1587.8733	K	S	6	21
PSM	TLENPEPLLR	514	sp|Q9Y4C2-2|TCAF1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6942	28.329	2	1180.6452	1180.6452	R	L	680	690
PSM	TTPSYVAFTDTER	515	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6733	27.723	2	1486.694	1486.6940	R	L	37	50
PSM	TTTNVLGDSLGAGIVEHLSR	516	sp|P43003-2|EAA1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9997	37.203	3	2039.0647	2039.0647	R	H	435	455
PSM	VIGSGCNLDSAR	517	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=4066	19.608	2	1247.5928	1247.5928	R	F	158	170
PSM	VLEGHEELVR	518	sp|Q9UKB1-2|FBW1B_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4256	20.171	2	1179.6248	1179.6248	R	C	404	414
PSM	VLSGQDTEDR	519	sp|O95562|SFT2B_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2106	13.714	2	1118.5204	1118.5204	K	S	7	17
PSM	VNILEVASGAVLR	520	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11324	41.262	2	1339.7823	1339.7823	R	S	47	60
PSM	VVEGTPLIDGR	521	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5808	24.958	2	1154.6295	1154.6295	K	R	280	291
PSM	ESTLHLVLR	522	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13286	47.308431666666664	2	1067.615062	1066.613494	K	L	64	73
PSM	AAAAAAAAAASGAAIPPLIPPR	523	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=8696	33.33224666666667	3	1898.072976	1898.073781	R	R	124	146
PSM	CGHSEQYFFLEVGR	524	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4	ms_run[1]:scan=9087	34.48188833333334	3	1727.771383	1727.772590	R	S	285	299
PSM	CGHSEQYFFLEVGR	525	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4	ms_run[1]:scan=9057	34.39076666666667	3	1727.771383	1727.772590	R	S	285	299
PSM	YEELQVTVGR	526	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6170	26.083666666666666	2	1192.611650	1192.608802	K	H	375	385
PSM	YEELQVTVGR	527	sp|P35908|K22E_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6127	25.956773333333334	2	1192.611650	1192.608802	K	H	375	385
PSM	HGVQELEIELQSQLSK	528	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9546	35.83327833333333	3	1836.956746	1836.958142	R	K	375	391
PSM	IQENPGPWGELATDNIILTVPTANLR	529	sp|Q9Y4C2|TCAF1_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12180	43.890811666666664	3	2832.486730	2831.481758	R	T	654	680
PSM	THINIVVIGHVDSGK	530	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12532	44.970506666666665	3	1588.873444	1587.873290	K	S	6	21
PSM	THINIVVIGHVDSGK	531	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6809	27.94217	3	1587.873214	1587.873290	K	S	6	21
PSM	ALLSSGAVLYK	532	sp|Q14534|ERG1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=7488	29.925285	2	1120.648631	1120.649211	R	A	546	557
PSM	ATELFVQCLATYSYR	533	sp|Q9NRG0|CHRC1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=10464	38.62668166666666	2	1820.876586	1820.876721	K	H	48	63
PSM	HFTEDIQTR	534	sp|Q96SB4|SRPK1_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3575	18.186878333333333	2	1146.551036	1145.546536	K	Q	507	516
PSM	DFVTTAEDR	535	sp|Q9Y263|PLAP_HUMAN	1	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=5281	23.162776666666666	2	1052.482755	1052.477454	R	S	245	254
PSM	EGIPPDQQR	536	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=3749	18.717771666666668	2	1038.509722	1038.509423	K	L	34	43
PSM	TNIAIFCETR	537	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20210204	userFasta.sprot_human_20210204	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=7532	30.05292	2	1223.596708	1223.596858	K	A	160	170