"Peptide Groups Peptide Group ID"	"Checked"	"Confidence"	"Annotated Sequence"	"Modifications"	"Qvality PEP"	"Qvality q-value"	"Number of Protein Groups"	"Number of Proteins"	"Number of PSMs"	"Master Protein Accessions"	"Positions in Master Proteins"	"Modifications in Master Proteins"	"Number of Missed Cleavages"	"Theo MHplus in Da"	"Abundance Ratio Mock_M  Mock_E"	"Abundance Ratio noMock_E  Mock_E"	"Abundance Ratio Adj P-Value Mock_M  Mock_E"	"Abundance Ratio Adj P-Value noMock_E  Mock_E"	"Abundance Ratio Variability in Percent Mock_M  Mock_E"	"Abundance Ratio Variability in Percent noMock_E  Mock_E"	"Abundances Grouped Mock_E"	"Abundances Grouped Mock_M"	"Abundances Grouped noMock_E"	"Abundances Grouped CV in Percent Mock_E"	"Abundances Grouped CV in Percent Mock_M"	"Abundances Grouped CV in Percent noMock_E"	"Quan Info"	"Found in Sample in S72 F72 Sample Mock_E"	"Found in Sample in S75 F75 Sample Mock_E"	"Found in Sample in S78 F78 Sample Mock_E"	"Found in Sample in S81 F81 Sample Mock_E"	"Found in Sample in S84 F84 Sample Mock_E"	"Found in Sample in S87 F87 Sample Mock_E"	"Found in Sample in S73 F73 Sample Mock_M"	"Found in Sample in S76 F76 Sample Mock_M"	"Found in Sample in S79 F79 Sample Mock_M"	"Found in Sample in S82 F82 Sample Mock_M"	"Found in Sample in S85 F85 Sample Mock_M"	"Found in Sample in S88 F88 Sample Mock_M"	"Found in Sample in S71 F71 Sample noMock_E"	"Found in Sample in S74 F74 Sample noMock_E"	"Found in Sample in S77 F77 Sample noMock_E"	"Found in Sample in S80 F80 Sample noMock_E"	"Found in Sample in S83 F83 Sample noMock_E"	"Found in Sample in S86 F86 Sample noMock_E"	"Confidence by Search Engine Sequest HT"	"Percolator q-Value by Search Engine Sequest HT"	"Percolator PEP by Search Engine Sequest HT"	"XCorr by Search Engine Sequest HT"	"Top Apex RT in min"
"36"	"False"	"High"	"[K].AAALLTKQAGTEVK.[R]"	"1xBiotin [K7]"	"3.65859E-06"	"0.000721313"	"1"	"1"	"40"	"Q8VCH8"	"Q8VCH8 [293-306]"	"Q8VCH8 1xBiotin [K299]"	"1"	"1626.88835"	"0.755"	"0.768"	"0.035579145790797"	"0.906515362333117"	"57.77"	"49.17"	"113.2"	"96.1"	"90.7"	"51.00"	"33.02"	"39.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.965E-07"	"4.29"	"40.40"
"36715"	"False"	"High"	"[R].LPKASEEGHLAVSESQLVDAK.[S]"	"1xBiotin [K3]"	"6.47578E-05"	"0.000721313"	"1"	"1"	"9"	"Q921R8-1"	"Q921R8-1 [31-51]"	"Q921R8-1 1xBiotin [K33]"	"1"	"2434.22825"	"0.594"	"1.417"	"0.961201741850067"	"0.960422171904683"	"93.44"	"110.79"	"77.2"	"45.0"	"177.9"	"78.33"	"23.73"	"60.17"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"6.237E-06"	"4.72"	"42.66"
"36662"	"False"	"High"	"[K].LPFAAAQIGNSFR.[N]"	""	"0.00150469"	"0.000721313"	"1"	"1"	"14"	"Q9CZD3"	"Q9CZD3 [309-321]"	""	"0"	"1391.74301"	"130.946"	"2.911"	"0.341168684536133"	"0.91402419503322"	"59.66"	"41.03"	"2.0"	"291.8"	"6.1"	"30.77"	"52.41"	"39.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001269"	"3.47"	"48.28"
"36644"	"False"	"High"	"[K].IPEHDLDPNVTIILKEPVR.[V]"	"1xBiotin [K15]"	"1.74219E-05"	"0.000721313"	"1"	"12"	"25"	"Q99PL5-1"	"Q99PL5-1 [83-101]"	"Q99PL5-1 1xBiotin [K97]"	"1"	"2424.29554"	"17.616"	"1.651"	"0.925138005747468"	"0.983025330649738"	"32.58"	"21.36"	"14.6"	"260.9"	"24.4"	"27.95"	"24.87"	"21.08"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.772E-06"	"5.47"	"53.20"
"36558"	"False"	"High"	"[K].IPAFLNVVDIAGLVK.[G]"	""	"0.000115192"	"0.000721313"	"1"	"2"	"9"	"Q9CZ30-1"	"Q9CZ30-1 [84-98]"	""	"0"	"1568.94104"	"27.578"	"2.758"	"0.925138005747468"	"0.91398852688127"	"115.80"	"46.85"	"9.6"	"266.8"	"23.6"	"37.12"	"80.47"	"36.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.086E-05"	"3.64"	"65.81"
"36541"	"False"	"High"	"[K].LNYKPPPQKSLK.[E]"	"1xBiotin [K]"	"0.000144856"	"0.000721313"	"1"	"1"	"26"	"Q61599"	"Q61599 [21-32]"	"Q61599 1xBiotin [K]"	"1"	"1638.90361"	"0.030"	"0.914"	"0.000102237726853927"	"0.906515362333117"	"41.79"	"30.17"	"151.9"	"4.9"	"143.1"	"18.71"	"32.78"	"49.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.357E-05"	"4.35"	"34.77"
"36538"	"False"	"High"	"[K].LNWLSVDFNNWK.[D]"	""	"9.74551E-05"	"0.000721313"	"1"	"1"	"26"	"Q9R0Q7"	"Q9R0Q7 [96-107]"	""	"0"	"1535.76414"	"268.344"	"7.611"	"0.925138005747468"	"0.906515362333117"	"88.48"	"79.77"	"1.1"	"289.1"	"9.8"	"57.26"	"74.02"	"45.62"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.279E-06"	"3.50"	"60.30"
"36522"	"False"	"High"	"[R].LNVGGTYFLTTR.[Q]"	""	"0.00189194"	"0.000721313"	"1"	"1"	"12"	"Q8VC57"	"Q8VC57 [48-59]"	""	"0"	"1341.71613"	"109.115"	"2.638"	"0.478597253695619"	"0.916215054610739"	"62.72"	"74.94"	"2.4"	"290.5"	"7.0"	"57.13"	"34.53"	"38.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000158"	"2.75"	"45.53"
"36504"	"False"	"High"	"[K].LNTKLVLWDINK.[N]"	"1xBiotin [K4]"	"0.00140565"	"0.000721313"	"1"	"2"	"2"	"Q9EQ06"	"Q9EQ06 [59-70]"	"Q9EQ06 1xBiotin [K62]"	"1"	"1682.92982"	"0.367"	"0.394"	"0.925138005747468"	"0.906515362333117"	"50.14"	"116.46"	"171.5"	"63.1"	"65.4"	"13.42"	"42.94"	"80.93"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"0.0001193"	"3.06"	"58.20"
"36489"	"False"	"High"	"[K].LNSLSIPSVSKR.[V]"	"1xBiotin [K11]"	"0.000324019"	"0.000721313"	"1"	"1"	"23"	"P49070"	"P49070 [71-82]"	"P49070 1xBiotin [K81]"	"1"	"1526.83592"	"0.099"	"0.824"	"0.00707972676313314"	"0.906515362333117"	"143.07"	"54.30"	"151.6"	"14.9"	"133.5"	"27.38"	"156.66"	"37.07"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.937E-05"	"2.40"	"45.40"
"36486"	"False"	"High"	"[K].LNSIGSYYKPWFFK.[H]"	""	"0.000624652"	"0.000721313"	"1"	"1"	"5"	"Q8VCH6"	"Q8VCH6 [293-306]"	""	"0"	"1749.89990"	"101.428"	"1.250"	"0.456381964830803"	"0.906515362333117"	"54.08"	"43.45"	"3.5"	"292.3"	"4.3"	"37.26"	"41.59"	"22.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"5.494E-05"	"4.07"	"53.20"
"36479"	"False"	"High"	"[R].INSDDKNLYLTASK.[K]"	"1xBiotin [K6]"	"1.45399E-06"	"0.000721313"	"1"	"1"	"17"	"Q64008"	"Q64008 [239-252]"	"Q64008 1xBiotin [K244]"	"1"	"1807.88947"	"0.065"	"0.835"	"0.000313771886218394"	"0.906515362333117"	"55.42"	"45.14"	"160.6"	"10.5"	"128.8"	"28.01"	"211.63"	"35.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.634E-07"	"5.27"	"42.47"
"36458"	"False"	"High"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]; 1xOxidation [M]"	"0.000371311"	"0.000721313"	"1"	"1"	"22"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"1"	"1704.76885"	"0.083"	"0.995"	"0.00660472498024896"	"0.907108336447894"	"44.08"	"40.93"	"149.0"	"13.0"	"138.0"	"66.89"	"28.16"	"36.61"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.337E-05"	"3.53"	"36.18"
"36457"	"False"	"High"	"[K].LNQQMAKMMDPR.[V]"	"1xBiotin [K7]"	"0.000217994"	"0.000721313"	"1"	"1"	"21"	"P14576-1"	"P14576-1 [458-469]"	"P14576-1 1xBiotin [K464]"	"1"	"1688.77393"	"0.071"	"1.204"	"0.00338850492409696"	"0.913565512658592"	"91.85"	"75.41"	"139.7"	"5.9"	"154.5"	"55.29"	"64.33"	"50.26"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.007E-05"	"3.44"	"42.56"
"36389"	"False"	"High"	"[K].LNLNGNWLLTASR.[D]"	""	"0.000720257"	"0.000721313"	"1"	"1"	"7"	"Q8K4P0"	"Q8K4P0 [296-308]"	""	"0"	"1471.80159"	"109.117"	"2.076"	"0.427089858136149"	"0.950055801575781"	"75.81"	"105.41"	"3.1"	"290.0"	"6.9"	"40.49"	"52.19"	"68.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"6.304E-05"	"3.01"	"53.08"
"36385"	"False"	"High"	"[R].LNIISNLDCVNEVIGIR.[Q]"	"1xCarbamidomethyl [C9]"	"0.00180054"	"0.000721313"	"1"	"2"	"1"	"Q76MZ3"	"Q76MZ3 [382-398]"	""	"0"	"1942.04262"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001508"	"3.13"	""
"36372"	"False"	"High"	"[K].LNIKFVPPEAR.[T]"	"1xBiotin [K4]"	"0.00118929"	"0.000721313"	"1"	"2"	"13"	"Q3UM18"	"Q3UM18 [78-88]"	"Q3UM18 1xBiotin [K81]"	"1"	"1509.82463"	"0.106"	"0.820"	"0.47240665661602"	"0.906515362333117"	"86.50"	"80.69"	"152.0"	"16.6"	"131.4"	"85.90"	"43.05"	"38.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001019"	"2.95"	"50.12"
"36349"	"False"	"High"	"[K].LNLAFIANLFNK.[Y]"	""	"0.000128776"	"0.000721313"	"1"	"1"	"14"	"Q61233"	"Q61233 [362-373]"	""	"0"	"1377.78890"	"77.659"	"5.492"	"0.656153793965884"	"0.906515362333117"	"64.14"	"39.30"	"4.5"	"271.7"	"23.8"	"38.04"	"68.07"	"33.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.213E-05"	"3.64"	"65.92"
"36295"	"False"	"High"	"[R].LNFYQHSWLPAR.[A]"	""	"0.000707001"	"0.000721313"	"1"	"1"	"33"	"Q9JK81"	"Q9JK81 [231-242]"	""	"0"	"1531.78046"	"136.967"	"4.176"	"0.925138005747468"	"0.906515362333117"	"55.26"	"38.35"	"1.9"	"289.9"	"8.2"	"54.19"	"29.92"	"22.06"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.211E-05"	"3.45"	"45.14"
"36280"	"False"	"High"	"[R].LNENLTVNGGGWSEKSVK.[L]"	"1xBiotin [K]"	"2.8067E-05"	"0.000721313"	"1"	"1"	"45"	"Q80WJ7"	"Q80WJ7 [274-291]"	"Q80WJ7 1xBiotin [K]"	"1"	"2158.05973"	"2.304"	"1.015"	"0.194346116610294"	"0.916215054610739"	"76.23"	"24.50"	"65.7"	"163.7"	"70.6"	"17.60"	"69.33"	"28.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.805E-06"	"4.77"	"44.73"
"36249"	"False"	"High"	"[K].LNCQVIGASVDSHFCHLAWINTPK.[K]"	"2xCarbamidomethyl [C3; C15]"	"0.000981602"	"0.000721313"	"1"	"1"	"5"	"P35700"	"P35700 [69-92]"	""	"0"	"2767.34430"	"1.437"	"3.200"	"0.949662611758987"	"0.906515362333117"	"79.66"	"133.45"	"47.4"	"83.1"	"169.5"	"57.37"	"229.31"	"108.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"8.462E-05"	"3.89"	"50.06"
"36236"	"False"	"High"	"[K].INAKLNYVPLEK.[Q]"	"1xBiotin [K4]"	"6.67944E-05"	"0.000721313"	"1"	"2"	"12"	"Q569Z5-1"	"Q569Z5-1 [905-916]"	"Q569Z5-1 1xBiotin [K908]"	"1"	"1627.88762"	"0.128"	"0.688"	"0.925138005747468"	"0.906515362333117"	"56.24"	"53.24"	"157.4"	"20.8"	"121.8"	"43.38"	"31.59"	"24.80"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.45E-06"	"3.24"	"47.23"
"36215"	"False"	"High"	"[K].LMWLFGCPLVR.[D]"	"1xCarbamidomethyl [C7]"	"0.000720257"	"0.000721313"	"1"	"1"	"9"	"Q5SUR0"	"Q5SUR0 [60-70]"	""	"0"	"1391.73265"	"47.564"	"3.303"	"0.556403604815838"	"0.906515362333117"	"88.93"	"54.49"	"6.9"	"272.8"	"20.3"	"37.56"	"71.37"	"41.37"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.316E-05"	"2.81"	"62.78"
"36107"	"False"	"High"	"[K].LMNFMYFQR.[N]"	"2xOxidation [M2; M5]"	"0.00112483"	"0.000721313"	"1"	"2"	"18"	"Q7TMB8-1"	"Q7TMB8-1 [122-130]"	""	"0"	"1281.57548"	"424.046"	"4.402"	"0.908078062980276"	"0.906515362333117"	"76.20"	"66.54"	"0.7"	"296.9"	"2.4"	"43.19"	"54.25"	"72.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.67E-05"	"2.60"	"40.12"
"35865"	"False"	"High"	"[K].LLYNNVSNFGR.[L]"	""	"0.000407454"	"0.000721313"	"1"	"1"	"18"	"Q68FD5"	"Q68FD5 [1216-1226]"	""	"0"	"1296.66951"	"171.573"	"4.188"	"0.925138005747468"	"0.906515362333117"	"51.45"	"56.63"	"1.7"	"292.0"	"6.3"	"38.52"	"37.68"	"44.20"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.645E-05"	"2.97"	"39.72"
"35848"	"False"	"High"	"[K].LLYDTFSAFGVILQTPK.[I]"	""	"0.000366741"	"0.000721313"	"1"	"1"	"8"	"Q8QZY9"	"Q8QZY9 [115-131]"	""	"0"	"1913.04188"	"1.556"	"2.169"	"0.925138005747468"	"0.906515362333117"	"69.91"	"73.87"	"64.1"	"103.2"	"132.7"	"49.30"	"216.80"	"59.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.308E-05"	"3.26"	"64.51"
"36754"	"False"	"High"	"[K].LPIFFFGTHETAFLGPK.[D]"	""	"0.000115908"	"0.000721313"	"1"	"2"	"8"	"Q99JF8"	"Q99JF8 [40-56]"	""	"0"	"1922.02108"	"85.732"	"2.926"	"0.719298505196754"	"0.916215054610739"	"73.87"	"91.67"	"3.5"	"286.7"	"9.8"	"54.00"	"51.78"	"70.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.096E-05"	"3.65"	"59.66"
"36792"	"False"	"High"	"[R].LPLPYGFSAMQGWR.[V]"	""	"8.55703E-05"	"0.000721313"	"1"	"1"	"18"	"Q61074"	"Q61074 [23-36]"	""	"0"	"1622.81479"	"51.118"	"4.617"	"0.925138005747468"	"0.906515362333117"	"79.21"	"70.29"	"6.1"	"265.6"	"28.3"	"47.92"	"74.83"	"95.71"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.171E-06"	"3.46"	"58.11"
"36793"	"False"	"High"	"[R].LPLPYGFSAMQGWR.[V]"	"1xOxidation [M10]"	"0.000153159"	"0.000721313"	"1"	"1"	"23"	"Q61074"	"Q61074 [23-36]"	""	"0"	"1638.80971"	"222.603"	"3.455"	"0.925138005747468"	"0.906515362333117"	"64.64"	"71.19"	"1.5"	"293.3"	"5.1"	"51.72"	"47.87"	"41.84"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.429E-05"	"2.81"	"52.04"
"36831"	"False"	"High"	"[K].IPNPSKSLLFQDGGK.[G]"	"1xBiotin [K6]"	"9.97771E-06"	"0.000721313"	"1"	"2"	"10"	"P26954"	"P26954 [480-494]"	"P26954 1xBiotin [K485]"	"1"	"1826.94693"	"0.213"	"0.256"	"0.925138005747468"	"0.906515362333117"	"47.34"	"91.94"	"203.9"	"48.5"	"47.6"	"26.64"	"41.58"	"97.48"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.037E-06"	"4.56"	"49.59"
"38482"	"False"	"High"	"[R].LSVVFGEHTLLVTVSGQR.[V]"	""	"0.000174431"	"0.000721313"	"1"	"1"	"4"	"Q8CF66"	"Q8CF66 [66-83]"	""	"0"	"1942.07564"	"1.235"	"1.059"	"0.935694807094878"	"0.906515362333117"	"85.03"	"60.16"	"94.5"	"107.5"	"98.0"	"31.59"	"155.02"	"47.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.622E-05"	"4.05"	"52.43"
"38391"	"False"	"High"	"[K].ISSTLYQATAPVLTPAKITGK.[G]"	"1xBiotin [K]"	"0.00147701"	"0.000721313"	"1"	"1"	"8"	"Q5RL79"	"Q5RL79 [111-131]"	"Q5RL79 1xBiotin [K]"	"1"	"2386.30504"	"0.291"	"0.673"	"0.925138005747468"	"0.906515362333117"	"46.37"	"75.75"	"148.3"	"43.2"	"108.5"	"71.15"	"29.56"	"62.61"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000125"	"4.67"	"53.14"
"38356"	"False"	"High"	"[K].LSSKLSAVSLR.[G]"	"1xBiotin [K4]"	"0.000246737"	"0.000721313"	"1"	"1"	"11"	"Q8BVL3"	"Q8BVL3 [432-442]"	"Q8BVL3 1xBiotin [K435]"	"1"	"1386.77735"	"0.261"	"0.812"	"0.925138005747468"	"0.906515362333117"	"42.62"	"54.83"	"144.4"	"36.2"	"119.5"	"47.06"	"23.19"	"36.26"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.255E-05"	"2.83"	"46.60"
"38346"	"False"	"High"	"[R].LSSFIGAIAIGDLVK.[S]"	""	"0.000939969"	"0.000721313"	"1"	"1"	"8"	"P80314"	"P80314 [26-40]"	""	"0"	"1503.87811"	"29.269"	"1.838"	"0.925138005747468"	"0.948135901442846"	"141.37"	"67.35"	"9.6"	"275.4"	"15.1"	"29.51"	"87.96"	"61.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"8.152E-05"	"3.44"	"61.90"
"38329"	"False"	"High"	"[K].LSSAGLVYLHFGR.[K]"	""	"0.000444354"	"0.000721313"	"1"	"1"	"12"	"Q9JK81"	"Q9JK81 [128-140]"	""	"0"	"1419.77431"	"170.608"	"4.893"	"0.925138005747468"	"0.906515362333117"	"45.44"	"49.44"	"1.6"	"291.4"	"7.0"	"37.32"	"26.78"	"32.73"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.974E-05"	"3.23"	"47.09"
"38327"	"False"	"High"	"[K].LSSAEETAFQTPKPSQTPSVPPLVKTSLFSPK.[L]"	"1xBiotin [K]"	"2.65454E-05"	"0.000721313"	"1"	"1"	"31"	"Q8VCB1"	"Q8VCB1 [405-436]"	"Q8VCB1 1xBiotin [K]"	"1"	"3625.88221"	"0.058"	"3.264"	"0.000486426654376818"	"0.906515362333117"	"74.98"	"52.54"	"66.7"	"5.1"	"228.2"	"48.14"	"230.29"	"25.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.66E-06"	"4.70"	"57.01"
"38132"	"False"	"High"	"[R].ISLPLPTFSSLNLR.[E]"	""	"0.000204904"	"0.000721313"	"1"	"1"	"35"	"P20152"	"P20152 [411-424]"	""	"0"	"1557.89990"	"224.329"	"12.564"	"0.925138005747468"	"0.906515362333117"	"48.03"	"81.42"	"1.3"	"281.5"	"17.2"	"46.09"	"34.94"	"69.38"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.889E-05"	"3.03"	"60.55"
"38095"	"False"	"High"	"[R].LSLGLKCDWFTLEK.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C7]"	"5.24621E-05"	"0.000721313"	"1"	"1"	"18"	"Q60664"	"Q60664 [201-214]"	"Q60664 1xBiotin [K206]"	"1"	"1935.97070"	"0.305"	"3.880"	"0.925138005747468"	"0.906515362333117"	"54.05"	"44.23"	"57.7"	"18.5"	"223.8"	"45.33"	"26.55"	"21.32"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.111E-06"	"3.53"	"62.43"
"38063"	"False"	"High"	"[R].LSKSGENPEQDEAQK.[N]"	"1xBiotin [K3]"	"1.25472E-05"	"0.000721313"	"1"	"1"	"36"	"Q61263"	"Q61263 [7-21]"	"Q61263 1xBiotin [K9]"	"1"	"1885.85963"	"0.737"	"0.677"	"0.0341435143813909"	"0.906515362333117"	"45.48"	"37.29"	"121.0"	"100.7"	"78.3"	"21.48"	"77.51"	"32.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.295E-06"	"4.21"	"29.31"
"38039"	"False"	"High"	"[R].ISKFYPIPTLHSTGS.[-]"	"1xBiotin [K3]"	"0.000422878"	"0.000721313"	"1"	"2"	"14"	"O54988-1"	"O54988-1 [1219-1233]"	"O54988-1 1xBiotin [K1221]"	"1"	"1873.95168"	"0.050"	"1.023"	"0.00352236573631472"	"0.916215054610739"	"76.82"	"72.86"	"127.5"	"8.3"	"164.2"	"62.47"	"38.49"	"35.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"3.781E-05"	"3.56"	"53.59"
"38037"	"False"	"High"	"[R].LSKFQDGSNNVMR.[T]"	"1xBiotin [K3]; 1xOxidation [M12]"	"6.23956E-05"	"0.000721313"	"1"	"2"	"9"	"Q9Z329-1"	"Q9Z329-1 [907-919]"	"Q9Z329-1 1xBiotin [K909]"	"1"	"1737.80470"	"0.257"	"0.435"	"0.925138005747468"	"0.906515362333117"	"54.78"	"89.43"	"165.3"	"46.3"	"88.4"	"40.82"	"40.66"	"69.30"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.027E-06"	"3.51"	"36.55"
"38036"	"False"	"High"	"[R].LSKFQDGSNNVMR.[T]"	"1xBiotin [K3]"	"0.00122667"	"0.000721313"	"1"	"2"	"5"	"Q9Z329-1"	"Q9Z329-1 [907-919]"	"Q9Z329-1 1xBiotin [K909]"	"1"	"1721.80978"	"0.668"	"2.221"	"0.93571056282755"	"0.906515362333117"	"102.85"	"104.61"	"65.4"	"43.3"	"191.3"	"86.68"	"28.62"	"78.00"	""	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001045"	"3.38"	"40.99"
"35846"	"False"	"High"	"[K].LLYDLADQLHAAVGASR.[A]"	""	"5.93796E-05"	"0.000721313"	"1"	"1"	"8"	"Q99LC5"	"Q99LC5 [233-249]"	""	"0"	"1812.96027"	"118.031"	"4.964"	"0.639586559857702"	"0.906515362333117"	"65.28"	"110.82"	"3.6"	"277.1"	"19.3"	"35.12"	"78.97"	"64.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"5.744E-06"	"3.56"	"51.42"
"37997"	"False"	"High"	"[K].ISGSILNELIGLVR.[S]"	""	"0.000136157"	"0.000721313"	"1"	"1"	"4"	"Q6ZQ38"	"Q6ZQ38 [730-743]"	""	"0"	"1483.88425"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.273E-05"	"3.44"	""
"37945"	"False"	"High"	"[R].ISFKGTPTEEQVR.[E]"	"1xBiotin [K4]"	"0.000161938"	"0.000721313"	"1"	"1"	"13"	"Q9Z268"	"Q9Z268 [395-407]"	"Q9Z268 1xBiotin [K398]"	"1"	"1717.85778"	"0.069"	"0.815"	"0.00348156537480939"	"0.906515362333117"	"35.67"	"13.54"	"160.8"	"10.9"	"128.4"	"8.30"	"36.44"	"10.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.511E-05"	"3.62"	"41.37"
"37869"	"False"	"High"	"[K].LSDLLAPISEQIQEVITFR.[E]"	""	"5.23976E-06"	"0.000721313"	"1"	"1"	"10"	"P40124"	"P40124 [100-118]"	""	"0"	"2172.19106"	"1.121"	"0.887"	""	"0.906515362333117"	"52.88"	"64.61"	"101.2"	"124.8"	"74.0"	"31.06"	"38.08"	"143.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.568E-07"	"5.98"	"67.84"
"37838"	"False"	"High"	"[R].LSASSLTMESFAFLWAGGR.[A]"	"1xOxidation [M8]"	"0.000306454"	"0.000721313"	"1"	"2"	"1"	"Q8VEK3"	"Q8VEK3 [282-300]"	""	"0"	"2046.99534"	"0.932"	"1.145"	"0.961956235049573"	"0.906515362333117"	"63.37"	"40.88"	"98.1"	"91.4"	"110.5"	"30.02"	"237.90"	"51.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.776E-05"	"2.71"	"63.70"
"37837"	"False"	"High"	"[R].LSASSLTMESFAFLWAGGR.[A]"	""	"5.82866E-05"	"0.000721313"	"1"	"2"	"4"	"Q8VEK3"	"Q8VEK3 [282-300]"	""	"0"	"2031.00042"	"0.518"	"1.115"	""	"0.906515362333117"	"56.11"	"69.09"	"116.4"	"54.3"	"129.3"	"40.21"	"46.91"	"60.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"5.641E-06"	"4.27"	"67.14"
"37698"	"False"	"High"	"[R].LRPLFSLLNQNNR.[E]"	""	"0.000681217"	"0.000721313"	"1"	"1"	"9"	"Q8BJY1"	"Q8BJY1 [46-58]"	""	"0"	"1584.89688"	"132.602"	"3.975"	"0.925138005747468"	"0.906515362333117"	"34.37"	"35.03"	"2.1"	"289.5"	"8.4"	"42.68"	"22.45"	"29.79"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"5.983E-05"	"3.53"	"48.54"
"37584"	"False"	"High"	"[K].LRECLPLIIFLR.[N]"	"1xCarbamidomethyl [C4]"	"0.000490635"	"0.000721313"	"1"	"1"	"14"	"P62702"	"P62702 [38-49]"	""	"1"	"1542.91887"	"201.618"	"6.994"	"0.925138005747468"	"0.906515362333117"	"52.87"	"77.44"	"1.5"	"289.3"	"9.2"	"38.15"	"38.32"	"70.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.367E-05"	"3.89"	"60.58"
"37262"	"False"	"High"	"[R].LQKGEFILATR.[G]"	"1xBiotin [K3]"	"0.000458327"	"0.000721313"	"1"	"4"	"11"	"Q9CPV7"	"Q9CPV7 [351-361]"	"Q9CPV7 1xBiotin [K353]"	"1"	"1501.81955"	"0.138"	"0.810"	"0.925138005747468"	"0.906515362333117"	"60.07"	"40.94"	"154.2"	"19.7"	"126.1"	"41.67"	"38.19"	"26.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.08E-05"	"3.18"	"49.98"
"37180"	"False"	"High"	"[R].IQEIQKAIELFSVGQGPAK.[T]"	"1xBiotin [K6]"	"0.000428147"	"0.000721313"	"1"	"1"	"7"	"O70310"	"O70310 [89-107]"	"O70310 1xBiotin [K94]"	"1"	"2282.22131"	"0.959"	"1.662"	"0.925138005747468"	"0.94306020666367"	"31.18"	"85.37"	"93.0"	"88.8"	"118.2"	"27.84"	"33.40"	"71.91"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.838E-05"	"4.54"	"62.60"
"37067"	"False"	"High"	"[K].IQAKLPGIAK.[K]"	"1xBiotin [K4]"	"0.000267423"	"0.000721313"	"1"	"5"	"8"	"Q9ES97-1"	"Q9ES97-1 [951-960]"	"Q9ES97-1 1xBiotin [K954]"	"1"	"1264.74459"	"0.124"	"0.627"	"0.00767873590518364"	"0.906515362333117"	"42.88"	"42.91"	"176.8"	"22.0"	"101.2"	"19.08"	"42.66"	"35.89"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.445E-05"	"3.31"	"41.90"
"37033"	"False"	"High"	"[R].IPWFQYPIIYDIR.[A]"	""	"6.47578E-05"	"0.000721313"	"1"	"1"	"24"	"O35129"	"O35129 [72-84]"	""	"0"	"1723.92064"	"397.036"	"13.472"	"0.925138005747468"	"0.906515362333117"	"43.59"	"41.28"	"0.7"	"288.0"	"11.2"	"28.78"	"49.67"	"30.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.264E-06"	"3.28"	"64.37"
"36907"	"False"	"High"	"[K].IPSAVSTVSMQNIHPKAVTSDR.[I]"	"1xBiotin [K16]"	"0.000390169"	"0.000721313"	"1"	"1"	"3"	"Q61165"	"Q61165 [601-622]"	"Q61165 1xBiotin [K616]"	"1"	"2564.29595"	"0.747"	"1.037"	"0.925138005747468"	"0.906515362333117"	"67.45"	"81.56"	"93.7"	"73.8"	"132.5"	"48.35"	"47.86"	"50.39"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.509E-05"	"3.84"	"43.54"
"36857"	"False"	"High"	"[R].LPPNTNDEVDEDPTGNKALWDR.[G]"	"1xBiotin [K17]"	"0.000531764"	"0.000721313"	"1"	"2"	"15"	"Q921M3-1"	"Q921M3-1 [1058-1079]"	"Q921M3-1 1xBiotin [K1074]"	"1"	"2722.24133"	"0.209"	"1.439"	"0.925138005747468"	"0.969227082684272"	"95.33"	"73.13"	"110.8"	"23.8"	"165.4"	"88.43"	"65.01"	"31.11"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.721E-05"	"3.30"	"46.82"
"37972"	"False"	"High"	"[R].LSGGGDWHIAYVLLYGPR.[R]"	""	"1.36836E-05"	"0.000721313"	"1"	"1"	"18"	"Q9JMA1"	"Q9JMA1 [465-482]"	""	"0"	"1974.02321"	"233.025"	"8.883"	"0.925138005747468"	"0.906515362333117"	"76.65"	"59.64"	"1.6"	"284.9"	"13.5"	"53.73"	"62.12"	"35.14"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.4E-06"	"4.38"	"59.89"
"35770"	"False"	"High"	"[R].LIVIGFISGYQSPTGLSPIK.[A]"	""	"0.000738318"	"0.000721313"	"1"	"1"	"1"	"Q8BGC4"	"Q8BGC4 [266-285]"	""	"0"	"2090.18960"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"6.47E-05"	"2.71"	""
"35685"	"False"	"High"	"[R].IITITGTQDQIQNAQYLLQNSVK.[Q]"	""	"6.84696E-05"	"0.000721313"	"1"	"3"	"14"	"P61979"	"P61979 [434-456]"	""	"0"	"2589.38826"	"368.118"	"13.508"	"0.925138005747468"	"0.906515362333117"	"53.30"	"70.01"	"0.9"	"288.7"	"10.4"	"37.61"	"52.16"	"65.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.578E-06"	"5.27"	"57.06"
"35656"	"False"	"High"	"[R].LLTGLKTAAK.[S]"	"1xBiotin [K6]"	"0.001432"	"0.000721313"	"1"	"1"	"7"	"Q91WC9"	"Q91WC9 [181-190]"	"Q91WC9 1xBiotin [K186]"	"1"	"1241.72861"	"0.078"	"0.594"	"0.00472417018594241"	"0.906515362333117"	"66.76"	"58.26"	"187.2"	"18.4"	"94.4"	"38.57"	"47.27"	"50.16"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000121"	"3.10"	"41.30"
"34593"	"False"	"High"	"[K].ILGSGIYSSSVLHGMVFK.[K]"	""	"0.000216648"	"0.000721313"	"1"	"1"	"4"	"P42932"	"P42932 [207-224]"	""	"0"	"1895.00953"	"0.932"	"2.576"	"0.925138005747468"	"0.916215054610739"	"140.70"	"45.62"	"68.8"	"56.7"	"174.5"	"25.13"	"143.75"	"39.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"1.992E-05"	"3.96"	"52.59"
"34582"	"False"	"High"	"[K].LLGQFTLIGIPPAPR.[G]"	""	"0.000129576"	"0.000721313"	"1"	"1"	"15"	"P38647"	"P38647 [499-513]"	""	"0"	"1592.95227"	"79.269"	"3.781"	"0.463973682624453"	"0.906515362333117"	"54.02"	"69.90"	"3.7"	"286.1"	"10.3"	"46.95"	"16.92"	"46.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.216E-05"	"3.61"	"57.68"
"34567"	"False"	"High"	"[K].IIGNLLYYR.[Y]"	""	"0.00147701"	"0.000721313"	"1"	"1"	"20"	"Q9JKF1"	"Q9JKF1 [1186-1194]"	""	"0"	"1124.64626"	"140.392"	"3.943"	"0.925138005747468"	"0.906515362333117"	"28.18"	"22.64"	"2.0"	"289.9"	"8.1"	"21.00"	"20.12"	"13.60"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001252"	"3.19"	"46.57"
"34519"	"False"	"High"	"[K].LLGGVTIAQGGVLPNIQAVLLPK.[K]"	""	"7.84637E-05"	"0.000721313"	"1"	"2"	"29"	"Q64522"	"Q64522 [97-119]"	""	"0"	"2271.37986"	"305.561"	"21.094"	"0.925138005747468"	"0.906515362333117"	"78.32"	"78.51"	"0.8"	"283.0"	"16.2"	"52.15"	"52.61"	"50.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.529E-06"	"4.72"	"64.15"
"34465"	"False"	"High"	"[R].ILFRPVASQLPR.[I]"	""	"0.000436176"	"0.000721313"	"1"	"1"	"22"	"P67778"	"P67778 [94-105]"	""	"0"	"1396.84233"	"148.953"	"6.489"	"0.925138005747468"	"0.906515362333117"	"80.51"	"63.66"	"2.4"	"284.8"	"12.8"	"52.10"	"87.10"	"59.92"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.891E-05"	"3.48"	"40.21"
"34446"	"False"	"High"	"[K].ILFIFIDSDHTDNQR.[I]"	""	"0.000196211"	"0.000721313"	"1"	"1"	"2"	"P09103"	"P09103 [288-302]"	""	"0"	"1833.91299"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.815E-05"	"3.14"	""
"34419"	"False"	"High"	"[R].LIFAGKQLEDGR.[T]"	"1xBiotin [K6]"	"0.000246737"	"0.000721313"	"1"	"4"	"11"	"P62984"	"P62984 [43-54]"	"P62984 1xBiotin [K48]"	"1"	"1572.82027"	"0.677"	"1.009"	"0.925138005747468"	"0.906515362333117"	"48.41"	"73.27"	"122.4"	"86.3"	"91.3"	"37.60"	"32.52"	"70.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"2.257E-05"	"3.25"	"48.32"
"34377"	"False"	"High"	"[R].LIEPGSKNPHLITNWGPAAFTQAELEER.[E]"	"1xBiotin [K7]"	"2.05928E-05"	"0.000721313"	"1"	"1"	"7"	"Q6A028"	"Q6A028 [547-574]"	"Q6A028 1xBiotin [K553]"	"1"	"3344.67322"	"1.387"	"7.184"	""	"0.906515362333117"	"42.15"	"44.93"	"32.2"	"46.5"	"221.2"	"38.69"	"37.50"	"32.71"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.083E-06"	"4.37"	"57.45"
"34216"	"False"	"High"	"[K].LLDGWWVVR.[K]"	""	"0.00220851"	"0.000721313"	"1"	"1"	"24"	"Q09014"	"Q09014 [259-267]"	""	"0"	"1143.63094"	"141.337"	"3.486"	"0.925138005747468"	"0.906515362333117"	"61.59"	"63.81"	"1.8"	"292.2"	"6.0"	"41.58"	"45.95"	"60.02"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001826"	"2.73"	"57.27"
"34151"	"False"	"High"	"[R].IICEKTLSFPK.[Q]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.000455498"	"0.000721313"	"1"	"3"	"12"	"Q08EC4-1"	"Q08EC4-1 [142-152]"	"Q08EC4-1 1xBiotin [K146]"	"1"	"1561.81168"	"0.211"	"0.897"	"0.925138005747468"	"0.906777072223237"	"57.59"	"48.42"	"134.9"	"31.2"	"133.9"	"31.87"	"45.74"	"38.89"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.068E-05"	"2.98"	"47.89"
"34054"	"False"	"High"	"[R].LLAETHYQLGLAYGYNSQYDEAVAQFGK.[S]"	""	"1.35152E-05"	"0.000721313"	"1"	"2"	"2"	"Q99MD9-1"	"Q99MD9-1 [568-595]"	""	"0"	"3149.52145"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.386E-06"	"5.03"	""
"34018"	"False"	"High"	"[K].IKYPENFFLLR.[G]"	""	"0.00123429"	"0.000721313"	"1"	"3"	"9"	"P63087"	"P63087 [112-122]"	""	"1"	"1439.80455"	"225.407"	"4.099"	"0.925138005747468"	"0.906515362333117"	"56.39"	"72.96"	"1.3"	"293.4"	"5.3"	"49.27"	"32.69"	"58.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001052"	"3.06"	"51.33"
"34594"	"False"	"High"	"[K].ILGSGIYSSSVLHGMVFK.[K]"	"1xOxidation [M15]"	"0.00202522"	"0.000721313"	"1"	"1"	"7"	"P42932"	"P42932 [207-224]"	""	"0"	"1911.00445"	"123.384"	"2.921"	"0.446957849641584"	"0.913565512658592"	"55.12"	"92.75"	"2.5"	"290.8"	"6.7"	"37.71"	"48.80"	"68.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"0.0001682"	"2.65"	"46.89"
"33994"	"False"	"High"	"[R].LKVPPAINQFTQALDR.[Q]"	""	"7.51349E-05"	"0.000721313"	"1"	"1"	"3"	"P12970"	"P12970 [74-89]"	""	"1"	"1811.01739"	"8.333"	"2.604"	"0.997362792207666"	"0.906515362333117"	"162.11"	"67.15"	"25.5"	"208.7"	"65.7"	"50.12"	"116.30"	"49.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"7.221E-06"	"4.63"	"52.58"
"33921"	"False"	"High"	"[R].LKSLALDIDRDTEDQNR.[Y]"	"1xBiotin [K2]"	"0.000771022"	"0.000721313"	"1"	"1"	"20"	"O35153"	"O35153 [35-51]"	"O35153 1xBiotin [K36]"	"2"	"2228.09757"	"0.005"	"0.874"	"2.30196890285531E-06"	"0.906515362333117"	"56.50"	"44.79"	"169.6"	"0.8"	"129.6"	"30.31"	"55.17"	"31.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.715E-05"	"2.08"	"45.37"
"33886"	"False"	"High"	"[R].LKQQSELQSQVR.[Y]"	"1xBiotin [K2]"	"0.00066045"	"0.000721313"	"1"	"1"	"9"	"Q61792"	"Q61792 [74-85]"	"Q61792 1xBiotin [K75]"	"1"	"1669.86901"	"0.244"	"0.328"	"0.925138005747468"	"0.906515362333117"	"64.55"	"68.04"	"201.2"	"43.3"	"55.5"	"48.14"	"41.38"	"42.49"	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.812E-05"	"2.79"	"33.32"
"33861"	"False"	"High"	"[K].LKPVHGLIFLFK.[W]"	""	"5.79267E-05"	"0.000721313"	"1"	"2"	"15"	"Q9WUP7-1"	"Q9WUP7-1 [46-57]"	""	"0"	"1411.88240"	"80.475"	"1.963"	"0.994201151226993"	"0.994581636647799"	"67.77"	"81.62"	"4.2"	"286.7"	"9.1"	"80.37"	"38.89"	"37.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"5.615E-06"	"3.28"	"50.06"
"33809"	"False"	"High"	"[R].IKNVLITPGK.[S]"	"1xBiotin [K2]"	"0.000441611"	"0.000721313"	"1"	"1"	"13"	"Q8BHE0"	"Q8BHE0 [289-298]"	"Q8BHE0 1xBiotin [K290]"	"1"	"1308.77080"	"0.163"	"0.845"	"0.925138005747468"	"0.906515362333117"	"59.99"	"57.63"	"150.0"	"26.4"	"123.7"	"39.19"	"44.50"	"67.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.949E-05"	"3.38"	"42.39"
"33803"	"False"	"High"	"[R].LKNITLDDASAPR.[L]"	"1xBiotin [K2]"	"0.00222222"	"0.000721313"	"1"	"1"	"9"	"Q91W50"	"Q91W50 [757-769]"	"Q91W50 1xBiotin [K758]"	"1"	"1639.84722"	"0.189"	"0.734"	"0.925138005747468"	"0.906515362333117"	"74.23"	"108.30"	"145.3"	"37.6"	"117.1"	"68.77"	"46.50"	"37.77"	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001834"	"3.18"	"42.78"
"33779"	"False"	"High"	"[R].IKLVEEPPTTKPR.[S]"	"1xBiotin [K2]"	"0.00137127"	"0.000721313"	"1"	"1"	"10"	"Q9CZE3"	"Q9CZE3 [207-219]"	"Q9CZE3 1xBiotin [K208]"	"1"	"1733.96185"	"0.206"	"0.807"	"0.925138005747468"	"0.906515362333117"	"34.65"	"42.08"	"149.9"	"33.0"	"117.2"	"25.36"	"29.65"	"33.95"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001163"	"2.59"	"36.24"
"33765"	"False"	"High"	"[K].IKIQLANEEYKR.[I]"	"1xBiotin [K2]"	"0.000159944"	"0.000721313"	"1"	"1"	"15"	"Q5SYH2"	"Q5SYH2 [106-117]"	"Q5SYH2 1xBiotin [K107]"	"2"	"1730.92580"	"0.046"	"0.730"	"0.000380997157912257"	"0.906515362333117"	"60.14"	"42.62"	"168.4"	"7.7"	"123.9"	"33.91"	"45.60"	"26.71"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.486E-05"	"3.99"	"38.71"
"33764"	"False"	"High"	"[K].IKIQLANEEYK.[R]"	"1xBiotin [K2]"	"0.00161072"	"0.000721313"	"1"	"1"	"5"	"Q5SYH2"	"Q5SYH2 [106-116]"	"Q5SYH2 1xBiotin [K107]"	"1"	"1574.82469"	"0.242"	"0.435"	"0.925138005747468"	"0.906515362333117"	"52.78"	"54.38"	"182.4"	"42.0"	"75.6"	"12.27"	"51.42"	"68.83"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001356"	"2.84"	"42.70"
"33705"	"False"	"High"	"[K].IKHVQNQVDEVIDVMQENITK.[V]"	"1xBiotin [K2]"	"1.03427E-06"	"0.000721313"	"1"	"1"	"8"	"O70480"	"O70480 [53-73]"	"O70480 1xBiotin [K54]"	"1"	"2706.35895"	"0.965"	"3.467"	""	"0.906515362333117"	"36.50"	"96.90"	"50.9"	"46.7"	"202.3"	"29.29"	"40.14"	"67.04"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.175E-07"	"5.96"	"59.03"
"33685"	"False"	"High"	"[K].LKGSAPSDMLDSLTTIPELK.[D]"	"1xBiotin [K2]"	"0.00182297"	"0.000721313"	"1"	"1"	"6"	"Q8K1B8"	"Q8K1B8 [334-353]"	"Q8K1B8 1xBiotin [K335]"	"1"	"2342.19820"	"0.958"	"0.966"	"0.925138005747468"	"0.906515362333117"	"20.44"	"25.10"	"102.9"	"99.5"	"97.7"	"17.91"	"25.97"	"35.49"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001522"	"4.39"	"61.02"
"33674"	"False"	"High"	"[K].IKGIHPYHSLSYTSGDTATDSPVHVGR.[A]"	"1xBiotin [K2]"	"0.000747518"	"0.000721313"	"1"	"5"	"2"	"A2AAE1-1"	"A2AAE1-1 [2253-2279]"	"A2AAE1-1 1xBiotin [K2254]"	"1"	"3121.51599"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"6.513E-05"	"3.17"	""
"33626"	"False"	"High"	"[R].LKELGPLPSHDAGR.[L]"	"1xBiotin [K2]"	"3.99488E-05"	"0.000721313"	"1"	"1"	"16"	"Q921R8-1"	"Q921R8-1 [17-30]"	"Q921R8-1 1xBiotin [K18]"	"1"	"1715.88975"	"0.047"	"0.979"	"8.71975573264604E-05"	"0.913565512658592"	"78.75"	"31.17"	"141.7"	"6.5"	"151.7"	"49.00"	"52.70"	"25.33"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.923E-06"	"4.14"	"39.19"
"33939"	"False"	"High"	"[K].LKSQWNNDNPLFK.[S]"	"1xBiotin [K2]"	"1.62746E-05"	"0.000721313"	"1"	"1"	"25"	"P11835"	"P11835 [745-757]"	"P11835 1xBiotin [K746]"	"1"	"1829.90031"	"0.014"	"0.986"	"1.5422364838643E-05"	"0.91398852688127"	"53.33"	"26.85"	"147.7"	"2.3"	"149.9"	"38.73"	"63.24"	"11.91"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.658E-06"	"4.02"	"49.18"
"38485"	"False"	"High"	"[K].ISVVVETVYTHVLHPYPTQITQSEK.[Q]"	""	"0.00057634"	"0.000721313"	"1"	"1"	"2"	"Q91YQ5"	"Q91YQ5 [128-152]"	""	"0"	"2868.51418"	"1.518"	"0.905"	"0.925138005747468"	"0.906515362333117"	"61.68"	"71.47"	"90.2"	"129.1"	"80.7"	"45.43"	"191.70"	"56.37"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"5.079E-05"	"4.18"	"52.60"
"34698"	"False"	"High"	"[K].LLKGIDLGSLVDSDVDLK.[I]"	"1xBiotin [K3]"	"2.09531E-06"	"0.000721313"	"1"	"2"	"22"	"Q3U1N2-1"	"Q3U1N2-1 [392-409]"	"Q3U1N2-1 1xBiotin [K394]"	"1"	"2126.14133"	"0.070"	"1.486"	"0.00575529233091854"	"0.971505552027982"	"42.95"	"54.46"	"120.5"	"8.4"	"171.0"	"17.87"	"36.49"	"49.99"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.312E-07"	"3.61"	"61.85"
"34800"	"False"	"High"	"[K].ILLANFLAQTEALMK.[G]"	""	"5.37118E-06"	"0.000721313"	"1"	"1"	"7"	"P06745"	"P06745 [424-438]"	""	"0"	"1675.94514"	"1.043"	"3.158"	"0.172585601411963"	"0.906515362333117"	"60.24"	"93.43"	"50.0"	"52.1"	"197.9"	"40.11"	"238.74"	"119.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.702E-07"	"4.64"	"67.48"
"35625"	"False"	"High"	"[K].IISYAQGFMLLR.[Q]"	"1xOxidation [M9]"	"0.000165999"	"0.000721313"	"1"	"1"	"17"	"Q9DCD0"	"Q9DCD0 [332-343]"	""	"0"	"1427.77153"	"240.541"	"3.610"	"0.925138005747468"	"0.906515362333117"	"41.43"	"63.70"	"1.2"	"294.5"	"4.2"	"32.55"	"26.98"	"65.61"	"MandatoryModificationMissing"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.542E-05"	"3.14"	"52.77"
"35624"	"False"	"High"	"[K].IISYAQGFMLLR.[Q]"	""	"0.000509206"	"0.000721313"	"1"	"1"	"12"	"Q9DCD0"	"Q9DCD0 [332-343]"	""	"0"	"1411.77662"	"68.763"	"3.023"	"0.458034939319086"	"0.906515362333117"	"95.37"	"73.40"	"5.3"	"277.0"	"17.7"	"55.98"	"88.85"	"44.74"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.52E-05"	"3.53"	"56.91"
"35623"	"False"	"High"	"[K].LISWYDNEYGYSNR.[V]"	""	"8.04317E-05"	"0.000721313"	"1"	"1"	"29"	"P16858"	"P16858 [308-321]"	""	"0"	"1779.79729"	"130.311"	"4.387"	"0.925138005747468"	"0.906515362333117"	"52.90"	"69.31"	"2.7"	"288.3"	"9.0"	"41.52"	"33.82"	"53.98"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.68E-06"	"3.67"	"45.27"
"35587"	"False"	"High"	"[R].LLSQVADILFQTAK.[N]"	""	"0.000143073"	"0.000721313"	"1"	"1"	"4"	"P13439"	"P13439 [49-62]"	""	"0"	"1546.88392"	"1.290"	"2.117"	"0.925138005747468"	"0.998316466510713"	"85.27"	"75.42"	"66.7"	"100.7"	"132.6"	"48.74"	"186.07"	"64.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.338E-05"	"3.03"	"61.51"
"35555"	"False"	"High"	"[R].ILSISADIETIGEILKK.[I]"	""	"0.000407454"	"0.000721313"	"1"	"3"	"7"	"P61979"	"P61979 [87-103]"	""	"1"	"1843.07866"	"6.506"	"2.159"	"0.977306680245685"	"0.977260755902588"	"190.24"	"51.33"	"32.7"	"201.0"	"66.3"	"29.55"	"118.36"	"50.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.65E-05"	"3.52"	"64.55"
"35554"	"False"	"High"	"[R].ILSISADIETIGEILK.[K]"	""	"0.00223601"	"0.000721313"	"1"	"3"	"3"	"P61979"	"P61979 [87-102]"	""	"0"	"1714.98369"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001845"	"2.62"	""
"35396"	"False"	"High"	"[K].IIQTPGLWESENQNKGVK.[L]"	"1xBiotin [K]"	"0.000163956"	"0.000721313"	"1"	"1"	"12"	"P35293"	"P35293 [169-186]"	"P35293 1xBiotin [K]"	"1"	"2267.14888"	"0.230"	"0.879"	"0.925138005747468"	"0.906515362333117"	"30.90"	"33.35"	"141.2"	"32.1"	"126.7"	"12.41"	"37.66"	"30.30"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.521E-05"	"5.10"	"46.18"
"35382"	"False"	"High"	"[R].LLQQVAQIYQSIEFSR.[L]"	""	"5.75691E-05"	"0.000721313"	"1"	"1"	"11"	"P23116"	"P23116 [439-454]"	""	"0"	"1923.03344"	"6.559"	"1.745"	"0.964150902908502"	"0.963188257025838"	"185.17"	"71.58"	"32.3"	"212.2"	"55.5"	"31.21"	"120.66"	"56.15"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.591E-06"	"4.26"	"60.22"
"35325"	"False"	"High"	"[R].LIQFHFHWGSSDGQGSEHTVNK.[K]"	""	"2.58959E-05"	"0.000721313"	"1"	"1"	"32"	"P00920"	"P00920 [90-111]"	""	"0"	"2511.17999"	"789.991"	"36.209"	"0.490921933507494"	"0.0863830436822202"	"138.40"	"129.13"	"0.4"	"286.1"	"13.5"	"183.00"	"94.09"	"53.08"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.592E-06"	"4.29"	"41.72"
"35277"	"False"	"High"	"[K].IIPTSASKTEAPAAAK.[S]"	"1xBiotin [K]"	"2.49513E-05"	"0.000721313"	"1"	"1"	"27"	"Q9QY76"	"Q9QY76 [140-155]"	"Q9QY76 1xBiotin [K]"	"1"	"1781.94660"	"0.033"	"0.771"	"7.31039480172466E-05"	"0.906515362333117"	"45.94"	"51.97"	"171.7"	"5.5"	"122.7"	"14.96"	"36.96"	"43.88"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.504E-06"	"3.67"	"35.05"
"35209"	"False"	"High"	"[R].IIPGFMCQGGDFTR.[H]"	"1xCarbamidomethyl [C7]"	"0.000656373"	"0.000721313"	"1"	"1"	"19"	"P17742"	"P17742 [56-69]"	""	"0"	"1598.74539"	"41.040"	"5.281"	"0.982626859977453"	"0.906515362333117"	"101.56"	"61.80"	"6.0"	"260.3"	"33.8"	"58.25"	"87.66"	"30.16"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.757E-05"	"2.70"	"47.05"
"35117"	"False"	"High"	"[R].ILNKAVYLFYGTK.[D]"	"1xBiotin [K4]"	"2.5736E-05"	"0.000721313"	"1"	"1"	"22"	"Q9R1C6"	"Q9R1C6 [398-410]"	"Q9R1C6 1xBiotin [K401]"	"1"	"1755.95022"	"0.112"	"0.654"	"0.925138005747468"	"0.906515362333117"	"55.73"	"75.17"	"155.1"	"21.8"	"123.1"	"45.92"	"45.27"	"59.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.584E-06"	"3.80"	"59.21"
"34745"	"False"	"High"	"[R].IIKPFPAPQTPGR.[L]"	"1xBiotin [K3]"	"0.000628531"	"0.000721313"	"1"	"1"	"69"	"Q9Z0F8"	"Q9Z0F8 [726-738]"	"Q9Z0F8 1xBiotin [K728]"	"0"	"1647.90394"	"0.005"	"0.834"	"1.81231113835501E-06"	"0.906515362333117"	"59.32"	"43.52"	"154.0"	"0.9"	"145.1"	"73.14"	"42.34"	"49.35"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.52E-05"	"2.77"	"46.03"
"35095"	"False"	"High"	"[R].ILMVGLDAAGKTTILYK.[L]"	"1xBiotin [K11]"	"0.000211348"	"0.000721313"	"1"	"5"	"3"	"P61205"	"P61205 [20-36]"	"P61205 1xBiotin [K30]"	"1"	"2033.11737"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"1.947E-05"	"3.94"	""
"35063"	"False"	"High"	"[R].ILMAINGKVFDVTK.[G]"	"1xBiotin [K8]"	"1.62746E-05"	"0.000721313"	"1"	"1"	"12"	"O55022"	"O55022 [89-102]"	"O55022 1xBiotin [K96]"	"1"	"1774.95941"	"0.223"	"1.169"	"0.925138005747468"	"0.916215054610739"	"56.52"	"75.21"	"118.5"	"25.6"	"155.9"	"21.21"	"47.32"	"60.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.654E-06"	"3.82"	"55.16"
"35049"	"False"	"High"	"[K].LLIVSNPVDILTYVAWK.[I]"	""	"2.12404E-05"	"0.000721313"	"1"	"1"	"20"	"P06151"	"P06151 [133-149]"	""	"0"	"1944.12046"	"454.097"	"8.206"	"0.925138005747468"	"0.906515362333117"	"121.17"	"195.05"	"0.7"	"294.6"	"4.7"	"38.60"	"82.49"	"110.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.143E-06"	"4.22"	"67.85"
"35035"	"False"	"High"	"[K].LLLVFWEIVPK.[T]"	""	"0.000548485"	"0.000721313"	"1"	"1"	"12"	"Q9JIF7"	"Q9JIF7 [77-87]"	""	"0"	"1356.82897"	"51.108"	"1.442"	"0.566803983447421"	"0.906515362333117"	"65.62"	"40.60"	"6.3"	"285.4"	"8.3"	"41.31"	"58.60"	"12.89"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.852E-05"	"2.53"	"67.27"
"34983"	"False"	"High"	"[K].LILPYVELDLHSYDLGIENR.[D]"	""	"4.4384E-05"	"0.000721313"	"1"	"1"	"7"	"O88844"	"O88844 [30-49]"	""	"0"	"2372.24964"	"36.740"	"2.101"	"0.925138005747468"	"0.969227082684272"	"34.46"	"68.64"	"6.8"	"278.8"	"14.4"	"19.55"	"30.10"	"53.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.36E-06"	"4.20"	"61.52"
"34966"	"False"	"High"	"[K].LLLPKADLGGSEVGVSQAPWHLPK.[S]"	"1xBiotin [K5]"	"3.15328E-06"	"0.000721313"	"1"	"1"	"5"	"Q6NSR3"	"Q6NSR3 [269-292]"	"Q6NSR3 1xBiotin [K273]"	"1"	"2738.46982"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"3.432E-07"	"4.72"	""
"34960"	"False"	"High"	"[R].LLLPGELAKHAVSEGTK.[A]"	"1xBiotin [K]"	"0.000800205"	"0.000721313"	"2"	"13"	"11"	"Q64525; Q6ZWY9"	"Q64525 [101-117]; Q6ZWY9 [101-117]"	"Q64525 1xBiotin [K]; Q6ZWY9 1xBiotin [K]"	"1"	"1989.08376"	"0.072"	"0.772"	"0.000188249581914294"	"0.906515362333117"	"47.62"	"43.57"	"150.9"	"11.3"	"137.8"	"37.05"	"161.61"	"29.01"	"NotUnique"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"6.975E-05"	"2.30"	"50.50"
"34911"	"False"	"High"	"[R].ILILGLDGAGKTTILYR.[L]"	"1xBiotin [K11]"	"0.000332146"	"0.000721313"	"1"	"1"	"11"	"P61211"	"P61211 [20-36]"	"P61211 1xBiotin [K30]"	"1"	"2043.16709"	"0.746"	"0.787"	"0.925138005747468"	"0.906515362333117"	"58.64"	"36.63"	"124.6"	"82.8"	"92.6"	"21.57"	"48.81"	"35.90"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.003E-05"	"3.46"	"61.23"
"34909"	"False"	"High"	"[K].ILIIGGSIANFTNVAATFK.[G]"	""	"9.86696E-05"	"0.000721313"	"1"	"1"	"4"	"Q91V92"	"Q91V92 [337-355]"	""	"0"	"1950.10587"	"1.122"	"0.911"	"0.925138005747468"	""	"114.43"	"62.38"	"110.7"	"81.5"	"107.8"	"45.79"	"176.72"	"39.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"9.38E-06"	"3.29"	"62.85"
"34892"	"False"	"High"	"[K].LILKNENVDR.[H]"	"1xBiotin [K4]"	"0.000583522"	"0.000721313"	"1"	"1"	"19"	"Q9D5T0"	"Q9D5T0 [271-280]"	"Q9D5T0 1xBiotin [K274]"	"1"	"1439.76751"	"0.020"	"0.934"	"3.14739121766013E-05"	"0.906515362333117"	"55.89"	"71.71"	"171.3"	"3.7"	"125.0"	"34.53"	"52.85"	"67.23"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.169E-05"	"2.80"	"39.97"
"34878"	"False"	"High"	"[R].LLIHQSLAGGIIGVK.[G]"	""	"9.56612E-05"	"0.000721313"	"1"	"3"	"10"	"P61979"	"P61979 [149-163]"	""	"0"	"1518.93662"	"114.469"	"4.383"	"0.925138005747468"	"0.906515362333117"	"69.63"	"61.74"	"2.4"	"288.6"	"9.0"	"58.66"	"37.78"	"38.04"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.105E-06"	"3.19"	"44.35"
"34809"	"False"	"High"	"[R].ILLAVNGKVFDVTK.[G]"	"1xBiotin [K8]"	"0.000163956"	"0.000721313"	"1"	"1"	"12"	"Q80UU9"	"Q80UU9 [113-126]"	"Q80UU9 1xBiotin [K120]"	"1"	"1742.98734"	"0.262"	"0.450"	"0.925138005747468"	"0.906515362333117"	"48.96"	"99.20"	"178.5"	"46.1"	"75.4"	"48.33"	"34.06"	"96.42"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.528E-05"	"3.68"	"55.42"
"34801"	"False"	"High"	"[K].ILLANFLAQTEALMK.[G]"	"1xOxidation [M14]"	"7.60713E-05"	"0.000721313"	"1"	"1"	"16"	"P06745"	"P06745 [424-438]"	""	"0"	"1691.94005"	"134.637"	"4.454"	"0.337587057061506"	"0.906515362333117"	"84.71"	"117.72"	"1.7"	"287.5"	"10.8"	"64.23"	"54.26"	"86.67"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.295E-06"	"3.91"	"61.39"
"35064"	"False"	"High"	"[R].ILMAINGKVFDVTK.[G]"	"1xBiotin [K8]; 1xOxidation [M3]"	"7.0187E-05"	"0.000721313"	"1"	"1"	"4"	"O55022"	"O55022 [89-102]"	"O55022 1xBiotin [K96]"	"1"	"1790.95432"	"0.357"	"0.518"	"0.925138005747468"	"0.906515362333117"	"34.09"	"87.77"	"148.9"	"57.0"	"94.1"	"33.78"	"21.77"	"73.11"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"6.748E-06"	"4.19"	"51.36"
"33623"	"False"	"High"	"[R].LKELEESAAIQK.[I]"	"1xBiotin [K2]"	"2.84168E-05"	"0.000721313"	"1"	"2"	"29"	"Q8R2Y0-1"	"Q8R2Y0-1 [188-199]"	"Q8R2Y0-1 1xBiotin [K189]"	"1"	"1584.83017"	"0.020"	"0.925"	"3.14739121766013E-05"	"0.906515362333117"	"60.81"	"25.68"	"152.6"	"3.5"	"143.9"	"26.53"	"46.32"	"21.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.826E-06"	"3.78"	"39.48"
"38527"	"False"	"High"	"[K].ITASKGIHFQDYDISPLLVK.[A]"	"1xBiotin [K5]"	"6.16276E-05"	"0.000721313"	"1"	"1"	"12"	"Q8VCC1"	"Q8VCC1 [245-264]"	"Q8VCC1 1xBiotin [K249]"	"1"	"2471.30029"	"0.216"	"1.426"	"0.925138005747468"	"0.923750342545975"	"63.86"	"138.57"	"130.8"	"25.2"	"144.0"	"58.88"	"35.82"	"103.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.953E-06"	"4.56"	"55.34"
"38586"	"False"	"High"	"[K].LTEPAPVPIHKLSVSNMVHTAK.[K]"	"1xBiotin [K11]; 1xOxidation [M17]"	"0.000364477"	"0.000721313"	"1"	"1"	"17"	"Q80UJ7"	"Q80UJ7 [367-388]"	"Q80UJ7 1xBiotin [K377]"	"1"	"2611.37347"	"0.058"	"0.834"	"0.000156776473849719"	"0.906515362333117"	"38.67"	"19.49"	"159.0"	"9.7"	"131.2"	"37.53"	"34.54"	"33.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.281E-05"	"3.90"	"41.75"
"44454"	"False"	"High"	"[K].MKLGVQVVITDPEK.[L]"	"1xBiotin [K2]; 1xOxidation [M1]"	"2.35986E-05"	"0.000721313"	"1"	"2"	"9"	"P11983"	"P11983 [246-259]"	"P11983 1xBiotin [K247]"	"1"	"1798.94415"	"0.153"	"0.614"	"0.593823153205735"	"0.906515362333117"	"45.44"	"41.66"	"167.7"	"28.4"	"104.0"	"34.77"	"31.51"	"18.74"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.375E-06"	"3.76"	"46.73"
"44453"	"False"	"High"	"[K].MKLGVQVVITDPEK.[L]"	"1xBiotin [K2]"	"6.42789E-06"	"0.000721313"	"1"	"2"	"14"	"P11983"	"P11983 [246-259]"	"P11983 1xBiotin [K247]"	"1"	"1782.94924"	"0.091"	"0.908"	"0.830135317126799"	"0.906515362333117"	"40.20"	"22.28"	"149.2"	"14.4"	"136.4"	"17.80"	"49.01"	"20.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.815E-07"	"4.20"	"50.32"
"44415"	"False"	"High"	"[-].MKHYEVEIR.[D]"	"1xAcetyl [N-Term]; 1xBiotin [K2]"	"0.000375938"	"0.000721313"	"1"	"1"	"12"	"Q9CY27"	"Q9CY27 [1-9]"	"Q9CY27 1xAcetyl [N-Term]; 1xBiotin [K2]"	"1"	"1472.70247"	"0.051"	"0.693"	"0.0028103014004041"	"0.906515362333117"	"43.06"	"32.17"	"166.0"	"9.4"	"124.6"	"22.53"	"42.14"	"14.26"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.374E-05"	"3.17"	"44.97"
"44391"	"False"	"High"	"[K].MKGLALDTEAELER.[Q]"	"1xBiotin [K2]; 1xOxidation [M1]"	"3.33814E-05"	"0.000721313"	"1"	"1"	"11"	"Q8R570"	"Q8R570 [370-383]"	"Q8R570 1xBiotin [K371]"	"1"	"1817.87720"	"0.442"	"0.967"	"0.925138005747468"	"0.906515362333117"	"43.25"	"34.15"	"126.4"	"53.9"	"119.7"	"29.75"	"34.35"	"12.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.299E-06"	"3.32"	"46.21"
"44390"	"False"	"High"	"[K].MKGLALDTEAELER.[Q]"	"1xBiotin [K2]"	"0.000173354"	"0.000721313"	"1"	"1"	"10"	"Q8R570"	"Q8R570 [370-383]"	"Q8R570 1xBiotin [K371]"	"1"	"1801.88228"	"0.332"	"0.968"	"0.925138005747468"	"0.906515362333117"	"60.43"	"55.39"	"129.2"	"40.2"	"130.6"	"39.61"	"38.74"	"43.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.612E-05"	"3.33"	"49.37"
"44320"	"False"	"High"	"[-].MKDDFAEEEEVQSFGYKR.[F]"	"1xBiotin [K17]; 1xOxidation [M1]"	"2.96758E-05"	"0.000721313"	"1"	"1"	"13"	"Q8K4Q8"	"Q8K4Q8 [1-18]"	"Q8K4Q8 1xBiotin [K17]"	"2"	"2450.06389"	"0.095"	"0.751"	"0.00504203109037951"	"0.906515362333117"	"44.91"	"24.31"	"159.8"	"17.0"	"123.2"	"33.80"	"37.70"	"16.87"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.953E-06"	"4.66"	"44.92"
"44319"	"False"	"High"	"[-].MKDDFAEEEEVQSFGYKR.[F]"	"1xBiotin [K17]"	"7.56017E-05"	"0.000721313"	"1"	"1"	"12"	"Q8K4Q8"	"Q8K4Q8 [1-18]"	"Q8K4Q8 1xBiotin [K17]"	"2"	"2434.06897"	"0.149"	"0.935"	"0.452844787848141"	"0.906515362333117"	"60.53"	"50.09"	"149.7"	"22.4"	"127.9"	"16.23"	"47.70"	"58.67"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.274E-06"	"4.74"	"46.30"
"43895"	"False"	"High"	"[R].MGPGATAGGAEKSNVK.[I]"	"1xBiotin [K12]; 1xOxidation [M1]"	"1.34152E-06"	"0.000721313"	"1"	"1"	"14"	"P62821"	"P62821 [176-191]"	"P62821 1xBiotin [K187]"	"1"	"1716.80437"	"0.113"	"0.696"	"0.245769850562249"	"0.906515362333117"	"56.59"	"84.60"	"165.8"	"17.8"	"116.4"	"48.35"	"51.98"	"65.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.509E-07"	"5.12"	"27.14"
"43894"	"False"	"High"	"[R].MGPGATAGGAEKSNVK.[I]"	"1xBiotin [K]"	"3.59567E-05"	"0.000721313"	"1"	"1"	"19"	"P62821"	"P62821 [176-191]"	"P62821 1xBiotin [K]"	"1"	"1700.80945"	"0.076"	"1.088"	"0.00641881286054574"	"0.906515362333117"	"62.79"	"41.50"	"135.8"	"9.3"	"154.8"	"25.00"	"54.66"	"32.42"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.549E-06"	"4.10"	"30.30"
"43730"	"False"	"High"	"[-].MGKGGNQGEGSTER.[Q]"	"1xBiotin [K3]; 1xMet-loss [N-Term]"	"9.68534E-05"	"0.000721313"	"1"	"1"	"17"	"Q9Z0R9"	"Q9Z0R9 [1-14]"	"Q9Z0R9 1xBiotin [K3]; 1xMet-loss [N-Term]"	"1"	"1502.66523"	"0.074"	"0.915"	"0.00421624953929923"	"0.906515362333117"	"49.97"	"59.81"	"159.7"	"12.1"	"128.2"	"29.77"	"36.54"	"48.59"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.177E-06"	"3.25"	"19.09"
"43706"	"False"	"High"	"[-].MGHQQLYWSHPR.[K]"	"1xMet-loss [N-Term]"	"0.000172283"	"0.000721313"	"1"	"1"	"15"	"P62274"	"P62274 [1-12]"	"P62274 1xMet-loss [N-Term]"	"0"	"1408.68689"	"120.905"	"6.034"	"0.935194287285695"	"0.906515362333117"	"57.42"	"78.38"	"2.4"	"282.7"	"14.9"	"56.63"	"77.66"	"52.00"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.599E-05"	"3.66"	"24.47"
"43301"	"False"	"High"	"[-].MFLYNLTLQR.[A]"	"1xOxidation [M1]"	"0.00212801"	"0.000721313"	"1"	"2"	"6"	"Q921M3-1"	"Q921M3-1 [1-10]"	""	"0"	"1314.68747"	"295.151"	"3.368"	"0.675311576075088"	"0.906515362333117"	"49.07"	"37.59"	"1.0"	"295.7"	"3.3"	"28.03"	"48.27"	"25.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001764"	"2.67"	"48.16"
"43300"	"False"	"High"	"[-].MFLYNLTLQR.[A]"	""	"0.00220851"	"0.000721313"	"1"	"2"	"5"	"Q921M3-1"	"Q921M3-1 [1-10]"	""	"0"	"1298.69255"	"64.755"	"5.385"	"0.925138005747468"	"0.906515362333117"	"97.66"	"66.27"	"3.5"	"277.9"	"18.6"	"51.00"	"62.27"	"27.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001821"	"2.64"	"52.74"
"43287"	"False"	"High"	"[K].MFLKVALPSYEEALSLPPK.[T]"	"1xBiotin [K4]; 1xOxidation [M1]"	"1.37686E-05"	"0.000721313"	"1"	"1"	"23"	"Q61168"	"Q61168 [229-247]"	"Q61168 1xBiotin [K232]"	"1"	"2375.23894"	"0.967"	"5.982"	"0.966090293805027"	"0.906515362333117"	"56.72"	"58.38"	"35.5"	"35.3"	"229.3"	"53.20"	"29.06"	"28.87"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.409E-06"	"4.29"	"60.28"
"43286"	"False"	"High"	"[K].MFLKVALPSYEEALSLPPK.[T]"	"1xBiotin [K4]"	"0.00018329"	"0.000721313"	"1"	"1"	"45"	"Q61168"	"Q61168 [229-247]"	"Q61168 1xBiotin [K232]"	"1"	"2359.24402"	"0.853"	"7.842"	"0.987000067345905"	"0.906515362333117"	"58.86"	"72.44"	"30.8"	"27.8"	"241.4"	"77.82"	"30.58"	"50.20"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.695E-05"	"4.52"	"62.84"
"43145"	"False"	"High"	"[K].MEVGQYIFVKCPK.[V]"	"1xBiotin [K10]; 1xCarbamidomethyl [C11]"	"0.000175514"	"0.000721313"	"1"	"1"	"5"	"Q61093"	"Q61093 [319-331]"	"Q61093 1xBiotin [K328]"	"1"	"1824.88453"	"0.464"	"0.638"	"0.925138005747468"	"0.906515362333117"	"73.57"	"81.72"	"127.7"	"77.7"	"94.6"	"56.32"	"38.49"	"56.15"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"1.631E-05"	"3.68"	"52.79"
"42559"	"False"	"High"	"[R].MEESFSSKYVPK.[Y]"	"1xBiotin [K8]; 1xOxidation [M1]"	"1.5975E-05"	"0.000721313"	"1"	"4"	"143"	"Q61029"	"Q61029 [381-392]"	"Q61029 1xBiotin [K388]"	"1"	"1673.75496"	"2.100"	"0.820"	"0.172585601411963"	"0.906515362333117"	"48.39"	"31.15"	"72.8"	"162.7"	"64.5"	"29.63"	"40.23"	"18.53"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.629E-06"	"4.02"	"41.60"
"42558"	"False"	"High"	"[R].MEESFSSKYVPK.[Y]"	"1xBiotin [K8]"	"5.79267E-05"	"0.000721313"	"1"	"4"	"71"	"Q61029"	"Q61029 [381-392]"	"Q61029 1xBiotin [K388]"	"1"	"1657.76004"	"0.291"	"0.852"	"0.00666482858032578"	"0.906515362333117"	"72.77"	"49.38"	"132.9"	"39.7"	"127.4"	"47.72"	"55.58"	"24.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.624E-06"	"4.22"	"43.51"
"42385"	"False"	"High"	"[-].MEAQELGSPTPTYHLLPKANQHTVK.[E]"	"1xAcetyl [N-Term]; 1xBiotin [K]"	"0.000397485"	"0.000721313"	"1"	"1"	"5"	"Q8BGK6-1"	"Q8BGK6-1 [1-25]"	"Q8BGK6-1 1xAcetyl [N-Term]; 1xBiotin [K]"	"1"	"3058.51249"	"0.466"	"0.385"	"0.925138005747468"	"0.906515362333117"	"66.32"	"85.45"	"149.3"	"96.1"	"54.6"	"57.92"	"35.57"	"100.96"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.563E-05"	"3.88"	"48.39"
"41987"	"False"	"High"	"[R].MDKSAVGHEYVADVEK.[H]"	"1xBiotin [K3]"	"4.78081E-05"	"0.000721313"	"1"	"1"	"7"	"P49710"	"P49710 [94-109]"	"P49710 1xBiotin [K96]"	"1"	"2003.92012"	"0.240"	"1.342"	"0.925138005747468"	"0.936238272383155"	"113.53"	"79.28"	"123.6"	"21.9"	"154.5"	"73.73"	"52.24"	"43.42"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"4.67E-06"	"3.53"	"41.16"
"41723"	"False"	"High"	"[K].MCLFAGFQR.[K]"	"1xCarbamidomethyl [C2]; 1xOxidation [M1]"	"0.00189194"	"0.000721313"	"1"	"2"	"30"	"Q8VEK3"	"Q8VEK3 [569-577]"	""	"0"	"1145.52305"	"194.476"	"3.409"	"0.925138005747468"	"0.906515362333117"	"103.84"	"91.72"	"1.1"	"295.6"	"3.3"	"77.46"	"51.76"	"59.10"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000158"	"2.67"	"42.87"
"41642"	"False"	"High"	"[R].MAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVK.[I]"	"1xBiotin [K8]; 1xOxidation [M1]"	"0.000257668"	"0.000721313"	"1"	"2"	"28"	"Q921T2-1"	"Q921T2-1 [314-347]"	"Q921T2-1 1xBiotin [K321]"	"1"	"4007.88754"	"0.007"	"0.545"	"3.88278458712235E-06"	"0.906515362333117"	"48.29"	"61.42"	"189.7"	"1.4"	"108.9"	"35.82"	"226.31"	"50.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.348E-05"	"4.33"	"34.40"
"41641"	"False"	"High"	"[R].MAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVK.[I]"	"1xBiotin [K8]"	"2.64799E-07"	"0.000721313"	"1"	"2"	"36"	"Q921T2-1"	"Q921T2-1 [314-347]"	"Q921T2-1 1xBiotin [K321]"	"1"	"3991.89263"	"0.006"	"1.005"	"2.55696572722952E-06"	"0.916215054610739"	"44.42"	"30.44"	"147.6"	"0.9"	"151.5"	"32.14"	"40.42"	"27.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.166E-08"	"4.71"	"36.08"
"41635"	"False"	"High"	"[-].MAYHSAYGVHGSKHR.[T]"	"1xBiotin [K13]; 1xMet-loss+Acetyl [N-Term]"	"0.00215451"	"0.000721313"	"1"	"1"	"4"	"Q91XB7"	"Q91XB7 [1-15]"	"Q91XB7 1xBiotin [K13]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1837.85510"	"8.704"	"0.914"	"0.605166493201375"	"0.906515362333117"	"69.10"	"57.38"	"29.2"	"244.5"	"26.4"	"55.58"	"55.15"	"46.95"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001788"	"3.27"	"27.01"
"41613"	"False"	"High"	"[K].MAVTFIGNSTAIQELFKR.[I]"	"1xOxidation [M1]"	"0.00137127"	"0.000721313"	"1"	"1"	"9"	"P99024"	"P99024 [363-380]"	""	"1"	"2042.07392"	"48.414"	"1.329"	"0.925138005747468"	"0.906515362333117"	"83.35"	"85.15"	"5.8"	"287.8"	"6.4"	"51.03"	"67.15"	"85.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001167"	"3.70"	"56.09"
"44455"	"False"	"High"	"[K].MKLGVQVVITDPEKLDQIR.[Q]"	"1xBiotin [K2]"	"6.49996E-07"	"0.000721313"	"1"	"2"	"12"	"P11983"	"P11983 [246-264]"	"P11983 1xBiotin [K247]"	"2"	"2408.30400"	"0.110"	"2.281"	"0.480827169233252"	"0.906515362333117"	"51.02"	"43.56"	"84.4"	"10.0"	"205.6"	"14.49"	"46.34"	"30.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.497E-08"	"5.44"	"54.42"
"44456"	"False"	"High"	"[K].MKLGVQVVITDPEKLDQIR.[Q]"	"1xBiotin [K2]; 1xOxidation [M1]"	"1.43787E-05"	"0.000721313"	"1"	"2"	"15"	"P11983"	"P11983 [246-264]"	"P11983 1xBiotin [K247]"	"2"	"2424.29891"	"0.260"	"1.997"	"0.925138005747468"	"0.937945192250145"	"25.42"	"34.67"	"94.8"	"24.1"	"181.1"	"22.85"	"27.81"	"29.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.474E-06"	"4.15"	"51.90"
"44593"	"False"	"High"	"[R].MKPWQSEYGGVVFGGWAR.[M]"	"1xOxidation [M1]"	"0.00180054"	"0.000721313"	"1"	"1"	"1"	"Q8CFQ3"	"Q8CFQ3 [492-509]"	""	"0"	"2070.98544"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001507"	"4.18"	""
"44709"	"False"	"High"	"[-].MKYHSHIENLDEDGYTQLDFSTQDIHK.[R]"	"1xBiotin [K2]"	"0.00140565"	"0.000721313"	"1"	"1"	"2"	"Q6QLQ4"	"Q6QLQ4 [1-27]"	"Q6QLQ4 1xBiotin [K2]"	"1"	"3490.56783"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001189"	"3.84"	""
"47620"	"False"	"High"	"[-].MSGHKCYSWELQDR.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C6]; 1xMet-loss+Acetyl [N-Term]"	"8.93615E-05"	"0.000721313"	"1"	"2"	"25"	"P97411-1"	"P97411-1 [1-14]"	"P97411-1 1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1933.83198"	"0.070"	"0.782"	"0.00360220553116065"	"0.906515362333117"	"48.06"	"42.08"	"164.6"	"12.2"	"123.2"	"38.26"	"37.17"	"24.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.518E-06"	"3.72"	"43.95"
"47327"	"False"	"High"	"[-].MSALEKSMHLGR.[L]"	"1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"0.000934167"	"0.000721313"	"1"	"1"	"10"	"Q8BVQ5"	"Q8BVQ5 [1-12]"	"Q8BVQ5 1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1496.73483"	"0.407"	"0.991"	"0.925138005747468"	"0.906515362333117"	"80.25"	"41.42"	"130.9"	"48.2"	"120.9"	"31.78"	"56.51"	"19.50"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.066E-05"	"3.08"	"47.45"
"46982"	"False"	"High"	"[-].MQNVINTVKGK.[A]"	"1xAcetyl [N-Term]; 1xBiotin [K9]"	"0.000934167"	"0.000721313"	"1"	"1"	"10"	"Q9CPX6"	"Q9CPX6 [1-11]"	"Q9CPX6 1xAcetyl [N-Term]; 1xBiotin [K9]"	"1"	"1499.77088"	"0.155"	"0.711"	"0.495643412805822"	"0.906515362333117"	"55.52"	"58.72"	"163.8"	"24.7"	"111.5"	"39.12"	"39.28"	"40.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"8.083E-05"	"3.23"	"58.60"
"46936"	"False"	"High"	"[-G].MQIFVKTLTGKTITLEVEPSDTIENVK.[A]"	"1xOxidation [M1]"	"0.000404939"	"0.000721313"	"1"	"4"	"6"	"P62984"	"P62984 [1-27]"	""	"2"	"3050.63298"	"0.849"	"0.935"	"0.0300502789924059"	""	"145.30"	"61.34"	"119.0"	"86.2"	"94.8"	"39.61"	"231.69"	"34.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"3.643E-05"	"4.26"	"51.47"
"46933"	"False"	"High"	"[-G].MQIFVKTLTGK.[T]"	"1xBiotin [K6]"	"8.93615E-05"	"0.000721313"	"1"	"4"	"12"	"P62984"	"P62984 [1-11]"	"P62984 1xBiotin [K6]"	"1"	"1491.80620"	"0.168"	"0.914"	"0.0189426161014597"	"0.906515362333117"	"50.45"	"49.74"	"149.1"	"25.0"	"125.9"	"36.82"	"36.15"	"39.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.51E-06"	"3.75"	"52.76"
"46734"	"False"	"High"	"[R].MPSKSMPPLDQPSCK.[A]"	"1xBiotin [K4]; 1xCarbamidomethyl [C14]"	"0.00031414"	"0.000721313"	"1"	"1"	"7"	"Q62419"	"Q62419 [298-312]"	"Q62419 1xBiotin [K301]"	"1"	"1928.87371"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"2.84E-05"	"3.15"	""
"46661"	"False"	"High"	"[-].MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSR.[A]"	"1xBiotin [K16]; 1xCarbamidomethyl [C30]; 1xOxidation [M6]; 1xMet-loss [N-Term]"	"3.91651E-06"	"0.000721313"	"1"	"2"	"22"	"Q8K078"	"Q8K078 [1-37]"	"Q8K078 1xBiotin [K16]; 1xMet-loss [N-Term]"	"1"	"4112.85352"	"0.240"	"9.840"	"0.0458194260156421"	"0.906515362333117"	"126.27"	"93.94"	"26.1"	"6.1"	"267.8"	"93.55"	"32.42"	"32.92"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.232E-07"	"6.89"	"49.40"
"46660"	"False"	"High"	"[-].MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSR.[A]"	"1xBiotin [K16]; 1xCarbamidomethyl [C30]; 1xMet-loss [N-Term]"	"2.18544E-07"	"0.000721313"	"1"	"2"	"14"	"Q8K078"	"Q8K078 [1-37]"	"Q8K078 1xBiotin [K16]; 1xMet-loss [N-Term]"	"1"	"4096.85861"	"0.695"	"18.362"	"0.260878759457804"	"0.834209464552986"	"85.59"	"77.14"	"15.3"	"10.8"	"273.9"	"89.86"	"52.34"	"42.05"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.634E-08"	"6.86"	"51.26"
"46585"	"False"	"High"	"[-].MPMILGYWNVR.[G]"	"1xOxidation [M3]; 1xMet-loss [N-Term]"	"0.00184568"	"0.000721313"	"1"	"1"	"23"	"P10649"	"P10649 [1-11]"	"P10649 1xMet-loss [N-Term]"	"0"	"1264.65069"	"130.652"	"3.191"	"0.925158317651619"	"0.906515362333117"	"24.87"	"29.96"	"2.2"	"290.9"	"6.9"	"19.06"	"28.10"	"19.48"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001539"	"2.86"	"49.11"
"46584"	"False"	"High"	"[-].MPMILGYWNVR.[G]"	"1xMet-loss [N-Term]"	"0.00227791"	"0.000721313"	"1"	"1"	"8"	"P10649"	"P10649 [1-11]"	"P10649 1xMet-loss [N-Term]"	"0"	"1248.65577"	"23.948"	"4.748"	"0.643644630630222"	"0.906515362333117"	"146.33"	"61.82"	"10.0"	"239.2"	"50.8"	"48.86"	"117.16"	"58.82"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001881"	"3.15"	"53.71"
"46582"	"False"	"High"	"[-].MPMFIVNTNVPR.[A]"	"1xOxidation [M3]; 1xMet-loss [N-Term]"	"0.000715811"	"0.000721313"	"1"	"1"	"30"	"P34884"	"P34884 [1-12]"	"P34884 1xMet-loss [N-Term]"	"0"	"1303.68272"	"323.469"	"6.177"	"0.925138005747468"	"0.906515362333117"	"53.52"	"56.49"	"0.9"	"293.6"	"5.5"	"31.52"	"44.00"	"48.81"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.265E-05"	"2.77"	"38.36"
"46581"	"False"	"High"	"[-].MPMFIVNTNVPR.[A]"	"1xMet-loss [N-Term]"	"0.00117465"	"0.000721313"	"1"	"1"	"16"	"P34884"	"P34884 [1-12]"	"P34884 1xMet-loss [N-Term]"	"0"	"1287.68780"	"46.506"	"4.828"	"0.585023052920106"	"0.906515362333117"	"77.38"	"60.52"	"6.5"	"263.2"	"30.3"	"44.68"	"69.99"	"29.57"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001007"	"3.39"	"43.07"
"41611"	"False"	"High"	"[K].MAVTFIGNSTAIQELFK.[R]"	"1xOxidation [M1]"	"1.83068E-05"	"0.000721313"	"1"	"1"	"17"	"P99024"	"P99024 [363-379]"	""	"0"	"1885.97281"	"245.382"	"6.229"	"0.925138005747468"	"0.906515362333117"	"56.56"	"63.31"	"1.3"	"291.4"	"7.3"	"50.01"	"37.83"	"43.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.859E-06"	"4.60"	"60.01"
"46515"	"False"	"High"	"[-].MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCR.[L]"	"1xCarbamidomethyl [C31]; 1xOxidation [M]; 1xMet-loss [N-Term]"	"0.00144983"	"0.000721313"	"1"	"2"	"8"	"P52480"	"P52480 [1-32]"	"P52480 1xMet-loss [N-Term]"	"0"	"3539.66169"	"1.280"	"8.859"	"0.195471428172578"	"0.906515362333117"	"85.46"	"71.58"	"24.9"	"43.2"	"231.9"	"54.76"	"237.13"	"51.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001229"	"4.31"	"46.44"
"46406"	"False"	"High"	"[-].MPEPAKSAPAPK.[K]"	"1xBiotin [K6]; 1xMet-loss [N-Term]"	"0.00152344"	"0.000721313"	"1"	"4"	"13"	"Q6ZWY9"	"Q6ZWY9 [1-12]"	"Q6ZWY9 1xBiotin [K6]; 1xMet-loss [N-Term]"	"1"	"1318.68238"	"0.095"	"0.847"	"0.00556263292220494"	"0.906515362333117"	"52.65"	"46.22"	"138.8"	"14.0"	"147.1"	"30.29"	"45.25"	"30.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001283"	"2.99"	"26.94"
"46257"	"False"	"High"	"[-].MNSTKSPASHHTER.[G]"	"1xAcetyl [N-Term]; 1xBiotin [K5]"	"0.00129696"	"0.000721313"	"1"	"1"	"6"	"Q9R0Q8"	"Q9R0Q8 [1-14]"	"Q9R0Q8 1xAcetyl [N-Term]; 1xBiotin [K5]"	"1"	"1850.82723"	"0.192"	"0.703"	"0.925138005747468"	"0.906515362333117"	"61.37"	"65.81"	"166.8"	"28.0"	"105.1"	"43.28"	"39.92"	"56.04"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001103"	"2.95"	"26.93"
"45994"	"False"	"High"	"[K].MNAKWDTGENPIYK.[S]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.00200031"	"0.000721313"	"1"	"1"	"13"	"P09055"	"P09055 [771-784]"	"P09055 1xBiotin [K774]"	"1"	"1908.86188"	"0.177"	"0.477"	"0.544184794343972"	"0.906515362333117"	"82.63"	"76.60"	"187.9"	"30.4"	"81.6"	"62.27"	"37.31"	"41.91"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001662"	"3.70"	"44.08"
"45993"	"False"	"High"	"[K].MNAKWDTGENPIYK.[S]"	"1xBiotin [K4]"	"0.000711393"	"0.000721313"	"1"	"1"	"11"	"P09055"	"P09055 [771-784]"	"P09055 1xBiotin [K774]"	"1"	"1892.86697"	"0.305"	"0.996"	"0.925138005747468"	"0.919235111389825"	"26.98"	"39.87"	"131.9"	"40.1"	"128.0"	"16.37"	"22.20"	"32.02"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.22E-05"	"2.90"	"46.30"
"45615"	"False"	"High"	"[R].MLVVLLQANR.[D]"	"1xOxidation [M1]"	"0.00173491"	"0.000721313"	"1"	"1"	"8"	"P48036"	"P48036 [150-159]"	""	"0"	"1172.68199"	"343.719"	"4.200"	"0.925138005747468"	"0.906515362333117"	"75.31"	"66.93"	"0.8"	"295.9"	"3.4"	"63.95"	"46.16"	"26.43"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001453"	"2.69"	"41.34"
"45581"	"False"	"High"	"[-].MLVLFETSVGYAIFK.[V]"	"1xOxidation [M1]"	"0.000308358"	"0.000721313"	"1"	"1"	"1"	"Q6DFW4"	"Q6DFW4 [1-15]"	""	"0"	"1733.91826"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.796E-05"	"2.92"	""
"45461"	"False"	"High"	"[K].MLSLNVFSVQVQAFK.[V]"	"1xOxidation [M1]"	"2.08495E-05"	"0.000721313"	"1"	"1"	"11"	"P11438"	"P11438 [338-352]"	""	"0"	"1726.91965"	"91.227"	"0.802"	"0.436385151440765"	""	"43.67"	"29.92"	"3.6"	"293.9"	"2.5"	"21.59"	"45.36"	"20.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"2.106E-06"	"4.63"	"58.59"
"45460"	"False"	"High"	"[K].MLSLNVFSVQVQAFK.[V]"	""	"0.000118815"	"0.000721313"	"1"	"1"	"7"	"P11438"	"P11438 [338-352]"	""	"0"	"1710.92474"	"4.207"	"1.927"	"0.942870059534198"	"0.984473607647425"	"171.57"	"75.16"	"45.8"	"167.6"	"86.7"	"40.14"	"124.63"	"66.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.12E-05"	"3.58"	"60.97"
"45176"	"False"	"High"	"[R].MLITIMGTVKPNANR.[I]"	""	"0.000535067"	"0.000721313"	"1"	"1"	"16"	"P16110"	"P16110 [144-158]"	""	"0"	"1658.90804"	"44.304"	"7.098"	"0.478597253695619"	"0.906515362333117"	"106.13"	"56.69"	"7.2"	"244.7"	"48.1"	"58.62"	"99.80"	"25.95"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.742E-05"	"3.39"	"43.10"
"45040"	"False"	"High"	"[K].MIKPFFHSLCDK.[Y]"	"1xCarbamidomethyl [C10]; 1xOxidation [M1]"	"0.000399954"	"0.000721313"	"1"	"1"	"3"	"P10639"	"P10639 [37-48]"	""	"0"	"1538.74942"	"288.256"	"3.980"	"0.311603383289785"	"0.906515362333117"	"64.75"	"74.47"	"0.9"	"294.9"	"4.2"	"58.67"	"29.75"	"42.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"3.587E-05"	"3.55"	"35.70"
"45039"	"False"	"High"	"[K].MIKPFFHSLCDK.[Y]"	"1xCarbamidomethyl [C10]"	"0.00205045"	"0.000721313"	"1"	"1"	"9"	"P10639"	"P10639 [37-48]"	""	"0"	"1522.75450"	"55.306"	"5.554"	"0.666161515527971"	"0.906515362333117"	"119.98"	"52.95"	"4.7"	"268.7"	"26.7"	"68.87"	"75.07"	"19.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.00017"	"2.92"	"38.31"
"44988"	"False"	"High"	"[K].MLGYFSLVGLLR.[L]"	"1xOxidation [M1]"	"0.000204904"	"0.000721313"	"1"	"1"	"18"	"Q8QZY1"	"Q8QZY1 [268-279]"	""	"0"	"1384.76572"	"120.240"	"2.775"	"0.945683295219289"	"0.919235111389825"	"93.60"	"44.46"	"2.5"	"290.4"	"7.1"	"37.51"	"75.58"	"21.61"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.891E-05"	"2.68"	"63.77"
"46514"	"False"	"High"	"[-].MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCR.[L]"	"1xCarbamidomethyl [C31]; 1xMet-loss [N-Term]"	"6.83011E-07"	"0.000721313"	"1"	"2"	"5"	"P52480"	"P52480 [1-32]"	"P52480 1xMet-loss [N-Term]"	"0"	"3523.66677"	"1.584"	"4.640"	"0.945683295219289"	"0.906515362333117"	"70.48"	"88.22"	"33.9"	"57.4"	"208.7"	"49.89"	"228.01"	"65.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"7.906E-08"	"6.14"	"51.68"
"41610"	"False"	"High"	"[K].MAVTFIGNSTAIQELFK.[R]"	""	"2.89497E-05"	"0.000721313"	"1"	"1"	"11"	"P99024"	"P99024 [363-379]"	""	"0"	"1869.97790"	"81.344"	"15.131"	"0.491661541833846"	"0.906515362333117"	"99.92"	"72.30"	"3.2"	"253.8"	"43.0"	"55.23"	"96.40"	"39.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.892E-06"	"3.69"	"62.20"
"41468"	"False"	"High"	"[-].MATLKDQLIVNLLK.[E]"	"1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"0.000702637"	"0.000721313"	"1"	"1"	"5"	"P06151"	"P06151 [1-14]"	"P06151 1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1736.99790"	"1.347"	"2.245"	""	"0.937945192250145"	"60.45"	"74.99"	"60.8"	"92.4"	"146.8"	"54.52"	"31.82"	"57.81"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.146E-05"	"3.17"	"68.62"
"41432"	"False"	"High"	"[-].MATDELASKLSR.[R]"	"1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"0.00103785"	"0.000721313"	"1"	"1"	"3"	"Q9D8Y0"	"Q9D8Y0 [1-12]"	"Q9D8Y0 1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1458.72570"	"0.515"	"0.659"	"0.925138005747468"	"0.906515362333117"	"76.88"	"57.32"	"134.4"	"69.7"	"95.9"	"49.13"	"61.78"	"46.19"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"8.913E-05"	"3.29"	"53.34"
"39165"	"False"	"High"	"[K].LVLLELNFLPTTGTK.[L]"	""	"0.00158108"	"0.000721313"	"1"	"1"	"8"	"Q9CX56"	"Q9CX56 [124-138]"	""	"0"	"1658.97273"	"7.832"	"1.635"	"0.996542475396571"	"0.948751264234871"	"201.82"	"54.41"	"34.3"	"210.7"	"55.0"	"31.94"	"103.42"	"45.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001332"	"3.54"	"62.46"
"39143"	"False"	"High"	"[R].IVLELFADIVPK.[T]"	""	"0.000830491"	"0.000721313"	"1"	"1"	"6"	"Q9CR16"	"Q9CR16 [32-43]"	""	"0"	"1356.81372"	"7.393"	"2.397"	"0.998769547666767"	"0.906515362333117"	"138.48"	"72.14"	"28.3"	"215.3"	"56.4"	"58.51"	"152.68"	"51.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.209E-05"	"3.21"	"63.71"
"39129"	"False"	"High"	"[R].LVKSVSESHTPCPSESTGDTVPLQR.[S]"	"1xBiotin [K3]; 1xCarbamidomethyl [C12]"	"0.000484596"	"0.000721313"	"1"	"2"	"6"	"Q8R5A6"	"Q8R5A6 [139-163]"	"Q8R5A6 1xBiotin [K141]"	"1"	"2937.40808"	"0.970"	"1.818"	""	"0.971360091582799"	"62.06"	"56.23"	"78.7"	"71.3"	"150.0"	"44.62"	"36.08"	"35.26"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"4.311E-05"	"3.71"	"37.84"
"39112"	"False"	"High"	"[R].LVHSGPSKGSVPYDAELSFALR.[T]"	"1xBiotin [K8]"	"1.77486E-05"	"0.000721313"	"1"	"1"	"12"	"Q61234"	"Q61234 [346-367]"	"Q61234 1xBiotin [K353]"	"1"	"2556.29152"	"0.078"	"1.290"	"0.0168493106117813"	"0.919235111389825"	"56.56"	"26.12"	"123.6"	"10.4"	"165.9"	"18.68"	"60.11"	"18.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.801E-06"	"3.70"	"52.10"
"39044"	"False"	"High"	"[R].LVEGILHAPDAGWGNLVYVVNYPK.[D]"	""	"9.68534E-05"	"0.000721313"	"1"	"1"	"5"	"Q921F2"	"Q921F2 [56-79]"	""	"0"	"2624.38713"	"2.179"	"1.621"	"0.925138005747468"	"0.943485193068069"	"88.21"	"65.91"	"77.6"	"109.8"	"112.5"	"49.04"	"141.16"	"33.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"9.189E-06"	"4.53"	"59.81"
"38936"	"False"	"High"	"[K].ITVVGVGAVGMACAISILMK.[D]"	"1xCarbamidomethyl [C13]"	"0.000624652"	"0.000721313"	"1"	"1"	"2"	"P06151"	"P06151 [23-42]"	""	"0"	"1990.08977"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"5.498E-05"	"4.20"	""
"38905"	"False"	"High"	"[R].LTTPVFGKGVAYDVPNAIFLEQK.[K]"	"1xBiotin [K8]"	"1.1867E-05"	"0.000721313"	"1"	"1"	"14"	"Q8K0C4"	"Q8K0C4 [134-156]"	"Q8K0C4 1xBiotin [K141]"	"1"	"2733.43203"	"0.169"	"3.722"	"0.925138005747468"	"0.906515362333117"	"47.46"	"43.31"	"60.1"	"11.5"	"228.4"	"25.13"	"47.36"	"38.06"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.226E-06"	"5.57"	"61.90"
"38903"	"False"	"High"	"[K].LTTPTYGDLNHLVSATMSGVTTCLR.[F]"	"1xCarbamidomethyl [C23]"	"4.68703E-06"	"0.000721313"	"3"	"5"	"8"	"Q7TMM9; Q9D6F9; P99024"	"Q7TMM9 [217-241]; Q9D6F9 [217-241]; P99024 [217-241]"	""	"0"	"2708.33821"	"6.435"	"11.229"	"0.973358748574628"	"0.906515362333117"	"197.47"	"64.74"	"18.8"	"88.8"	"192.4"	"42.12"	"135.58"	"54.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.013E-07"	"4.93"	"61.53"
"38890"	"False"	"High"	"[R].LTTDFNVIVQALSK.[S]"	""	"0.00205045"	"0.000721313"	"1"	"1"	"4"	"P32067"	"P32067 [61-74]"	""	"0"	"1548.86318"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001704"	"3.37"	""
"38884"	"False"	"High"	"[K].LTSTVMLWLQTNK.[S]"	"1xOxidation [M6]"	"0.000785478"	"0.000721313"	"1"	"3"	"12"	"P47757-1"	"P47757-1 [169-181]"	""	"0"	"1550.82469"	"90.965"	"1.850"	"0.486459598296651"	"0.957287483848178"	"87.82"	"43.34"	"3.6"	"289.8"	"6.6"	"29.53"	"66.06"	"33.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.831E-05"	"2.55"	"48.06"
"38883"	"False"	"High"	"[K].LTSTVMLWLQTNK.[S]"	""	"0.000702637"	"0.000721313"	"1"	"3"	"9"	"P47757-1"	"P47757-1 [169-181]"	""	"0"	"1534.82978"	"8.890"	"1.100"	"0.981385243268088"	"0.906515362333117"	"273.42"	"46.86"	"30.3"	"239.0"	"30.7"	"31.94"	"124.21"	"37.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.148E-05"	"2.95"	"54.18"
"38882"	"False"	"High"	"[K].LTSSSEKALANQFLAPGR.[V]"	"1xBiotin [K7]"	"5.86487E-05"	"0.000721313"	"1"	"2"	"23"	"Q9CQ56"	"Q9CQ56 [88-105]"	"Q9CQ56 1xBiotin [K94]"	"1"	"2116.08555"	"0.124"	"0.724"	"0.0119276693209257"	"0.906515362333117"	"36.03"	"42.72"	"157.6"	"20.4"	"122.0"	"36.87"	"31.49"	"50.93"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.669E-06"	"3.83"	"52.40"
"39181"	"False"	"High"	"[K].LVINGKPITIFQER.[D]"	""	"4.14611E-05"	"0.000721313"	"1"	"1"	"27"	"P16858"	"P16858 [65-78]"	""	"0"	"1627.95300"	"292.774"	"18.056"	"0.925138005747468"	"0.625665755000974"	"88.61"	"86.27"	"0.8"	"285.3"	"13.9"	"72.66"	"43.29"	"28.71"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.079E-06"	"3.80"	"45.84"
"38877"	"False"	"High"	"[K].LTSMHFYGWK.[Q]"	""	"0.000300814"	"0.000721313"	"1"	"1"	"26"	"P07742"	"P07742 [720-729]"	""	"0"	"1269.60849"	"36.716"	"3.004"	"0.925138005747468"	"0.906515362333117"	"83.40"	"63.55"	"8.2"	"266.1"	"25.7"	"46.30"	"105.07"	"31.68"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.724E-05"	"3.07"	"41.45"
"38799"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"2xBiotin [K7; K25]"	"0.00126524"	"0.000721313"	"1"	"1"	"10"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 2xBiotin [K133; K151]"	"1"	"3911.91690"	"1.061"	"25.636"	""	"0.69921766089904"	"69.77"	"65.47"	"10.5"	"11.4"	"278.1"	"45.35"	"45.66"	"41.19"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001078"	"3.93"	"58.36"
"38796"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEK.[N]"	"1xBiotin [K7]; 1xOxidation [M23]"	"2.78593E-06"	"0.000721313"	"1"	"1"	"104"	"Q3U9G9"	"Q3U9G9 [127-151]"	"Q3U9G9 1xBiotin [K133]"	"0"	"3027.49544"	"2.141"	"1.451"	"0.177019279229111"	"0.969227082684272"	"45.34"	"51.95"	"70.2"	"133.2"	"96.5"	"24.02"	"36.71"	"58.18"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.052E-07"	"4.33"	"55.47"
"38795"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEK.[N]"	"1xBiotin [K7]"	"1.53733E-06"	"0.000721313"	"1"	"1"	"73"	"Q3U9G9"	"Q3U9G9 [127-151]"	"Q3U9G9 1xBiotin [K133]"	"0"	"3011.50053"	"0.955"	"1.888"	"0.0530463939056239"	"0.906777072223237"	"75.98"	"40.64"	"81.5"	"79.6"	"138.8"	"32.32"	"76.02"	"27.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.719E-07"	"5.22"	"56.38"
"38705"	"False"	"High"	"[K].LTLHGLQQYYVK.[L]"	""	"0.000152213"	"0.000721313"	"2"	"3"	"25"	"Q9Z1N5; Q8VDW0-1"	"Q9Z1N5 [257-268]; Q8VDW0-1 [256-267]"	""	"0"	"1462.80528"	"310.321"	"6.525"	"0.925138005747468"	"0.906515362333117"	"58.22"	"64.05"	"1.1"	"292.6"	"6.3"	"45.92"	"55.00"	"59.12"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.421E-05"	"3.12"	"41.53"
"38679"	"False"	"High"	"[K].ITKVFDFAGEEVR.[V]"	"1xBiotin [K3]"	"0.00220851"	"0.000721313"	"1"	"1"	"8"	"O88271"	"O88271 [161-173]"	"O88271 1xBiotin [K163]"	"1"	"1736.86762"	"0.703"	"0.456"	"0.925138005747468"	"0.906515362333117"	"55.54"	"45.80"	"127.3"	"105.6"	"67.1"	"41.79"	"32.15"	"32.82"	""	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.000183"	"2.40"	"53.17"
"38657"	"False"	"High"	"[K].LTKAASLPGK.[N]"	"1xBiotin [K3]"	"0.00210184"	"0.000721313"	"1"	"1"	"8"	"O70472"	"O70472 [1640-1649]"	"O70472 1xBiotin [K1642]"	"1"	"1211.68165"	"0.054"	"0.698"	"0.00273395014870016"	"0.906515362333117"	"43.29"	"35.98"	"168.6"	"10.8"	"120.5"	"25.14"	"40.02"	"26.34"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001738"	"2.92"	"35.43"
"38646"	"False"	"High"	"[R].LTHFPTVSGSPASLADSMQQKLAGPR.[R]"	"1xBiotin [K21]"	"2.63164E-07"	"0.000721313"	"1"	"1"	"6"	"Q9D8V0-4"	"Q9D8V0-4 [359-384]"	"Q9D8V0-4 1xBiotin [K379]"	"1"	"2922.46006"	"0.815"	"2.007"	"0.925138005747468"	"0.906515362333117"	"51.20"	"95.05"	"74.8"	"66.7"	"158.4"	"31.46"	"40.23"	"69.58"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.151E-08"	"6.77"	"56.98"
"38640"	"False"	"High"	"[R].ITGSVGKGLAAITMDKEYQQK.[R]"	"1xBiotin [K7]"	"0.000397485"	"0.000721313"	"1"	"3"	"10"	"Q8BX70-1"	"Q8BX70-1 [3476-3496]"	"Q8BX70-1 1xBiotin [K3482]"	"2"	"2464.25744"	"0.358"	"0.928"	"0.925138005747468"	"0.906515362333117"	"35.21"	"46.49"	"130.6"	"48.2"	"121.2"	"27.99"	"37.96"	"41.30"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.572E-05"	"4.46"	"47.67"
"38638"	"False"	"High"	"[R].ITGSVGKGLAAITMDK.[E]"	"1xBiotin [K7]"	"0.000328057"	"0.000721313"	"1"	"3"	"7"	"Q8BX70-1"	"Q8BX70-1 [3476-3491]"	"Q8BX70-1 1xBiotin [K3482]"	"1"	"1787.93940"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.967E-05"	"3.25"	""
"38636"	"False"	"High"	"[K].LTGSLSGWTSPK.[D]"	""	"0.00034686"	"0.000721313"	"1"	"1"	"9"	"Q99KI0"	"Q99KI0 [234-245]"	""	"0"	"1233.64738"	"137.592"	"2.920"	"0.928611703535518"	"0.906515362333117"	"84.84"	"85.58"	"1.9"	"291.6"	"6.5"	"71.32"	"42.40"	"36.36"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.13E-05"	"3.28"	"37.95"
"38630"	"False"	"High"	"[R].LTGNFKHASSILPITEFSDITRR.[T]"	"1xBiotin [K6]"	"3.33814E-05"	"0.000721313"	"1"	"3"	"6"	"Q61029"	"Q61029 [297-319]"	"Q61029 1xBiotin [K302]"	"2"	"2829.47161"	"0.944"	"17.005"	"0.993174102210305"	"0.906515362333117"	"73.67"	"64.95"	"17.3"	"15.7"	"267.0"	"73.59"	"23.97"	"28.39"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"3.304E-06"	"3.83"	"55.42"
"38629"	"False"	"High"	"[R].LTGNFKHASSILPITEFSDITR.[R]"	"1xBiotin [K6]"	"2.12142E-06"	"0.000721313"	"1"	"3"	"98"	"Q61029"	"Q61029 [297-318]"	"Q61029 1xBiotin [K302]"	"1"	"2673.37050"	"0.379"	"4.329"	"0.0103906751949773"	"0.906515362333117"	"47.93"	"54.03"	"53.8"	"19.9"	"226.3"	"37.28"	"33.72"	"63.67"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.346E-07"	"5.53"	"58.10"
"38800"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"2xBiotin [K7; K25]; 1xOxidation [M23]"	"0.000373618"	"0.000721313"	"1"	"1"	"12"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 2xBiotin [K133; K151]"	"1"	"3927.91181"	"0.429"	"12.767"	"0.929016530787821"	"0.906515362333117"	"76.68"	"86.62"	"20.9"	"11.6"	"267.5"	"94.84"	"39.94"	"32.40"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.37E-05"	"3.61"	"57.06"
"38585"	"False"	"High"	"[K].LTEPAPVPIHKLSVSNMVHTAK.[K]"	"1xBiotin [K11]"	"0.0006983"	"0.000721313"	"1"	"1"	"26"	"Q80UJ7"	"Q80UJ7 [367-388]"	"Q80UJ7 1xBiotin [K377]"	"1"	"2595.37856"	"0.016"	"1.358"	"2.02065471673078E-05"	"0.995815753748193"	"59.13"	"27.92"	"122.9"	"2.1"	"175.0"	"18.24"	"61.42"	"16.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.128E-05"	"3.38"	"46.61"
"39182"	"False"	"High"	"[K].LVINGKPITIFQER.[D]"	"1xBiotin [K6]"	"0.002335"	"0.000721313"	"1"	"1"	"8"	"P16858"	"P16858 [65-78]"	"P16858 1xBiotin [K70]"	"0"	"1854.03060"	"0.607"	"0.585"	"0.925138005747468"	"0.906515362333117"	"74.43"	"60.18"	"136.5"	"83.9"	"79.7"	"54.86"	"53.97"	"51.16"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.000192"	"2.17"	"56.73"
"39289"	"False"	"High"	"[R].LVPGWTKPITIGR.[H]"	""	"0.00095168"	"0.000721313"	"1"	"1"	"13"	"P54071"	"P54071 [160-172]"	""	"0"	"1437.85765"	"219.569"	"9.315"	"0.408414121338871"	"0.906515362333117"	"60.36"	"65.07"	"1.2"	"286.6"	"12.2"	"51.51"	"41.90"	"52.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.214E-05"	"2.97"	"41.81"
"41393"	"False"	"High"	"[K].MASTPASYGNTTTKPMGLLSR.[V]"	"1xBiotin [K14]; 1xOxidation [M]"	"0.00237875"	"0.000721313"	"1"	"2"	"10"	"Q8BRF7"	"Q8BRF7 [499-519]"	"Q8BRF7 1xBiotin [K512]"	"0"	"2426.15126"	"0.335"	"0.915"	"0.925138005747468"	"0.906515362333117"	"67.91"	"84.73"	"157.3"	"51.8"	"90.9"	"52.62"	"37.56"	"54.96"	""	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001959"	"3.49"	"47.82"
"41266"	"False"	"High"	"[-].MASGSGTKNLDFR.[R]"	"1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"0.00102508"	"0.000721313"	"1"	"1"	"12"	"Q9CPW7"	"Q9CPW7 [1-13]"	"Q9CPW7 1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1520.71620"	"0.162"	"0.729"	"0.247923689696889"	"0.906515362333117"	"31.51"	"29.34"	"162.6"	"24.8"	"112.6"	"26.78"	"23.83"	"18.81"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.818E-05"	"2.91"	"44.52"
"41185"	"False"	"High"	"[-].MARPLEEALDVIVSTFHK.[Y]"	"1xMet-loss+Acetyl [N-Term]"	"2.0979E-05"	"0.000721313"	"1"	"1"	"5"	"P07091"	"P07091 [1-18]"	"P07091 1xMet-loss+Acetyl [N-Term]"	"0"	"1967.05965"	"0.627"	"1.499"	"0.945216151185579"	"0.937945192250145"	"82.92"	"60.00"	"105.6"	"55.0"	"139.4"	"43.79"	"235.21"	"28.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"2.119E-06"	"5.82"	"68.19"
"40300"	"False"	"High"	"[R].MADSLASKVTR.[L]"	"1xBiotin [K8]; 1xOxidation [M1]"	"0.000349015"	"0.000721313"	"1"	"1"	"11"	"O35153"	"O35153 [24-34]"	"O35153 1xBiotin [K31]"	"1"	"1420.69230"	"0.567"	"0.881"	"0.0212730684969713"	"0.906515362333117"	"43.30"	"24.28"	"114.5"	"79.5"	"106.0"	"26.58"	"36.73"	"30.04"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.157E-05"	"3.31"	"39.11"
"40299"	"False"	"High"	"[R].MADSLASKVTR.[L]"	"1xBiotin [K8]"	"3.64049E-05"	"0.000721313"	"1"	"1"	"24"	"O35153"	"O35153 [24-34]"	"O35153 1xBiotin [K31]"	"1"	"1404.69738"	"0.013"	"0.936"	"1.16364095154626E-05"	"0.906515362333117"	"52.48"	"26.39"	"159.6"	"2.0"	"138.5"	"19.91"	"50.47"	"22.43"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.597E-06"	"4.19"	"41.62"
"40146"	"False"	"High"	"[-].MAATTGSGVKVPR.[N]"	"1xBiotin [K10]; 1xMet-loss+Acetyl [N-Term]"	"0.00137127"	"0.000721313"	"1"	"2"	"12"	"Q9CZY3"	"Q9CZY3 [1-13]"	"Q9CZY3 1xBiotin [K10]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1411.73621"	"0.078"	"0.616"	"0.00671530157851783"	"0.906515362333117"	"64.67"	"55.80"	"173.8"	"16.4"	"109.8"	"44.16"	"43.25"	"52.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001163"	"2.87"	"37.71"
"39941"	"False"	"High"	"[-].MAAGFKTVEPLEYYR.[R]"	"1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"0.000883536"	"0.000721313"	"1"	"1"	"11"	"Q9D753"	"Q9D753 [1-15]"	"Q9D753 1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1911.93095"	"0.407"	"0.526"	"0.925138005747468"	"0.906515362333117"	"83.71"	"51.71"	"153.3"	"68.0"	"78.7"	"39.48"	"180.13"	"40.34"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"7.674E-05"	"2.47"	"59.99"
"39791"	"False"	"High"	"[-].MAAAAATAATKGNGGGSGR.[V]"	"1xBiotin [K11]; 1xMet-loss+Acetyl [N-Term]"	"4.01969E-05"	"0.000721313"	"1"	"1"	"19"	"Q9D3B1"	"Q9D3B1 [1-19]"	"Q9D3B1 1xBiotin [K11]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1756.83951"	"0.031"	"0.701"	"6.58331229130953E-05"	"0.906515362333117"	"57.53"	"43.44"	"171.7"	"5.4"	"122.9"	"30.83"	"43.96"	"22.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"3.949E-06"	"4.04"	"37.17"
"39790"	"False"	"High"	"[-].MAAAAATAATKGNGGGSGR.[V]"	"1xBiotin [K11]; 1xMet-loss [N-Term]"	"1.53923E-05"	"0.000721313"	"1"	"1"	"21"	"Q9D3B1"	"Q9D3B1 [1-19]"	"Q9D3B1 1xBiotin [K11]; 1xMet-loss [N-Term]"	"1"	"1714.82894"	"0.058"	"0.710"	"0.00339105827698877"	"0.906515362333117"	"53.96"	"41.74"	"172.1"	"8.6"	"119.3"	"37.76"	"49.67"	"39.43"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.571E-06"	"4.14"	"24.58"
"39747"	"False"	"High"	"[K].LYTLVTYVPVTTFK.[N]"	""	"0.000466921"	"0.000721313"	"1"	"1"	"12"	"P62900"	"P62900 [102-115]"	""	"0"	"1644.92472"	"72.382"	"1.404"	"0.478597253695619"	"0.919063063983313"	"56.90"	"98.80"	"4.0"	"290.3"	"5.6"	"9.64"	"48.56"	"78.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.16E-05"	"3.14"	"55.95"
"39723"	"False"	"High"	"[K].LYSKMIVGNHEDR.[S]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.000184429"	"0.000721313"	"1"	"1"	"10"	"Q8K2C8"	"Q8K2C8 [441-453]"	"Q8K2C8 1xBiotin [K444]"	"1"	"1803.85165"	"0.063"	"0.752"	"0.00375902477549748"	"0.906515362333117"	"61.85"	"63.54"	"142.8"	"11.9"	"145.3"	"40.84"	"42.60"	"52.10"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.713E-05"	"2.83"	"35.51"
"39722"	"False"	"High"	"[K].LYSKMIVGNHEDR.[S]"	"1xBiotin [K4]"	"9.56612E-05"	"0.000721313"	"1"	"1"	"11"	"Q8K2C8"	"Q8K2C8 [441-453]"	"Q8K2C8 1xBiotin [K444]"	"1"	"1787.85674"	"0.102"	"0.823"	"0.00618834630488763"	"0.906515362333117"	"42.50"	"37.45"	"160.3"	"14.7"	"125.0"	"26.84"	"29.91"	"31.63"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.102E-06"	"4.19"	"39.35"
"39252"	"False"	"High"	"[K].IVNLGSSKTDLFYER.[K]"	"1xBiotin [K8]"	"6.0869E-05"	"0.000721313"	"1"	"1"	"11"	"P83870"	"P83870 [88-102]"	"P83870 1xBiotin [K95]"	"1"	"1967.98952"	"0.197"	"0.231"	"0.925138005747468"	"0.906515362333117"	"94.50"	"93.27"	"202.0"	"38.8"	"59.2"	"76.50"	"213.72"	"114.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"5.895E-06"	"3.94"	"53.90"
"39686"	"False"	"High"	"[K].IYNSIYIGSQDALIAHYPR.[I]"	""	"0.000182158"	"0.000721313"	"1"	"1"	"2"	"Q99NB9"	"Q99NB9 [1268-1286]"	""	"0"	"2194.12913"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"1.687E-05"	"2.85"	""
"39578"	"False"	"High"	"[K].LYCIYVAIGQK.[R]"	"1xCarbamidomethyl [C3]"	"0.00103785"	"0.000721313"	"1"	"1"	"16"	"Q03265"	"Q03265 [242-252]"	""	"0"	"1327.70787"	"91.067"	"2.840"	"0.993882874540102"	"0.906515362333117"	"54.72"	"51.00"	"3.2"	"288.8"	"8.0"	"59.31"	"24.19"	"19.96"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.91E-05"	"2.87"	"45.85"
"39554"	"False"	"High"	"[R].IWVLDYFGGPK.[V]"	""	"0.000733761"	"0.000721313"	"1"	"1"	"8"	"O88668"	"O88668 [197-207]"	""	"0"	"1294.68304"	"120.456"	"3.389"	"0.435748277446407"	"0.906515362333117"	"30.69"	"41.07"	"2.5"	"289.4"	"8.0"	"20.56"	"30.43"	"44.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.431E-05"	"2.80"	"60.09"
"39545"	"False"	"High"	"[R].LWSNFWGGLSADGYYAR.[S]"	""	"0.00124967"	"0.000721313"	"1"	"1"	"8"	"Q9R0E2"	"Q9R0E2 [415-431]"	""	"0"	"1962.91332"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001068"	"2.92"	""
"39511"	"False"	"High"	"[R].LWLLDDSKSWWR.[V]"	"1xBiotin [K8]"	"0.001432"	"0.000721313"	"1"	"1"	"6"	"Q99M51"	"Q99M51 [29-40]"	"Q99M51 1xBiotin [K36]"	"1"	"1830.89959"	"0.983"	"1.212"	""	"0.906515362333117"	"49.79"	"57.81"	"91.4"	"96.6"	"112.1"	"31.28"	"40.43"	"51.05"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001214"	"3.44"	"65.31"
"39501"	"False"	"High"	"[K].IWHHTFYNELR.[V]"	""	"0.000146661"	"0.000721313"	"1"	"4"	"182"	"P60710"	"P60710 [85-95]"	""	"0"	"1515.74916"	"151.550"	"4.815"	"0.925138005747468"	"0.906515362333117"	"69.17"	"67.93"	"1.7"	"290.3"	"8.0"	"63.25"	"61.72"	"26.49"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.369E-05"	"3.19"	"35.99"
"39468"	"False"	"High"	"[K].LVYLYLMNYAK.[S]"	"1xOxidation [M7]"	"0.000916976"	"0.000721313"	"1"	"3"	"21"	"O35643"	"O35643 [68-78]"	""	"0"	"1406.73884"	"219.083"	"3.978"	"0.925138005747468"	"0.906515362333117"	"45.98"	"36.88"	"1.2"	"293.9"	"4.9"	"24.51"	"38.08"	"22.51"	"MandatoryModificationMissing"	"High"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.929E-05"	"2.89"	"49.16"
"39467"	"False"	"High"	"[K].LVYLYLMNYAK.[S]"	""	"0.000872663"	"0.000721313"	"1"	"3"	"18"	"O35643"	"O35643 [68-78]"	""	"0"	"1390.74392"	"63.942"	"3.531"	"0.962122454074805"	"0.906515362333117"	"48.22"	"36.84"	"4.8"	"278.8"	"16.4"	"32.24"	"72.54"	"19.64"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.584E-05"	"2.66"	"56.74"
"39455"	"False"	"High"	"[K].LVVVDFSATWCGPCK.[M]"	"2xCarbamidomethyl [C11; C14]"	"0.000872663"	"0.000721313"	"1"	"1"	"9"	"P10639"	"P10639 [22-36]"	""	"0"	"1738.82912"	"0.930"	"3.902"	"0.925138005747468"	"0.906515362333117"	"127.83"	"56.89"	"57.5"	"32.0"	"210.4"	"51.11"	"218.20"	"42.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.572E-05"	"3.20"	"52.59"
"39402"	"False"	"High"	"[R].LVTGWVKPIIIGR.[H]"	""	"0.000210043"	"0.000721313"	"1"	"1"	"31"	"O88844"	"O88844 [120-132]"	""	"0"	"1451.90968"	"114.051"	"5.181"	"0.935194287285695"	"0.906515362333117"	"60.67"	"68.96"	"2.3"	"285.5"	"12.2"	"52.34"	"39.03"	"48.66"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.932E-05"	"2.91"	"47.56"
"39383"	"False"	"High"	"[R].IVSQLLTLMDGLK.[Q]"	""	"0.00015411"	"0.000721313"	"1"	"1"	"11"	"Q01853"	"Q01853 [324-336]"	""	"0"	"1430.82871"	"71.412"	"7.520"	"0.925138005747468"	"0.906515362333117"	"79.87"	"77.86"	"4.5"	"264.7"	"30.8"	"53.12"	"48.60"	"59.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.433E-05"	"3.40"	"62.47"
"39379"	"False"	"High"	"[R].LVSLIGSKTQIPTQR.[Y]"	"1xBiotin [K8]"	"0.000738318"	"0.000721313"	"1"	"1"	"15"	"Q9R1P4"	"Q9R1P4 [108-122]"	"Q9R1P4 1xBiotin [K115]"	"1"	"1867.04698"	"0.121"	"0.802"	"0.368592391352662"	"0.906515362333117"	"72.89"	"70.20"	"145.0"	"24.4"	"130.6"	"74.06"	"43.91"	"64.47"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.448E-05"	"3.14"	"48.95"
"39329"	"False"	"High"	"[K].LVQIEYALAAVAGGAPSVGIK.[A]"	""	"0.00176742"	"0.000721313"	"1"	"1"	"9"	"P49722"	"P49722 [19-39]"	""	"0"	"2027.15355"	"49.509"	"0.991"	"0.925138005747468"	"0.906515362333117"	"69.16"	"102.87"	"5.0"	"289.5"	"5.5"	"30.81"	"61.62"	"93.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.000148"	"4.31"	"61.51"
"39647"	"False"	"High"	"[R].LYIGLAGLATDVQTVAQR.[L]"	""	"0.000184429"	"0.000721313"	"1"	"1"	"9"	"Q9R1P1"	"Q9R1P1 [49-66]"	""	"0"	"1889.04909"	"36.482"	"1.212"	"0.925138005747468"	""	"117.57"	"73.21"	"7.7"	"282.6"	"9.7"	"26.12"	"85.91"	"55.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.705E-05"	"3.90"	"59.30"
"33609"	"False"	"High"	"[R].IKEEYEVAEMGAPHGSASVR.[T]"	"1xBiotin [K2]"	"8.96955E-07"	"0.000721313"	"1"	"1"	"8"	"Q9CQW9"	"Q9CQW9 [23-42]"	"Q9CQW9 1xBiotin [K24]"	"1"	"2386.11659"	"0.201"	"1.197"	"0.925138005747468"	"0.916215054610739"	"85.23"	"113.04"	"151.8"	"20.2"	"128.0"	"51.04"	"67.75"	"94.26"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.025E-07"	"5.41"	"40.21"
"33592"	"False"	"High"	"[R].LKEAINTSK.[D]"	"1xBiotin [K2]"	"0.00107048"	"0.000721313"	"1"	"1"	"9"	"Q9ERB0"	"Q9ERB0 [146-154]"	"Q9ERB0 1xBiotin [K147]"	"1"	"1229.65583"	"0.112"	"0.699"	"0.00641881286054574"	"0.906515362333117"	"52.46"	"46.31"	"165.8"	"19.4"	"114.7"	"34.46"	"41.11"	"44.50"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.202E-05"	"3.17"	"30.94"
"33311"	"False"	"High"	"[K].LHFKPFGNPVFAR.[D]"	""	"0.000616964"	"0.000721313"	"1"	"1"	"23"	"Q6P5D8"	"Q6P5D8 [1800-1812]"	""	"0"	"1529.83758"	"112.772"	"3.005"	"0.947835990867828"	"0.906515362333117"	"65.01"	"60.58"	"2.4"	"290.3"	"7.3"	"43.43"	"83.04"	"94.43"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"5.451E-05"	"2.87"	"42.92"
"25911"	"False"	"High"	"[R].KCPFYAAQPDK.[G]"	"1xBiotin [K1]; 1xCarbamidomethyl [C2]"	"4.90072E-05"	"0.000721313"	"1"	"1"	"40"	"O70252"	"O70252 [263-273]"	"O70252 1xBiotin [K263]"	"1"	"1550.71303"	"0.055"	"0.850"	"0.00023281438288468"	"0.906515362333117"	"56.20"	"23.37"	"152.6"	"9.3"	"138.0"	"27.59"	"80.23"	"15.11"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.781E-06"	"4.18"	"38.64"
"25840"	"False"	"High"	"[K].KAYFLGYMVHR.[L]"	"1xOxidation [M8]"	"0.00107713"	"0.000721313"	"1"	"1"	"3"	"Q8CFI7"	"Q8CFI7 [361-371]"	""	"1"	"1400.71435"	"126.338"	"1.073"	"0.427089858136149"	""	"53.72"	"55.20"	"2.4"	"294.4"	"3.1"	"38.11"	"35.36"	"41.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"9.229E-05"	"2.27"	"33.44"
"25824"	"False"	"High"	"[K].KAVQQSGDKNMSK.[V]"	"1xBiotin [K]; 1xOxidation [M11]"	"0.00117465"	"0.000721313"	"1"	"1"	"10"	"Q91WE4"	"Q91WE4 [35-47]"	"Q91WE4 1xBiotin [K]"	"2"	"1662.79380"	"0.178"	"1.027"	"0.0140968257447818"	"0.906515362333117"	"71.66"	"60.39"	"139.6"	"25.1"	"135.3"	"78.96"	"212.27"	"15.13"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001003"	"4.45"	"16.14"
"25823"	"False"	"High"	"[K].KAVQQSGDKNMSK.[V]"	"1xBiotin [K9]"	"0.000644293"	"0.000721313"	"1"	"1"	"12"	"Q91WE4"	"Q91WE4 [35-47]"	"Q91WE4 1xBiotin [K43]"	"2"	"1646.79889"	"0.100"	"1.047"	"0.00631326284207043"	"0.906515362333117"	"68.59"	"33.67"	"145.6"	"11.7"	"142.7"	"34.73"	"51.99"	"9.43"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"5.653E-05"	"4.46"	"20.86"
"25709"	"False"	"High"	"[K].KAPGFGGFGSSAVSGGSTAAMITETIIETDKPK.[V]"	"1xBiotin [K1]; 1xOxidation [M21]"	"7.93442E-06"	"0.000721313"	"1"	"1"	"13"	"Q5XJY5"	"Q5XJY5 [179-211]"	"Q5XJY5 1xBiotin [K179]"	"1"	"3454.68688"	"1.177"	"8.196"	""	"0.906515362333117"	"82.63"	"62.22"	"26.2"	"47.1"	"226.8"	"51.37"	"48.63"	"31.41"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.325E-07"	"4.39"	"59.51"
"25708"	"False"	"High"	"[K].KAPGFGGFGSSAVSGGSTAAMITETIIETDKPK.[V]"	"1xBiotin [K1]"	"8.27572E-07"	"0.000721313"	"1"	"1"	"9"	"Q5XJY5"	"Q5XJY5 [179-211]"	"Q5XJY5 1xBiotin [K179]"	"1"	"3438.69197"	"1.494"	"11.474"	""	"0.906515362333117"	"54.15"	"87.48"	"19.7"	"29.5"	"250.8"	"46.90"	"31.49"	"59.12"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.463E-08"	"5.51"	"61.61"
"25693"	"False"	"High"	"[R].KANLTCKLAIDNLEK.[A]"	"1xBiotin [K]; 1xCarbamidomethyl [C6]"	"0.00101875"	"0.000721313"	"1"	"1"	"10"	"Q6QD59"	"Q6QD59 [97-111]"	"Q6QD59 1xBiotin [K]"	"2"	"1957.02453"	"0.166"	"0.730"	"0.12283963724332"	"0.906515362333117"	"36.29"	"37.80"	"155.8"	"29.4"	"114.8"	"33.84"	"17.59"	"12.15"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.769E-05"	"3.42"	"45.79"
"25684"	"False"	"High"	"[R].KAMPSNSPVAALAATGK.[E]"	"1xBiotin [K1]; 1xOxidation [M3]"	"0.000355559"	"0.000721313"	"1"	"1"	"10"	"Q9QY76"	"Q9QY76 [200-216]"	"Q9QY76 1xBiotin [K200]"	"1"	"1855.94047"	"0.520"	"1.098"	"0.925138005747468"	"0.909223670800027"	"98.72"	"88.77"	"105.5"	"62.5"	"131.9"	"80.79"	"40.07"	"47.49"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.208E-05"	"3.40"	"40.82"
"25683"	"False"	"High"	"[R].KAMPSNSPVAALAATGK.[E]"	"1xBiotin [K1]"	"7.15032E-05"	"0.000721313"	"1"	"1"	"11"	"Q9QY76"	"Q9QY76 [200-216]"	"Q9QY76 1xBiotin [K200]"	"1"	"1839.94555"	"0.154"	"0.797"	"0.925138005747468"	"0.906515362333117"	"84.09"	"30.75"	"154.2"	"24.9"	"120.8"	"52.56"	"63.64"	"19.92"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.884E-06"	"3.55"	"44.88"
"25636"	"False"	"High"	"[R].KAIIIFVPVPQLK.[S]"	""	"0.0015909"	"0.000721313"	"1"	"1"	"2"	"P62082"	"P62082 [58-70]"	""	"1"	"1465.95048"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001338"	"3.40"	""
"25601"	"False"	"High"	"[K].KALAAAGYDVEK.[N]"	"1xBiotin [K1]"	"8.5042E-05"	"0.000721313"	"2"	"4"	"12"	"P15864; P43277"	"P15864 [64-75]; P43277 [65-76]"	"P15864 1xBiotin [K64]; P43277 1xBiotin [K65]"	"1"	"1461.74063"	"0.153"	"1.104"	"0.925138005747468"	"0.907108336447894"	"48.01"	"75.78"	"132.4"	"21.8"	"145.9"	"35.31"	"38.47"	"60.40"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.133E-06"	"3.78"	"38.40"
"25495"	"False"	"High"	"[R].KAEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K]; 1xOxidation [M5]"	"7.32966E-05"	"0.000721313"	"1"	"1"	"13"	"P09581"	"P09581 [676-704]"	"P09581 1xBiotin [K]"	"2"	"3330.56168"	"0.399"	"0.710"	"0.0114501370223797"	"0.906515362333117"	"387.58"	"44.57"	"132.5"	"63.1"	"104.4"	"40.78"	"124.42"	"34.00"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.05E-06"	"4.23"	"41.93"
"25494"	"False"	"High"	"[R].KAEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K]"	"1.83068E-05"	"0.000721313"	"1"	"1"	"11"	"P09581"	"P09581 [676-704]"	"P09581 1xBiotin [K]"	"2"	"3314.56677"	"0.163"	"1.385"	"0.925138005747468"	"0.919063063983313"	"111.13"	"80.64"	"131.7"	"17.7"	"150.7"	"64.11"	"210.17"	"49.42"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.862E-06"	"4.69"	"43.97"
"25482"	"False"	"High"	"[K].KADIGVAMGIVGSDVSK.[Q]"	"1xBiotin [K1]"	"1.53923E-05"	"0.000721313"	"1"	"1"	"10"	"Q8VDN2"	"Q8VDN2 [727-743]"	"Q8VDN2 1xBiotin [K727]"	"1"	"1872.95578"	"0.250"	"0.601"	"0.925138005747468"	"0.906515362333117"	"90.37"	"91.11"	"157.1"	"46.4"	"96.5"	"105.80"	"44.05"	"73.30"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.575E-06"	"3.92"	"51.80"
"25426"	"False"	"High"	"[R].HYYSITINYR.[K]"	""	"0.000867277"	"0.000721313"	"1"	"1"	"13"	"O35593"	"O35593 [199-208]"	""	"0"	"1329.65861"	"204.096"	"5.152"	"0.925138005747468"	"0.906515362333117"	"63.16"	"64.50"	"1.8"	"290.3"	"7.9"	"70.92"	"84.29"	"77.67"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.539E-05"	"2.79"	"36.66"
"25405"	"False"	"High"	"[K].HYKSTVGVDFALK.[V]"	"1xBiotin [K3]"	"0.000106942"	"0.000721313"	"1"	"1"	"26"	"Q91YQ1"	"Q91YQ1 [35-47]"	"Q91YQ1 1xBiotin [K37]"	"1"	"1690.86214"	"0.037"	"0.936"	"9.06719145300864E-05"	"0.906515362333117"	"60.14"	"43.21"	"154.6"	"6.3"	"139.1"	"36.63"	"44.51"	"20.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.013E-05"	"4.06"	"43.97"
"25396"	"False"	"High"	"[R].HYGGLTGLNK.[A]"	""	"0.000288052"	"0.000721313"	"1"	"2"	"23"	"Q9DBJ1"	"Q9DBJ1 [91-100]"	""	"0"	"1059.55817"	"109.083"	"2.855"	"0.929016530787821"	"0.906515362333117"	"72.17"	"67.38"	"2.5"	"290.4"	"7.1"	"53.93"	"43.69"	"18.38"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.624E-05"	"3.14"	"24.02"
"25378"	"False"	"High"	"[K].HWPSSHNWFFAK.[L]"	""	"0.000245214"	"0.000721313"	"1"	"1"	"6"	"O88668"	"O88668 [180-191]"	""	"0"	"1543.72294"	"219.439"	"3.759"	"0.925138005747468"	"0.906515362333117"	"106.65"	"117.34"	"1.3"	"294.4"	"4.4"	"100.14"	"43.54"	"43.72"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"2.241E-05"	"3.02"	"43.76"
"25377"	"False"	"High"	"[K].HWPFMVVNDAGRPK.[V]"	"1xOxidation [M5]"	"1.18523E-06"	"0.000721313"	"1"	"1"	"64"	"P63017"	"P63017 [89-102]"	""	"0"	"1669.82676"	"172.052"	"3.810"	"0.925138005747468"	"0.906515362333117"	"42.90"	"41.59"	"1.7"	"291.7"	"6.6"	"33.78"	"38.70"	"30.85"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.337E-07"	"4.88"	"37.48"
"25376"	"False"	"High"	"[K].HWPFMVVNDAGRPK.[V]"	""	"6.67123E-06"	"0.000721313"	"1"	"1"	"29"	"P63017"	"P63017 [89-102]"	""	"0"	"1653.83184"	"101.299"	"8.238"	"0.951001576605419"	"0.906515362333117"	"109.38"	"96.09"	"2.4"	"271.5"	"26.1"	"81.70"	"83.12"	"28.22"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.053E-07"	"4.99"	"41.10"
"25367"	"False"	"High"	"[R].HWGGNVLGPK.[S]"	""	"0.00171356"	"0.000721313"	"1"	"1"	"19"	"P12970"	"P12970 [236-245]"	""	"0"	"1064.56359"	"96.262"	"3.207"	"0.949662611758987"	"0.906515362333117"	"76.61"	"67.65"	"2.9"	"287.2"	"9.9"	"77.20"	"61.74"	"29.56"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001438"	"2.91"	"28.28"
"25351"	"False"	"High"	"[K].HVSTSSDEGSPSASTPMINKTGFK.[F]"	"1xBiotin [K20]; 1xOxidation [M17]"	"2.2458E-05"	"0.000721313"	"1"	"1"	"23"	"Q8BGR2"	"Q8BGR2 [238-261]"	"Q8BGR2 1xBiotin [K257]"	"1"	"2707.23381"	"0.089"	"0.755"	"0.00360557416517033"	"0.906515362333117"	"44.08"	"36.26"	"159.8"	"14.4"	"125.8"	"32.86"	"29.29"	"13.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.258E-06"	"6.08"	"38.35"
"25350"	"False"	"High"	"[K].HVSTSSDEGSPSASTPMINKTGFK.[F]"	"1xBiotin [K20]"	"1.11406E-06"	"0.000721313"	"1"	"1"	"13"	"Q8BGR2"	"Q8BGR2 [238-261]"	"Q8BGR2 1xBiotin [K257]"	"1"	"2691.23889"	"0.044"	"0.929"	"0.00532160659296196"	"0.906515362333117"	"76.04"	"28.41"	"154.1"	"6.5"	"139.4"	"14.52"	"63.05"	"25.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.263E-07"	"6.26"	"41.51"
"25289"	"False"	"High"	"[R].HVDAHATLNDGVVVQVMGLLSNNNQALR.[R]"	""	"3.17679E-05"	"0.000721313"	"1"	"1"	"5"	"P97855"	"P97855 [79-106]"	""	"0"	"2985.53231"	"0.614"	"1.410"	""	"0.906515362333117"	"43.78"	"79.82"	"103.9"	"73.8"	"122.3"	"38.24"	"33.63"	"69.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"3.153E-06"	"4.77"	"60.71"
"25223"	"False"	"High"	"[K].HTGPGILSMANAGPNTNGSQFFICTAK.[T]"	"1xCarbamidomethyl [C24]; 1xOxidation [M9]"	"1.35824E-06"	"0.000721313"	"1"	"1"	"15"	"P17742"	"P17742 [92-118]"	""	"0"	"2807.32396"	"446.149"	"10.003"	"0.924218194593475"	"0.906515362333117"	"39.16"	"56.49"	"0.6"	"292.6"	"6.7"	"55.27"	"27.71"	"34.08"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.528E-07"	"6.18"	"44.89"
"25912"	"False"	"High"	"[R].KCPFYAAQPDKGTLGGSNCPFQTTVAVLR.[K]"	"1xBiotin [K1]; 2xCarbamidomethyl [C2; C19]"	"2.36867E-07"	"0.000721313"	"1"	"1"	"23"	"O70252"	"O70252 [263-291]"	"O70252 1xBiotin [K263]"	"2"	"3409.64900"	"0.045"	"2.084"	"0.00184006519548732"	"0.906515362333117"	"54.97"	"39.70"	"101.3"	"4.1"	"194.6"	"25.57"	"50.08"	"25.99"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.843E-08"	"4.59"	"52.64"
"25984"	"False"	"High"	"[R].KDDLLQQAR.[K]"	"1xBiotin [K1]"	"0.000928401"	"0.000721313"	"1"	"2"	"9"	"Q9R049"	"Q9R049 [586-594]"	"Q9R049 1xBiotin [K586]"	"1"	"1312.66780"	"0.102"	"0.748"	"0.716607214650224"	"0.906515362333117"	"58.25"	"56.22"	"167.0"	"14.8"	"118.2"	"25.51"	"49.06"	"62.86"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"8.056E-05"	"3.32"	"38.58"
"26029"	"False"	"High"	"[R].KDFLAMFSPK.[C]"	"1xBiotin [K1]"	"0.00149541"	"0.000721313"	"1"	"1"	"5"	"Q99N69"	"Q99N69 [260-269]"	"Q99N69 1xBiotin [K260]"	"1"	"1409.69559"	"0.169"	"0.901"	"0.925138005747468"	"0.906777072223237"	"72.98"	"39.81"	"137.8"	"22.4"	"139.8"	"34.82"	"54.63"	"23.90"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001267"	"2.25"	"60.29"
"26030"	"False"	"High"	"[R].KDFLAMFSPK.[C]"	"1xBiotin [K1]; 1xOxidation [M6]"	"0.0017242"	"0.000721313"	"1"	"1"	"11"	"Q99N69"	"Q99N69 [260-269]"	"Q99N69 1xBiotin [K260]"	"1"	"1425.69051"	"0.266"	"0.755"	"0.925138005747468"	"0.906515362333117"	"57.40"	"51.16"	"141.8"	"41.7"	"116.5"	"42.60"	"41.10"	"29.02"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001446"	"3.12"	"53.07"
"27072"	"False"	"High"	"[K].KGNFNYIEFTR.[I]"	"1xBiotin [K1]"	"7.60713E-05"	"0.000721313"	"1"	"1"	"12"	"Q3THE2"	"Q3THE2 [151-161]"	"Q3THE2 1xBiotin [K151]"	"1"	"1614.77332"	"0.140"	"0.806"	"0.925138005747468"	"0.906515362333117"	"50.19"	"47.67"	"157.2"	"21.6"	"121.2"	"33.19"	"45.96"	"36.89"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.295E-06"	"3.34"	"49.28"
"27008"	"False"	"High"	"[R].KGLGPSQQDPNRFDR.[D]"	"1xBiotin [K1]"	"0.00183429"	"0.000721313"	"1"	"1"	"6"	"Q9WTR1"	"Q9WTR1 [58-72]"	"Q9WTR1 1xBiotin [K58]"	"2"	"1940.93955"	"0.087"	"0.770"	"0.00338850492409696"	"0.906515362333117"	"54.06"	"49.21"	"165.9"	"16.0"	"118.1"	"38.53"	"48.23"	"26.51"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001535"	"2.49"	"33.85"
"27007"	"False"	"High"	"[R].KGLGPSQQDPNR.[F]"	"1xBiotin [K1]"	"0.00150469"	"0.000721313"	"1"	"1"	"6"	"Q9WTR1"	"Q9WTR1 [58-69]"	"Q9WTR1 1xBiotin [K58]"	"1"	"1522.74309"	"0.241"	"0.691"	"0.925138005747468"	"0.906515362333117"	"62.15"	"88.69"	"157.1"	"40.2"	"102.8"	"57.58"	"37.58"	"60.58"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001271"	"3.00"	"29.71"
"26970"	"False"	"High"	"[K].KGHQLLDPYLTVSVDQVR.[V]"	"1xBiotin [K1]"	"0.000105626"	"0.000721313"	"1"	"1"	"4"	"P23298"	"P23298 [36-53]"	"P23298 1xBiotin [K36]"	"1"	"2294.19616"	"0.988"	"1.365"	"0.994201151226993"	"0.938631779069411"	"71.32"	"101.03"	"86.5"	"87.6"	"125.9"	"103.12"	"41.18"	"98.99"	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"1.003E-05"	"4.83"	"50.05"
"26939"	"False"	"High"	"[K].KGFVEVTELTDVTYTSNLVR.[L]"	"1xBiotin [K1]"	"3.96532E-06"	"0.000721313"	"1"	"1"	"4"	"Q80TN4"	"Q80TN4 [596-615]"	"Q80TN4 1xBiotin [K596]"	"1"	"2497.26430"	"0.884"	"0.906"	"0.952589814133025"	"0.906515362333117"	"47.54"	"81.34"	"114.4"	"93.7"	"91.9"	"23.27"	"46.56"	"72.53"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"4.27E-07"	"5.76"	"59.82"
"26896"	"False"	"High"	"[K].KGELLMEDVWPLSK.[Y]"	"1xBiotin [K1]"	"0.00174568"	"0.000721313"	"1"	"1"	"4"	"Q9R1X5"	"Q9R1X5 [125-138]"	"Q9R1X5 1xBiotin [K125]"	"1"	"1870.94415"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001466"	"3.70"	""
"26873"	"False"	"High"	"[K].KGDVVIVLTGWRPGSGFTNTMR.[V]"	"1xOxidation [M21]"	"0.000334209"	"0.000721313"	"1"	"2"	"47"	"P52480"	"P52480 [505-526]"	""	"1"	"2407.25507"	"398.096"	"8.318"	"0.822737660380108"	"0.906515362333117"	"56.22"	"54.61"	"0.7"	"293.8"	"5.5"	"47.61"	"34.76"	"51.08"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.019E-05"	"4.08"	"48.56"
"26872"	"False"	"High"	"[K].KGDVVIVLTGWRPGSGFTNTMR.[V]"	""	"0.000344719"	"0.000721313"	"1"	"2"	"31"	"P52480"	"P52480 [505-526]"	""	"1"	"2391.26016"	"424.924"	"40.543"	"0.925138005747468"	"0.0648066660153722"	"85.10"	"91.95"	"0.7"	"275.7"	"23.6"	"86.25"	"51.06"	"33.76"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.104E-05"	"3.76"	"51.06"
"26781"	"False"	"High"	"[K].KFQYQLACR.[S]"	"1xBiotin [K1]; 1xCarbamidomethyl [C8]"	"0.000349015"	"0.000721313"	"1"	"3"	"13"	"Q8BRG8"	"Q8BRG8 [288-296]"	"Q8BRG8 1xBiotin [K288]"	"1"	"1439.69224"	"0.012"	"0.765"	"1.16364095154626E-05"	"0.906515362333117"	"43.40"	"39.75"	"170.2"	"2.2"	"127.7"	"49.70"	"224.18"	"39.49"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.152E-05"	"3.33"	"40.59"
"26762"	"False"	"High"	"[R].KFMNPFNLPNLYQK.[L]"	"1xOxidation [M3]"	"0.000993832"	"0.000721313"	"1"	"1"	"12"	"Q60864"	"Q60864 [123-136]"	""	"1"	"1769.90434"	"157.761"	"3.149"	"0.925138005747468"	"0.906515362333117"	"77.70"	"81.82"	"1.6"	"293.2"	"5.1"	"72.00"	"44.70"	"49.83"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.589E-05"	"3.46"	"50.01"
"26761"	"False"	"High"	"[R].KFMNPFNLPNLYQK.[L]"	""	"0.000506063"	"0.000721313"	"1"	"1"	"9"	"Q60864"	"Q60864 [123-136]"	""	"1"	"1753.90942"	"44.789"	"2.934"	"0.755076974354295"	"0.906515362333117"	"47.50"	"73.34"	"5.9"	"276.0"	"18.1"	"17.43"	"65.40"	"61.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"4.485E-05"	"3.83"	"53.15"
"26738"	"False"	"High"	"[R].KFLDGIYVSEK.[G]"	"1xBiotin [K1]"	"0.000118081"	"0.000721313"	"1"	"1"	"14"	"P51410"	"P51410 [174-184]"	"P51410 1xBiotin [K174]"	"1"	"1524.77668"	"0.063"	"0.813"	"0.00197252368443313"	"0.906515362333117"	"64.45"	"37.03"	"168.3"	"10.0"	"121.7"	"23.89"	"56.09"	"27.40"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.113E-05"	"2.95"	"48.46"
"25222"	"False"	"High"	"[K].HTGPGILSMANAGPNTNGSQFFICTAK.[T]"	"1xCarbamidomethyl [C24]"	"1.06548E-07"	"0.000721313"	"1"	"1"	"13"	"P17742"	"P17742 [92-118]"	""	"0"	"2791.32904"	"92.720"	"12.357"	"0.462987182596949"	"0.906515362333117"	"82.73"	"50.84"	"2.8"	"263.9"	"33.3"	"25.25"	"71.63"	"46.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.323E-08"	"7.59"	"49.91"
"26705"	"False"	"High"	"[R].KFFVGGNWK.[M]"	""	"0.00066868"	"0.000721313"	"1"	"1"	"27"	"P17751"	"P17751 [56-64]"	""	"1"	"1082.57818"	"98.864"	"3.041"	"0.945683295219289"	"0.906515362333117"	"58.65"	"68.00"	"3.0"	"288.1"	"8.9"	"44.72"	"53.01"	"74.37"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.875E-05"	"3.73"	"37.12"
"26615"	"False"	"High"	"[R].KESYSVYVYK.[V]"	"1xBiotin [K1]"	"7.23943E-05"	"0.000721313"	"2"	"9"	"12"	"Q64525; Q6ZWY9"	"Q64525 [35-44]; Q6ZWY9 [35-44]"	"Q64525 1xBiotin [K35]; Q6ZWY9 1xBiotin [K35]"	"1"	"1491.71883"	"0.060"	"1.080"	"0.000146155812048007"	"0.927892136092816"	"73.20"	"70.24"	"130.8"	"8.0"	"161.2"	"54.00"	"46.50"	"49.54"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.937E-06"	"3.80"	"41.05"
"26614"	"False"	"High"	"[R].KESYSVYVYK.[V]"	""	"0.000506063"	"0.000721313"	"2"	"9"	"50"	"Q64525; Q6ZWY9"	"Q64525 [35-44]; Q6ZWY9 [35-44]"	""	"1"	"1265.64123"	"184.862"	"4.913"	"0.925138005747468"	"0.906515362333117"	"42.01"	"38.21"	"1.5"	"290.7"	"7.8"	"34.46"	"32.50"	"22.48"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.484E-05"	"3.82"	"29.65"
"26538"	"False"	"High"	"[R].KENTSNIFYSK.[N]"	"1xBiotin [K1]"	"0.00101875"	"0.000721313"	"1"	"1"	"8"	"Q9QYE6"	"Q9QYE6 [28-38]"	"Q9QYE6 1xBiotin [K28]"	"1"	"1556.74135"	"0.262"	"0.574"	"0.925138005747468"	"0.906515362333117"	"43.45"	"94.62"	"164.4"	"41.6"	"94.0"	"48.38"	"28.73"	"80.36"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"8.79E-05"	"3.17"	"39.29"
"26527"	"False"	"High"	"[K].KENLNEVVSALTAQQVR.[F]"	"1xBiotin [K1]"	"7.74028E-06"	"0.000721313"	"1"	"1"	"8"	"Q99LE3"	"Q99LE3 [178-194]"	"Q99LE3 1xBiotin [K178]"	"1"	"2125.10701"	"0.668"	"0.635"	"0.925138005747468"	"0.906515362333117"	"78.21"	"104.24"	"130.1"	"93.1"	"76.8"	"155.56"	"28.33"	"63.09"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"8.121E-07"	"4.44"	"57.89"
"26399"	"False"	"High"	"[K].KEGICAIGGTSEQSSVGTQHSYSEEEK.[Y]"	"1xBiotin [K1]; 1xCarbamidomethyl [C5]"	"8.28596E-06"	"0.000721313"	"1"	"1"	"3"	"Q61233"	"Q61233 [97-123]"	"Q61233 1xBiotin [K97]"	"1"	"3124.38338"	"0.363"	"0.460"	"0.925138005747468"	"0.906515362333117"	"77.76"	"88.50"	"171.7"	"62.3"	"66.0"	"66.77"	"22.95"	"70.29"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"8.675E-07"	"4.84"	"37.06"
"26385"	"False"	"High"	"[K].KEGAAGFFKGIGK.[G]"	"1xBiotin [K9]"	"0.000640316"	"0.000721313"	"1"	"3"	"3"	"Q8BX70-1"	"Q8BX70-1 [3540-3552]"	"Q8BX70-1 1xBiotin [K3548]"	"2"	"1535.80390"	"0.235"	"0.762"	"0.925138005747468"	"0.906515362333117"	"59.13"	"29.66"	"147.5"	"35.2"	"117.3"	"15.04"	"50.66"	"23.57"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"5.642E-05"	"4.26"	"43.81"
"26340"	"False"	"High"	"[K].KEELLNAMVAKLGNR.[E]"	"1xBiotin [K11]"	"7.70194E-05"	"0.000721313"	"1"	"1"	"13"	"Q9D2V7"	"Q9D2V7 [890-904]"	"Q9D2V7 1xBiotin [K900]"	"2"	"1912.01430"	"0.217"	"2.302"	"0.925138005747468"	"0.916215054610739"	"53.72"	"26.61"	"86.5"	"16.1"	"197.5"	"29.32"	"39.11"	"17.48"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.384E-06"	"4.35"	"57.06"
"26277"	"False"	"High"	"[K].KEDALLYQSK.[D]"	"1xBiotin [K1]"	"0.000115908"	"0.000721313"	"1"	"1"	"76"	"O08579"	"O08579 [80-89]"	"O08579 1xBiotin [K80]"	"1"	"1420.71408"	"0.567"	"0.882"	"0.0212730684969713"	"0.906515362333117"	"42.22"	"24.25"	"114.9"	"78.9"	"106.2"	"26.48"	"36.35"	"29.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.094E-05"	"4.09"	"39.11"
"26231"	"False"	"High"	"[R].KDVYVQLYLQHLTAR.[N]"	"1xBiotin [K1]"	"1.72716E-07"	"0.000721313"	"1"	"6"	"22"	"Q61029"	"Q61029 [34-48]"	"Q61029 1xBiotin [K34]"	"1"	"2073.09499"	"0.031"	"2.019"	"6.49983793219649E-05"	"0.906515362333117"	"51.20"	"54.98"	"95.8"	"2.9"	"201.2"	"50.86"	"39.13"	"34.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.102E-08"	"6.15"	"55.05"
"26141"	"False"	"High"	"[K].KDNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K]"	"8.61019E-05"	"0.000721313"	"1"	"2"	"11"	"Q9CQ56"	"Q9CQ56 [207-225]"	"Q9CQ56 1xBiotin [K]"	"2"	"2426.18025"	"0.145"	"1.104"	"0.0149972581827278"	"0.906515362333117"	"44.56"	"36.24"	"133.7"	"19.1"	"147.1"	"24.45"	"171.68"	"28.46"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.212E-06"	"3.16"	"39.57"
"26100"	"False"	"High"	"[K].KDLLEIDR.[F]"	"1xBiotin [K1]"	"0.00184568"	"0.000721313"	"1"	"1"	"5"	"Q4VBD2"	"Q4VBD2 [548-555]"	"Q4VBD2 1xBiotin [K548]"	"1"	"1227.64018"	"0.080"	"0.827"	"0.00393862992554404"	"0.906515362333117"	"52.13"	"50.83"	"152.7"	"15.7"	"131.6"	"46.72"	"32.67"	"57.19"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001543"	"2.94"	"45.95"
"26057"	"False"	"High"	"[R].KDGSASGTTLLEALDCILPPTRPTDKPLR.[L]"	"1xCarbamidomethyl [C16]"	"0.000334209"	"0.000721313"	"1"	"1"	"14"	"P10126"	"P10126 [219-247]"	""	"1"	"3122.65142"	"7.365"	"9.530"	"0.925138005747468"	"0.906515362333117"	"623.22"	"57.58"	"19.2"	"112.1"	"168.7"	"23.91"	"127.98"	"47.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.022E-05"	"3.74"	"57.30"
"26702"	"False"	"High"	"[R].KFFLSHPAYR.[H]"	""	"0.00010052"	"0.000721313"	"1"	"4"	"26"	"P39054-1"	"P39054-1 [257-266]"	""	"1"	"1265.67895"	"76.700"	"1.750"	"0.993882874540102"	"0.916215054610739"	"70.11"	"64.37"	"3.8"	"289.3"	"6.9"	"60.01"	"41.75"	"25.51"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.56E-06"	"3.38"	"31.09"
"25191"	"False"	"High"	"[K].HTAMVSWGGVSIPNSPFR.[V]"	"1xOxidation [M4]"	"0.000254497"	"0.000721313"	"1"	"1"	"8"	"Q8BTM8"	"Q8BTM8 [743-760]"	""	"0"	"1958.95414"	"159.828"	"2.256"	"0.372007186706233"	"0.906515362333117"	"66.53"	"68.12"	"1.6"	"293.6"	"4.8"	"55.49"	"30.51"	"34.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.327E-05"	"3.27"	"48.69"
"25118"	"False"	"High"	"[K].HSQFIGYPITLYLEK.[E]"	""	"0.000165999"	"0.000721313"	"1"	"1"	"12"	"P11499"	"P11499 [205-219]"	""	"0"	"1808.95815"	"129.078"	"3.236"	"0.423502284931059"	"0.906515362333117"	"55.61"	"62.66"	"2.1"	"291.0"	"6.9"	"50.27"	"48.06"	"39.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"1.548E-05"	"3.65"	"54.26"
"25073"	"False"	"High"	"[R].HSLASTDEKR.[E]"	"1xBiotin [K9]"	"0.000916976"	"0.000721313"	"1"	"1"	"27"	"Q91ZX7"	"Q91ZX7 [4520-4529]"	"Q91ZX7 1xBiotin [K4528]"	"1"	"1369.65287"	"0.190"	"0.826"	"0.00338043135353608"	"0.906515362333117"	"309.96"	"30.46"	"151.4"	"25.3"	"123.3"	"26.70"	"129.87"	"9.91"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.943E-05"	"3.33"	"24.02"
"23729"	"False"	"High"	"[K].GWNFNYLQFPR.[S]"	""	"0.000583522"	"0.000721313"	"1"	"1"	"22"	"Q8R0X7"	"Q8R0X7 [471-481]"	""	"0"	"1441.70114"	"158.417"	"4.145"	"0.925138005747468"	"0.906515362333117"	"43.14"	"20.12"	"1.9"	"290.4"	"7.8"	"11.89"	"33.68"	"19.56"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.14E-05"	"3.59"	"57.49"
"23617"	"False"	"High"	"[R].GVNFLFPIQAK.[T]"	""	"0.00190368"	"0.000721313"	"1"	"1"	"14"	"Q9JIK5"	"Q9JIK5 [277-287]"	""	"0"	"1233.69902"	"173.810"	"3.733"	"0.925138005747468"	"0.906515362333117"	"92.31"	"103.27"	"1.6"	"292.6"	"5.8"	"86.96"	"30.69"	"41.54"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001584"	"2.95"	"54.25"
"23613"	"False"	"High"	"[R].GVMLAVDAVIAELKK.[Q]"	"1xOxidation [M3]"	"0.000551892"	"0.000721313"	"1"	"1"	"13"	"P63038-1"	"P63038-1 [143-157]"	""	"1"	"1572.90294"	"90.694"	"1.605"	"0.430383505746853"	"0.924306229746472"	"59.91"	"56.90"	"3.6"	"290.9"	"5.4"	"35.16"	"55.20"	"88.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"4.881E-05"	"3.05"	"57.84"
"23605"	"False"	"High"	"[K].GVIVHTMAAVQALGVKANVEK.[K]"	"1xBiotin [K16]; 1xOxidation [M7]"	"0.000752161"	"0.000721313"	"1"	"1"	"4"	"Q9CZW4"	"Q9CZW4 [250-270]"	"Q9CZW4 1xBiotin [K265]"	"1"	"2377.27303"	"0.961"	"2.060"	"0.97864233222105"	"0.969054191468458"	"63.13"	"64.92"	"73.8"	"74.1"	"152.1"	"64.00"	"23.02"	"43.06"	""	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"6.58E-05"	"4.00"	"46.93"
"23604"	"False"	"High"	"[K].GVIVHTMAAVQALGVKANVEK.[K]"	"1xBiotin [K]"	"8.03331E-06"	"0.000721313"	"1"	"1"	"18"	"Q9CZW4"	"Q9CZW4 [250-270]"	"Q9CZW4 1xBiotin [K]"	"1"	"2361.27812"	"0.166"	"2.230"	"0.925138005747468"	"0.935866453494337"	"75.52"	"79.05"	"99.7"	"17.9"	"182.4"	"49.42"	"47.25"	"57.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.422E-07"	"5.69"	"54.47"
"23584"	"False"	"High"	"[R].GVLLMLFGGVPK.[T]"	""	"5.93796E-05"	"0.000721313"	"1"	"1"	"11"	"P97311"	"P97311 [367-378]"	""	"0"	"1230.72788"	"59.952"	"6.218"	"0.510895597510438"	"0.906515362333117"	"79.74"	"64.42"	"4.2"	"269.0"	"26.8"	"58.21"	"53.58"	"21.91"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.765E-06"	"3.26"	"62.58"
"23445"	"False"	"High"	"[R].GTVMYVGLTDFKPGYWVGVR.[Y]"	"1xOxidation [M4]"	"0.000840839"	"0.000721313"	"1"	"1"	"2"	"Q9D1E6"	"Q9D1E6 [177-196]"	""	"0"	"2261.14234"	"7.034"	"0.628"	"0.925138005747468"	""	"328.34"	"50.40"	"39.8"	"238.5"	"21.7"	"24.76"	"139.96"	"43.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"7.315E-05"	"4.31"	"54.95"
"23441"	"False"	"High"	"[K].GTVLIKTAEELMNFSK.[G]"	"1xBiotin [K6]"	"3.50769E-05"	"0.000721313"	"1"	"1"	"14"	"P42932"	"P42932 [255-270]"	"P42932 1xBiotin [K260]"	"1"	"2007.02895"	"0.412"	"3.958"	"0.931513090357645"	"0.906515362333117"	"96.39"	"103.01"	"65.1"	"23.6"	"211.3"	"74.54"	"36.10"	"96.62"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.478E-06"	"4.37"	"64.94"
"23387"	"False"	"High"	"[R].GTQLGDKLDSFIK.[A]"	"1xBiotin [K7]"	"0.000176604"	"0.000721313"	"1"	"1"	"13"	"P49070"	"P49070 [105-117]"	"P49070 1xBiotin [K111]"	"1"	"1647.84107"	"14.029"	"0.698"	"0.925138005747468"	"0.906515362333117"	"87.97"	"55.44"	"21.8"	"264.3"	"13.9"	"39.71"	"75.30"	"51.90"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.64E-05"	"3.19"	"58.11"
"23365"	"False"	"High"	"[K].GTPFETPDQGKAR.[L]"	"1xBiotin [K11]"	"0.00055532"	"0.000721313"	"1"	"3"	"24"	"Q9CPZ6"	"Q9CPZ6 [69-81]"	"Q9CPZ6 1xBiotin [K79]"	"1"	"1629.76897"	"0.011"	"0.828"	"9.58177570709534E-06"	"0.906515362333117"	"52.65"	"27.01"	"161.3"	"2.0"	"136.8"	"19.86"	"43.14"	"17.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.901E-05"	"3.58"	"36.77"
"23354"	"False"	"High"	"[K].GTLVQTKGTGASGSFK.[L]"	"1xBiotin [K7]"	"0.000590793"	"0.000721313"	"2"	"3"	"12"	"P43276; P43277"	"P43276 [91-106]; P43277 [92-107]"	"P43276 1xBiotin [K97]; P43277 1xBiotin [K98]"	"1"	"1764.89489"	"0.097"	"0.784"	"0.571651314852435"	"0.906515362333117"	"61.33"	"61.02"	"160.7"	"12.8"	"126.5"	"35.29"	"52.31"	"64.25"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.204E-05"	"3.68"	"38.55"
"23332"	"False"	"High"	"[K].GTLGGLFSQILQGEDIVR.[E]"	""	"0.000119553"	"0.000721313"	"1"	"1"	"5"	"O35841"	"O35841 [131-148]"	""	"0"	"1903.02835"	"0.964"	"1.341"	"0.925138005747468"	"0.906515362333117"	"84.99"	"61.36"	"100.4"	"91.4"	"108.2"	"43.62"	"175.88"	"36.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"1.129E-05"	"3.23"	"65.43"
"23754"	"False"	"High"	"[K].GYADIVQLLLAK.[G]"	""	"0.000889024"	"0.000721313"	"1"	"1"	"12"	"Q62422"	"Q62422 [151-162]"	""	"0"	"1303.76201"	"103.312"	"6.840"	"0.925138005747468"	"0.906515362333117"	"72.08"	"75.69"	"2.4"	"280.5"	"17.1"	"74.18"	"62.75"	"44.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.699E-05"	"2.80"	"64.04"
"23276"	"False"	"High"	"[K].GTGASGSFKLNK.[K]"	"1xBiotin [K9]"	"0.00188027"	"0.000721313"	"3"	"4"	"8"	"P43276; P15864; P43277"	"P43276 [98-109]; P15864 [98-109]; P43277 [99-110]"	"P43276 1xBiotin [K106]; P15864 1xBiotin [K106]; P43277 1xBiotin [K107]"	"1"	"1392.69401"	"0.178"	"0.605"	"0.925138005747468"	"0.906515362333117"	"72.47"	"103.07"	"161.5"	"26.1"	"112.4"	"61.37"	"45.68"	"125.53"	"NotUnique"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001571"	"2.95"	"35.70"
"23210"	"False"	"High"	"[K].GSYVSIHSSGFR.[D]"	""	"0.000648295"	"0.000721313"	"2"	"2"	"17"	"Q9Z1N5; Q8VDW0-1"	"Q9Z1N5 [37-48]; Q8VDW0-1 [36-47]"	""	"0"	"1296.63312"	"133.412"	"4.405"	"0.925138005747468"	"0.906515362333117"	"43.67"	"50.01"	"2.1"	"287.2"	"10.7"	"44.71"	"44.52"	"29.25"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.689E-05"	"2.82"	"29.98"
"23143"	"False"	"High"	"[K].GSSQLDVNEEVEALIVKSPHK.[D]"	"1xBiotin [K17]"	"0.000509206"	"0.000721313"	"1"	"1"	"6"	"O35379"	"O35379 [288-308]"	"O35379 1xBiotin [K304]"	"1"	"2505.26536"	"0.180"	"1.354"	"0.925138005747468"	"0.916215054610739"	"59.37"	"63.49"	"98.2"	"24.5"	"177.2"	"50.65"	"42.69"	"50.01"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"4.518E-05"	"4.34"	"56.05"
"23096"	"False"	"High"	"[K].GSQDKEAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K21]; 1xOxidation [M16]"	"0.00056224"	"0.000721313"	"1"	"1"	"5"	"Q61009"	"Q61009 [480-508]"	"Q61009 1xBiotin [K500]"	"2"	"3279.58717"	"1.059"	"0.918"	"0.989440770281069"	"0.906515362333117"	"100.73"	"87.35"	"102.9"	"104.3"	"92.8"	"133.08"	"27.01"	"23.62"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"4.978E-05"	"4.35"	"48.13"
"23095"	"False"	"High"	"[K].GSQDKEAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K21]"	"3.03826E-06"	"0.000721313"	"1"	"1"	"5"	"Q61009"	"Q61009 [480-508]"	"Q61009 1xBiotin [K500]"	"2"	"3263.59225"	"0.979"	"3.183"	""	"0.906515362333117"	"33.44"	"77.23"	"55.1"	"57.2"	"187.6"	"26.72"	"11.23"	"54.89"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"3.308E-07"	"5.88"	"52.91"
"23057"	"False"	"High"	"[R].GSPECVGLTETKSMIFSPASR.[V]"	"1xBiotin [K12]; 1xCarbamidomethyl [C5]"	"0.000506063"	"0.000721313"	"1"	"1"	"16"	"P83093"	"P83093 [649-669]"	"P83093 1xBiotin [K660]"	"1"	"2480.16183"	"0.110"	"1.065"	"0.427089858136149"	"0.906515362333117"	"73.11"	"66.06"	"138.9"	"13.2"	"147.9"	"56.59"	"51.82"	"41.00"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.486E-05"	"3.73"	"57.88"
"23001"	"False"	"High"	"[R].GSIGFLYLNIGLQNGVLLR.[T]"	""	"0.000332146"	"0.000721313"	"1"	"2"	"6"	"Q921M3-1"	"Q921M3-1 [658-676]"	""	"0"	"2047.16987"	"2.182"	"2.185"	"0.949662611758987"	"0.906515362333117"	"71.48"	"55.25"	"56.5"	"119.1"	"124.4"	"36.68"	"204.97"	"41.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"3.011E-05"	"2.67"	"65.44"
"22998"	"False"	"High"	"[K].GSIFAVFDSIQSAK.[K]"	""	"0.00163078"	"0.000721313"	"1"	"1"	"8"	"P32067"	"P32067 [152-165]"	""	"0"	"1469.76347"	"43.054"	"2.730"	"0.647472045214019"	"0.916215054610739"	"144.59"	"105.30"	"6.4"	"277.1"	"16.5"	"43.53"	"93.44"	"90.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"0.000137"	"3.42"	"59.10"
"22978"	"False"	"High"	"[R].GSKLVTLEAK.[S]"	"1xBiotin [K3]"	"0.00111789"	"0.000721313"	"1"	"2"	"13"	"Q920B0"	"Q920B0 [388-397]"	"Q920B0 1xBiotin [K390]"	"1"	"1271.70278"	"0.039"	"0.883"	"0.000134036379313673"	"0.906515362333117"	"40.61"	"27.46"	"153.9"	"5.9"	"140.1"	"17.91"	"37.37"	"20.19"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.571E-05"	"3.10"	"41.64"
"22970"	"False"	"High"	"[R].GSKGGHGAASPSDK.[G]"	"1xBiotin [K3]"	"0.000594462"	"0.000721313"	"1"	"1"	"15"	"Q8BMK4"	"Q8BMK4 [8-21]"	"Q8BMK4 1xBiotin [K10]"	"1"	"1481.68015"	"0.098"	"0.952"	"0.00448250096392046"	"0.906515362333117"	"61.93"	"46.34"	"155.2"	"15.8"	"129.1"	"42.69"	"43.72"	"30.59"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.234E-05"	"3.87"	"16.48"
"22711"	"False"	"High"	"[R].GREESAAPTVQKSLSSLR.[L]"	"1xBiotin [K12]"	"1.73144E-05"	"0.000721313"	"1"	"2"	"5"	"Q8BFW3-1"	"Q8BFW3-1 [105-122]"	"Q8BFW3-1 1xBiotin [K116]"	"2"	"2142.09718"	"0.092"	"0.730"	"0.0100095092696787"	"0.906515362333117"	"46.13"	"28.30"	"162.7"	"14.9"	"122.4"	"60.35"	"39.67"	"37.60"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"1.759E-06"	"4.82"	"40.84"
"22681"	"False"	"High"	"[R].GQWINLPVLHLTKDPLKAPGR.[L]"	"1xBiotin [K13]"	"9.97771E-06"	"0.000721313"	"1"	"1"	"30"	"P58742"	"P58742 [40-60]"	"P58742 1xBiotin [K52]"	"2"	"2579.42789"	"0.203"	"31.865"	"0.925138005747468"	"0.132828431719327"	"65.46"	"47.89"	"8.7"	"1.6"	"289.6"	"37.29"	"60.35"	"31.17"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.037E-06"	"4.08"	"58.66"
"22680"	"False"	"High"	"[R].GQWINLPVLHLTKDPLK.[A]"	"1xBiotin [K]"	"5.37779E-05"	"0.000721313"	"1"	"1"	"46"	"P58742"	"P58742 [40-56]"	"P58742 1xBiotin [K]"	"1"	"2198.21544"	"0.059"	"17.785"	"9.56190873519663E-05"	"0.625665755000974"	"43.40"	"57.55"	"16.6"	"1.0"	"282.4"	"24.48"	"220.29"	"49.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.217E-06"	"4.67"	"61.05"
"23246"	"False"	"High"	"[K].GTEASTKNIFGR.[Y]"	"1xBiotin [K7]"	"0.000605609"	"0.000721313"	"1"	"1"	"19"	"Q99LM2"	"Q99LM2 [77-88]"	"Q99LM2 1xBiotin [K83]"	"1"	"1506.73694"	"0.039"	"0.929"	"0.000137748542218594"	"0.906515362333117"	"69.16"	"46.73"	"145.6"	"8.0"	"146.5"	"43.00"	"49.69"	"30.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.327E-05"	"3.65"	"42.29"
"27162"	"False"	"High"	"[R].KGSITEYTATEEK.[G]"	"1xBiotin [K1]"	"1.50157E-05"	"0.000721313"	"1"	"1"	"12"	"O54940"	"O54940 [112-124]"	"O54940 1xBiotin [K112]"	"1"	"1682.79418"	"0.112"	"0.865"	"0.00471126058208943"	"0.906515362333117"	"71.51"	"90.78"	"148.5"	"19.5"	"132.0"	"55.75"	"39.34"	"72.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.535E-06"	"4.42"	"36.19"
"23788"	"False"	"High"	"[K].GYFVQDTSFDFFNYAGLHR.[S]"	""	"0.000265772"	"0.000721313"	"1"	"1"	"4"	"P12265"	"P12265 [197-215]"	""	"0"	"2284.04579"	"8.890"	"1.176"	"0.973358748574628"	"0.906515362333117"	"235.60"	"61.01"	"39.1"	"223.0"	"37.9"	"37.72"	"113.62"	"38.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"2.432E-05"	"4.75"	"59.60"
"23821"	"False"	"High"	"[K].GYLFWTEWGHYPR.[I]"	""	"0.000922671"	"0.000721313"	"1"	"1"	"5"	"Q91ZX7"	"Q91ZX7 [2021-2033]"	""	"0"	"1711.80159"	"34.287"	"1.975"	"0.786556628498804"	"0.936238272383155"	"145.59"	"76.08"	"8.1"	"278.9"	"13.0"	"42.17"	"129.42"	"55.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"7.965E-05"	"3.04"	"56.16"
"24994"	"False"	"High"	"[K].HRPLNLGPFVVR.[A]"	""	"0.000987698"	"0.000721313"	"1"	"1"	"6"	"Q99N96"	"Q99N96 [286-297]"	""	"0"	"1404.82226"	"267.790"	"2.875"	"0.925138005747468"	"0.906777072223237"	"61.14"	"60.65"	"1.3"	"295.3"	"3.5"	"37.64"	"49.01"	"54.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"8.54E-05"	"2.95"	"40.84"
"24943"	"False"	"High"	"[K].HQSLGGQYGVQGFPTIK.[I]"	""	"0.00101246"	"0.000721313"	"1"	"1"	"2"	"Q922R8"	"Q922R8 [86-102]"	""	"0"	"1816.93406"	"294.760"	"6.535"	"0.925138005747468"	"0.906515362333117"	"36.63"	"42.54"	"1.1"	"291.3"	"7.6"	"52.59"	"36.31"	"21.62"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"8.736E-05"	"3.64"	"40.71"
"24901"	"False"	"High"	"[R].HQGVMVGMGQK.[D]"	""	"0.000259269"	"0.000721313"	"1"	"7"	"5"	"P60710"	"P60710 [40-50]"	""	"0"	"1171.57106"	"2.012"	"4.968"	"0.925138005747468"	"0.906515362333117"	"91.69"	"66.94"	"45.2"	"62.6"	"192.2"	"47.86"	"141.97"	"58.04"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"2.367E-05"	"2.95"	"21.46"
"24867"	"False"	"High"	"[K].HPSSFEGKGPHSYVK.[N]"	"1xBiotin [K8]"	"5.14331E-06"	"0.000721313"	"1"	"1"	"21"	"O88822"	"O88822 [256-270]"	"O88822 1xBiotin [K263]"	"1"	"1882.89048"	"0.024"	"0.918"	"4.08102682277022E-05"	"0.906515362333117"	"79.99"	"75.74"	"171.1"	"4.3"	"124.6"	"58.03"	"20.80"	"71.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.499E-07"	"4.40"	"31.48"
"24798"	"False"	"High"	"[R].HNYYFINYR.[T]"	""	"0.0013544"	"0.000721313"	"1"	"1"	"23"	"Q9D0D5"	"Q9D0D5 [89-97]"	""	"0"	"1289.60618"	"142.647"	"3.354"	"0.925138005747468"	"0.906515362333117"	"75.33"	"77.98"	"1.9"	"291.5"	"6.6"	"62.25"	"38.78"	"47.82"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001153"	"2.78"	"38.26"
"24755"	"False"	"High"	"[K].HNELTGDNVGPLILKK.[K]"	"1xBiotin [K]"	"1.78368E-06"	"0.000721313"	"1"	"1"	"103"	"Q9CQB5"	"Q9CQB5 [117-132]"	"Q9CQB5 1xBiotin [K]"	"1"	"1974.04771"	"1.253"	"1.062"	"0.0816832246389883"	"0.923750342545975"	"33.81"	"44.78"	"88.6"	"110.5"	"101.0"	"32.54"	"12.94"	"39.96"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.98E-07"	"5.32"	"46.95"
"24734"	"False"	"High"	"[R].HMYHSLYLK.[V]"	""	"0.00132127"	"0.000721313"	"1"	"1"	"22"	"P84099"	"P84099 [118-126]"	""	"0"	"1191.59793"	"28.062"	"3.709"	"0.925138005747468"	"0.906515362333117"	"85.33"	"72.30"	"7.8"	"260.4"	"31.8"	"51.82"	"80.88"	"45.93"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001123"	"3.30"	"27.15"
"24708"	"False"	"High"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K]; 3xOxidation [M2; M6; M13]"	"0.000141312"	"0.000721313"	"1"	"1"	"8"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K]"	"1"	"2116.88064"	"0.386"	"1.034"	"0.925138005747468"	"0.927892136092816"	"93.75"	"97.93"	"105.2"	"79.7"	"115.1"	"79.29"	"55.16"	"40.09"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.325E-05"	"4.52"	"35.27"
"24707"	"False"	"High"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K]; 2xOxidation [M6; M]"	"0.00142316"	"0.000721313"	"1"	"1"	"13"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K]"	"1"	"2100.88573"	"0.180"	"0.961"	"0.00981529860488958"	"0.906515362333117"	"123.52"	"114.28"	"144.5"	"26.0"	"129.5"	"86.17"	"48.20"	"69.54"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001203"	"3.68"	"38.94"
"24706"	"False"	"High"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K12]; 1xOxidation [M]"	"2.54192E-05"	"0.000721313"	"1"	"1"	"17"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K228]"	"1"	"2084.89081"	"0.119"	"0.976"	"0.00851731170301682"	"0.906515362333117"	"62.88"	"49.44"	"146.3"	"17.2"	"136.5"	"40.80"	"223.95"	"40.48"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.548E-06"	"6.04"	"41.98"
"24705"	"False"	"High"	"[K].HMNSAMEDSSSKMFLK.[V]"	"1xBiotin [K12]"	"0.000878083"	"0.000721313"	"1"	"1"	"2"	"Q61168"	"Q61168 [217-232]"	"Q61168 1xBiotin [K228]"	"1"	"2068.89590"	"0.833"	"0.680"	"0.994201151226993"	"0.906515362333117"	"42.69"	"61.26"	"126.4"	"90.8"	"82.8"	"54.38"	"21.98"	"118.98"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"7.633E-05"	"3.57"	"43.60"
"24666"	"False"	"High"	"[K].HMANQLLAKFEENTR.[N]"	"1xBiotin [K9]"	"0.000355559"	"0.000721313"	"1"	"3"	"3"	"Q8BML1"	"Q8BML1 [715-729]"	"Q8BML1 1xBiotin [K723]"	"1"	"2027.97898"	"0.941"	"1.180"	"0.925138005747468"	"0.919063063983313"	"43.50"	"75.36"	"96.9"	"85.0"	"118.1"	"36.26"	"37.64"	"55.51"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.213E-05"	"3.80"	"54.33"
"23796"	"False"	"High"	"[K].GYGFVSFYNK.[L]"	""	"0.00201273"	"0.000721313"	"1"	"1"	"20"	"P70318"	"P70318 [156-165]"	""	"0"	"1181.56259"	"108.537"	"2.829"	"0.929320212853233"	"0.906515362333117"	"56.41"	"57.91"	"3.1"	"289.8"	"7.0"	"38.42"	"35.75"	"43.42"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001669"	"3.02"	"45.22"
"24662"	"False"	"High"	"[K].HIYFITGETK.[D]"	""	"0.00129696"	"0.000721313"	"1"	"1"	"2"	"P07901"	"P07901 [491-500]"	""	"0"	"1208.63100"	"122.517"	"2.263"	"0.463973682624453"	"0.956043974317412"	"40.72"	"76.18"	"2.3"	"292.4"	"5.3"	"19.50"	"57.73"	"78.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001103"	"2.83"	"33.75"
"24453"	"False"	"High"	"[R].HIADLAGNPEVILPVPAFNVINGGSHAGNK.[L]"	""	"6.75438E-06"	"0.000721313"	"1"	"1"	"20"	"P17182"	"P17182 [133-162]"	""	"0"	"3021.59048"	"392.119"	"14.786"	"0.925138005747468"	"0.906515362333117"	"57.56"	"65.98"	"0.9"	"286.5"	"12.6"	"41.63"	"37.05"	"45.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"7.144E-07"	"5.53"	"55.08"
"24438"	"False"	"High"	"[K].HKSSLNSSPWSGLMALGNSR.[H]"	"1xBiotin [K2]; 1xOxidation [M14]"	"1.63353E-07"	"0.000721313"	"1"	"1"	"18"	"Q3TDQ1"	"Q3TDQ1 [11-30]"	"Q3TDQ1 1xBiotin [K12]"	"1"	"2371.12816"	"0.073"	"1.225"	"0.000556964699394451"	"0.969054191468458"	"35.04"	"34.56"	"131.2"	"8.9"	"159.9"	"30.82"	"18.32"	"18.11"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.995E-08"	"6.10"	"48.54"
"24437"	"False"	"High"	"[K].HKSSLNSSPWSGLMALGNSR.[H]"	"1xBiotin [K2]"	"6.41995E-07"	"0.000721313"	"1"	"1"	"15"	"Q3TDQ1"	"Q3TDQ1 [11-30]"	"Q3TDQ1 1xBiotin [K12]"	"1"	"2355.13324"	"0.050"	"2.462"	"0.00219106241957464"	"0.906515362333117"	"45.80"	"63.75"	"89.9"	"4.3"	"205.8"	"29.92"	"43.57"	"61.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.442E-08"	"6.13"	"53.75"
"24326"	"False"	"High"	"[R].HGSLGFLPR.[K]"	""	"0.00114592"	"0.000721313"	"1"	"1"	"27"	"P27659"	"P27659 [11-19]"	""	"0"	"983.54213"	"124.594"	"4.299"	"0.925138005747468"	"0.906515362333117"	"56.64"	"66.19"	"3.1"	"287.2"	"9.8"	"45.22"	"35.47"	"62.04"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.793E-05"	"3.27"	"34.66"
"24247"	"False"	"High"	"[R].HFYWYLTNEGIQYLR.[D]"	""	"7.42101E-05"	"0.000721313"	"1"	"1"	"10"	"P63325"	"P63325 [66-80]"	""	"0"	"2002.98101"	"116.612"	"5.411"	"0.332752787163207"	"0.906515362333117"	"56.81"	"74.74"	"2.6"	"283.5"	"13.9"	"22.41"	"48.45"	"76.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"7.112E-06"	"3.90"	"55.64"
"24223"	"False"	"High"	"[K].HFPSVNWLISYSK.[Y]"	""	"0.000464039"	"0.000721313"	"1"	"2"	"16"	"P50516-1"	"P50516-1 [444-456]"	""	"0"	"1577.81109"	"181.867"	"6.702"	"0.382153176583616"	"0.906515362333117"	"49.61"	"74.92"	"1.5"	"287.1"	"11.4"	"31.19"	"34.53"	"55.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.135E-05"	"3.69"	"52.73"
"23994"	"False"	"High"	"[K].HAVSEGTKAVTK.[Y]"	"1xBiotin [K8]"	"0.000351183"	"0.000721313"	"2"	"13"	"26"	"Q64525; Q6ZWY9"	"Q64525 [110-121]; Q6ZWY9 [110-121]"	"Q64525 1xBiotin [K117]; Q6ZWY9 1xBiotin [K117]"	"1"	"1453.74677"	"0.057"	"0.893"	"0.0032109022594614"	"0.906515362333117"	"63.52"	"33.99"	"145.5"	"12.7"	"141.8"	"45.75"	"41.91"	"16.37"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.172E-05"	"3.90"	"23.55"
"23982"	"False"	"High"	"[K].HASQKDYSHGFGGR.[Y]"	"1xBiotin [K5]"	"0.000256078"	"0.000721313"	"1"	"1"	"8"	"P49710"	"P49710 [147-160]"	"P49710 1xBiotin [K151]"	"1"	"1772.79216"	"0.147"	"0.910"	"0.00676648558264721"	"0.906515362333117"	"29.75"	"22.18"	"147.8"	"21.7"	"130.6"	"14.30"	"25.30"	"18.48"	""	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.34E-05"	"3.59"	"29.61"
"23887"	"False"	"High"	"[R].GYSFSLTTFSPSGK.[L]"	""	"0.000113072"	"0.000721313"	"1"	"1"	"29"	"P49722"	"P49722 [5-18]"	""	"0"	"1478.71619"	"199.011"	"5.307"	"0.925138005747468"	"0.906515362333117"	"58.48"	"58.90"	"1.6"	"290.5"	"7.9"	"43.89"	"31.65"	"29.24"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.069E-05"	"3.71"	"49.40"
"23846"	"False"	"High"	"[R].GYMTQFPSFPSWLGK.[H]"	"1xOxidation [M3]"	"0.000357768"	"0.000721313"	"1"	"2"	"10"	"P35601-1"	"P35601-1 [935-949]"	""	"0"	"1761.83050"	"155.487"	"3.781"	"0.417631522857492"	"0.906515362333117"	"63.12"	"102.04"	"1.7"	"292.3"	"6.0"	"36.51"	"53.10"	"82.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"3.221E-05"	"3.76"	"58.02"
"23845"	"False"	"High"	"[R].GYMTQFPSFPSWLGK.[H]"	""	"0.00210184"	"0.000721313"	"1"	"2"	"8"	"P35601-1"	"P35601-1 [935-949]"	""	"0"	"1745.83559"	"1.464"	"2.854"	"0.925138005747468"	"0.91398852688127"	"99.54"	"51.00"	"59.9"	"87.7"	"152.4"	"37.81"	"157.49"	"42.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001743"	"3.13"	"60.77"
"23829"	"False"	"High"	"[R].GYISPYFINTSK.[G]"	""	"0.00140565"	"0.000721313"	"1"	"1"	"20"	"P63038-1"	"P63038-1 [222-233]"	""	"0"	"1389.70489"	"103.557"	"2.646"	"0.944967096116098"	"0.915242122105656"	"52.06"	"68.16"	"2.7"	"289.4"	"7.9"	"79.96"	"33.65"	"61.67"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001191"	"3.24"	"44.14"
"24479"	"False"	"High"	"[K].HLDEYASIASSSKGGR.[I]"	"1xBiotin [K13]"	"0.000157"	"0.000721313"	"1"	"2"	"6"	"Q8BYI6-1"	"Q8BYI6-1 [363-378]"	"Q8BYI6-1 1xBiotin [K375]"	"1"	"1903.89669"	"0.245"	"0.516"	"0.925138005747468"	"0.906515362333117"	"71.07"	"96.67"	"164.9"	"44.3"	"90.8"	"59.83"	"49.93"	"77.82"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.461E-05"	"3.60"	"37.09"
"27184"	"False"	"High"	"[R].KGTDVNVFTTILTSR.[S]"	"1xBiotin [K1]"	"1.00896E-06"	"0.000721313"	"1"	"1"	"27"	"P10107"	"P10107 [214-228]"	"P10107 1xBiotin [K214]"	"1"	"1877.97896"	"0.058"	"0.853"	"0.00294959150271344"	"0.906515362333117"	"42.42"	"46.79"	"155.3"	"9.2"	"135.5"	"23.43"	"41.31"	"38.60"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.148E-07"	"5.39"	"59.51"
"27188"	"False"	"High"	"[R].KGTKPPSPYATITVGETSHK.[T]"	"1xBiotin [K]"	"2.68431E-06"	"0.000721313"	"1"	"2"	"31"	"Q3U7R1"	"Q3U7R1 [801-820]"	"Q3U7R1 1xBiotin [K]"	"1"	"2325.19074"	"0.022"	"0.822"	"3.61097378948738E-05"	"0.906515362333117"	"27.45"	"25.86"	"168.3"	"3.3"	"128.4"	"19.97"	"17.93"	"17.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.94E-07"	"5.73"	"34.94"
"27208"	"False"	"High"	"[K].KGVPIIFADELDDSKPPPSSSMPLILQEEK.[A]"	"1xBiotin [K1]"	"7.84637E-05"	"0.000721313"	"1"	"1"	"18"	"Q62165"	"Q62165 [792-821]"	"Q62165 1xBiotin [K792]"	"1"	"3506.77972"	"0.812"	"22.233"	"0.982626859977453"	"0.360748518686307"	"93.34"	"89.75"	"12.0"	"10.7"	"277.3"	"75.14"	"33.90"	"19.62"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.51E-06"	"4.79"	"60.46"
"32408"	"False"	"High"	"[R].IFDDVSSGVSQLASKVQGVGSK.[G]"	"1xBiotin [K15]"	"1.13495E-06"	"0.000721313"	"1"	"1"	"31"	"Q9EPJ9"	"Q9EPJ9 [264-285]"	"Q9EPJ9 1xBiotin [K278]"	"1"	"2434.22825"	"4.096"	"1.708"	"0.452844787848141"	"0.919235111389825"	"39.44"	"51.25"	"44.8"	"178.8"	"76.5"	"24.81"	"27.92"	"58.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.282E-07"	"5.87"	"59.65"
"32397"	"False"	"High"	"[K].LFCEDKSSHLVFINSR.[E]"	"1xBiotin [K6]; 1xCarbamidomethyl [C3]"	"0.00101875"	"0.000721313"	"1"	"1"	"2"	"Q8K4Q8"	"Q8K4Q8 [633-648]"	"Q8K4Q8 1xBiotin [K638]"	"1"	"2178.04706"	"0.341"	"0.563"	"0.925138005747468"	"0.906515362333117"	"60.59"	"76.39"	"168.5"	"54.7"	"76.8"	"41.53"	"42.51"	"60.08"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"8.788E-05"	"2.92"	"48.73"
"32295"	"False"	"High"	"[R].LESLSTKLCSR.[A]"	"1xBiotin [K7]; 1xCarbamidomethyl [C9]"	"0.0002625"	"0.000721313"	"1"	"1"	"21"	"P43883"	"P43883 [218-228]"	"P43883 1xBiotin [K224]"	"1"	"1519.76071"	"0.073"	"0.877"	"0.000196954901565931"	"0.906515362333117"	"47.46"	"40.96"	"148.4"	"11.9"	"139.7"	"35.35"	"33.14"	"25.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.4E-05"	"3.63"	"46.38"
"32184"	"False"	"High"	"[K].LENKMEGIGLK.[K]"	"1xBiotin [K4]; 1xOxidation [M5]"	"0.000334209"	"0.000721313"	"1"	"1"	"15"	"Q8R5J9"	"Q8R5J9 [148-158]"	"Q8R5J9 1xBiotin [K151]"	"1"	"1473.74400"	"0.121"	"0.976"	"0.925138005747468"	"0.906515362333117"	"61.50"	"22.89"	"144.6"	"17.3"	"138.1"	"15.27"	"51.60"	"26.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.026E-05"	"3.05"	"38.33"
"32183"	"False"	"High"	"[K].LENKMEGIGLK.[K]"	"1xBiotin [K4]"	"0.000149412"	"0.000721313"	"1"	"1"	"17"	"Q8R5J9"	"Q8R5J9 [148-158]"	"Q8R5J9 1xBiotin [K151]"	"1"	"1457.74908"	"0.087"	"0.775"	"0.00261741329068786"	"0.906515362333117"	"52.80"	"16.77"	"163.5"	"12.3"	"124.1"	"15.18"	"41.42"	"13.93"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.393E-05"	"3.77"	"46.36"
"32182"	"False"	"High"	"[K].IENKIESIGLK.[R]"	"1xBiotin [K4]"	"0.000187887"	"0.000721313"	"1"	"1"	"11"	"Q9JIG8"	"Q9JIG8 [149-159]"	"Q9JIG8 1xBiotin [K152]"	"1"	"1469.80323"	"0.265"	"1.014"	"0.925138005747468"	"0.919235111389825"	"82.06"	"53.05"	"135.6"	"28.6"	"135.8"	"53.37"	"52.48"	"23.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.743E-05"	"3.74"	"48.33"
"32098"	"False"	"High"	"[K].LEKSIQANLTPNENCLK.[Q]"	"1xBiotin [K3]; 1xCarbamidomethyl [C15]"	"0.00103144"	"0.000721313"	"1"	"2"	"12"	"E9Q9A9-1"	"E9Q9A9-1 [37-53]"	"E9Q9A9-1 1xBiotin [K39]"	"1"	"2198.09440"	"0.247"	"0.675"	"0.69920017797184"	"0.906515362333117"	"94.83"	"94.17"	"162.0"	"42.3"	"95.7"	"75.46"	"49.96"	"50.38"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"8.884E-05"	"3.71"	"44.57"
"32089"	"False"	"High"	"[R].IEKNILSSADYVER.[G]"	"1xBiotin [K3]"	"0.00017122"	"0.000721313"	"1"	"1"	"12"	"P70452"	"P70452 [241-254]"	"P70452 1xBiotin [K243]"	"1"	"1862.93167"	"0.358"	"0.687"	"0.925138005747468"	"0.906515362333117"	"46.64"	"77.09"	"137.7"	"49.1"	"113.2"	"48.34"	"27.60"	"57.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.594E-05"	"3.33"	"48.44"
"32031"	"False"	"High"	"[R].LEGLSKQLDWDVR.[S]"	"1xBiotin [K6]"	"8.24491E-05"	"0.000721313"	"1"	"1"	"8"	"Q8C172"	"Q8C172 [99-111]"	"Q8C172 1xBiotin [K104]"	"1"	"1784.89998"	"0.253"	"0.640"	"0.925138005747468"	"0.906515362333117"	"51.33"	"106.26"	"167.4"	"41.1"	"91.5"	"30.22"	"40.98"	"76.32"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"7.875E-06"	"2.99"	"53.20"
"31931"	"False"	"High"	"[K].LEEDMLCLLYGKNR.[G]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]"	"1.20895E-05"	"0.000721313"	"1"	"2"	"26"	"Q3TNL8-1"	"Q3TNL8-1 [261-274]"	"Q3TNL8-1 1xBiotin [K272]"	"1"	"1979.93875"	"0.085"	"0.903"	"0.00222527782024733"	"0.906515362333117"	"31.77"	"43.76"	"147.9"	"13.0"	"139.1"	"31.00"	"33.84"	"31.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.244E-06"	"4.60"	"59.10"
"31896"	"False"	"High"	"[K].LEDKSASPGLPK.[G]"	"1xBiotin [K4]"	"0.000198656"	"0.000721313"	"1"	"2"	"14"	"Q9EQU5"	"Q9EQU5 [24-35]"	"Q9EQU5 1xBiotin [K27]"	"1"	"1467.75119"	"0.100"	"0.932"	"0.0184269738406528"	"0.906515362333117"	"59.06"	"62.91"	"144.7"	"16.4"	"138.9"	"72.02"	"33.89"	"57.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.83E-05"	"3.22"	"36.17"
"31660"	"False"	"High"	"[R].IDISFLLDVSSLSR.[A]"	""	"0.000729232"	"0.000721313"	"1"	"1"	"5"	"Q00651"	"Q00651 [731-744]"	""	"0"	"1564.85810"	"1.335"	"1.117"	"0.925138005747468"	"0.906515362333117"	"90.98"	"82.75"	"77.1"	"110.7"	"112.2"	"67.37"	"189.66"	"52.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"6.39E-05"	"3.76"	"65.17"
"32462"	"False"	"High"	"[K].LFGYQPTIYYPK.[R]"	""	"0.000291642"	"0.000721313"	"1"	"1"	"19"	"Q8K4Z3"	"Q8K4Z3 [127-138]"	""	"0"	"1489.77258"	"147.696"	"3.633"	"0.925138005747468"	"0.906515362333117"	"51.00"	"60.83"	"2.1"	"289.9"	"8.0"	"70.60"	"14.41"	"20.30"	"MandatoryModificationMissing"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.658E-05"	"3.10"	"49.45"
"31607"	"False"	"High"	"[K].LDKSQIHDIVLVGGSTR.[I]"	"1xBiotin [K3]"	"0.00184568"	"0.000721313"	"1"	"1"	"7"	"P63017"	"P63017 [326-342]"	"P63017 1xBiotin [K328]"	"1"	"2064.09063"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001538"	"3.98"	""
"31525"	"False"	"High"	"[K].LDDLVSKSEVLGTQSK.[A]"	"1xBiotin [K7]"	"0.000101773"	"0.000721313"	"1"	"1"	"9"	"Q9CQW1"	"Q9CQW1 [167-182]"	"Q9CQW1 1xBiotin [K173]"	"1"	"1944.99467"	"0.301"	"1.342"	"0.925138005747468"	"0.970525080472744"	"78.74"	"63.91"	"104.2"	"34.4"	"161.4"	"53.52"	"51.28"	"44.75"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"9.651E-06"	"3.38"	"49.94"
"31390"	"False"	"High"	"[K].ICHQIEYYFGDFNLPR.[D]"	"1xCarbamidomethyl [C2]"	"0.000487606"	"0.000721313"	"1"	"1"	"7"	"P32067"	"P32067 [17-32]"	""	"0"	"2071.96946"	"9.260"	"0.755"	"0.925138005747468"	"0.906515362333117"	"259.08"	"72.69"	"30.7"	"246.0"	"23.3"	"27.16"	"118.26"	"65.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"4.331E-05"	"3.24"	"53.94"
"31285"	"False"	"High"	"[K].LAVNMVPFPR.[L]"	"1xOxidation [M5]"	"0.0015329"	"0.000721313"	"4"	"8"	"18"	"Q7TMM9; Q9D6F9; Q9ERD7; P99024"	"Q7TMM9 [253-262]; Q9D6F9 [253-262]; Q9ERD7 [253-262]; P99024 [253-262]"	""	"0"	"1159.62923"	"936.412"	"19.345"	"0.648384706721422"	"0.906515362333117"	"56.40"	"102.34"	"0.3"	"293.2"	"6.5"	"69.50"	"40.81"	"64.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001296"	"2.80"	"41.06"
"31284"	"False"	"High"	"[K].LAVNMVPFPR.[L]"	""	"0.00140565"	"0.000721313"	"4"	"8"	"15"	"Q7TMM9; Q9D6F9; Q9ERD7; P99024"	"Q7TMM9 [253-262]; Q9D6F9 [253-262]; Q9ERD7 [253-262]; P99024 [253-262]"	""	"0"	"1143.63431"	"53.557"	"4.066"	"0.589712369315999"	"0.906515362333117"	"68.87"	"50.43"	"6.5"	"266.2"	"27.4"	"42.63"	"73.08"	"24.18"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001188"	"3.08"	"47.25"
"31274"	"False"	"High"	"[R].LAVLKGQDPSR.[V]"	"1xBiotin [K5]"	"0.000481604"	"0.000721313"	"1"	"1"	"13"	"Q9DAZ9"	"Q9DAZ9 [259-269]"	"Q9DAZ9 1xBiotin [K263]"	"1"	"1409.75694"	"0.093"	"0.814"	"0.00844222534545754"	"0.906515362333117"	"54.16"	"73.57"	"159.6"	"15.1"	"125.3"	"34.79"	"35.81"	"91.59"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.287E-05"	"2.99"	"38.44"
"31220"	"False"	"High"	"[K].LASTSSCAQKSAGAGVK.[G]"	"1xBiotin [K10]; 1xCarbamidomethyl [C7]"	"0.00175652"	"0.000721313"	"1"	"2"	"8"	"Q6Y685-2"	"Q6Y685-2 [100-116]"	"Q6Y685-2 1xBiotin [K109]"	"1"	"1848.89424"	"0.125"	"0.858"	"0.00660250658508337"	"0.906515362333117"	"64.52"	"83.44"	"165.8"	"20.1"	"114.2"	"50.81"	"43.82"	"64.34"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001476"	"4.44"	"28.42"
"31192"	"False"	"High"	"[R].IASGLGLAWIIGR.[V]"	""	"0.00144983"	"0.000721313"	"1"	"1"	"4"	"Q9CPU4"	"Q9CPU4 [85-97]"	""	"0"	"1326.78923"	"46.732"	"0.973"	"0.925138005747468"	"0.916215054610739"	"87.16"	"85.38"	"5.3"	"289.4"	"5.3"	"81.54"	"29.32"	"26.39"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001229"	"1.82"	"60.36"
"31149"	"False"	"High"	"[K].LAQSNGWGVMVSHR.[S]"	"1xOxidation [M10]"	"5.89405E-06"	"0.000721313"	"1"	"2"	"18"	"P17182"	"P17182 [359-372]"	""	"0"	"1557.75907"	"278.669"	"4.552"	"0.925138005747468"	"0.906515362333117"	"38.61"	"36.15"	"1.0"	"294.0"	"5.0"	"25.77"	"26.34"	"25.43"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.239E-07"	"4.92"	"29.77"
"31148"	"False"	"High"	"[K].LAQSNGWGVMVSHR.[S]"	""	"3.91651E-06"	"0.000721313"	"1"	"2"	"13"	"P17182"	"P17182 [359-372]"	""	"0"	"1541.76416"	"115.699"	"6.042"	"0.925138005747468"	"0.906515362333117"	"99.48"	"59.51"	"3.5"	"275.7"	"20.8"	"49.62"	"76.02"	"91.15"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.215E-07"	"5.01"	"35.77"
"31061"	"False"	"High"	"[R].IAMSKDQHNGSLTDPSSVHEK.[K]"	"1xBiotin [K5]; 1xOxidation [M3]"	"0.000825365"	"0.000721313"	"1"	"1"	"11"	"Q99KU0"	"Q99KU0 [13-33]"	"Q99KU0 1xBiotin [K17]"	"1"	"2523.16025"	"0.084"	"0.589"	"0.000592354981243821"	"0.906515362333117"	"106.33"	"78.58"	"181.1"	"14.7"	"104.2"	"56.79"	"218.00"	"44.95"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.191E-05"	"4.03"	"27.98"
"31060"	"False"	"High"	"[R].IAMSKDQHNGSLTDPSSVHEK.[K]"	"1xBiotin [K5]"	"2.51063E-05"	"0.000721313"	"1"	"1"	"21"	"Q99KU0"	"Q99KU0 [13-33]"	"Q99KU0 1xBiotin [K17]"	"1"	"2507.16533"	"0.060"	"1.015"	"0.000141510306527739"	"0.916215054610739"	"44.96"	"73.50"	"144.4"	"9.0"	"146.5"	"25.73"	"202.42"	"70.11"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.521E-06"	"4.82"	"32.94"
"31058"	"False"	"High"	"[K].LAMQEFMILPVGASSFR.[E]"	"2xOxidation [M3; M7]"	"3.68586E-05"	"0.000721313"	"1"	"1"	"18"	"P17182"	"P17182 [163-179]"	""	"0"	"1928.96087"	"572.827"	"10.493"	"0.852034109887306"	"0.906515362333117"	"71.07"	"136.08"	"0.5"	"293.1"	"6.5"	"54.62"	"38.71"	"84.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"3.641E-06"	"4.05"	"53.54"
"31599"	"False"	"High"	"[R].LDKAALNALQPPEFR.[N]"	"1xBiotin [K3]"	"1.81713E-06"	"0.000721313"	"1"	"2"	"369"	"Q78T54"	"Q78T54 [4-18]"	"Q78T54 1xBiotin [K6]"	"1"	"1909.00003"	"0.621"	"0.809"	"0.0250134226936827"	"0.906515362333117"	"66.10"	"60.31"	"117.8"	"76.2"	"106.0"	"51.35"	"52.14"	"27.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.014E-07"	"4.98"	"54.91"
"31057"	"False"	"High"	"[K].LAMQEFMILPVGASSFR.[E]"	"1xOxidation [M]"	"1.35991E-05"	"0.000721313"	"1"	"1"	"29"	"P17182"	"P17182 [163-179]"	""	"0"	"1912.96595"	"143.704"	"8.213"	"0.304273797497455"	"0.906515362333117"	"93.61"	"63.17"	"2.7"	"279.0"	"18.3"	"37.09"	"75.55"	"57.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.397E-06"	"3.81"	"58.46"
"32546"	"False"	"High"	"[K].LFNDLFKNNANR.[A]"	"1xBiotin [K7]"	"0.00038776"	"0.000721313"	"1"	"1"	"6"	"Q8BHY8"	"Q8BHY8 [775-786]"	"Q8BHY8 1xBiotin [K781]"	"1"	"1691.83224"	"0.690"	"0.556"	"0.939160161221265"	"0.906515362333117"	"68.99"	"81.34"	"147.2"	"89.2"	"63.6"	"62.56"	"24.34"	"58.94"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.49E-05"	"3.16"	"51.27"
"32574"	"False"	"High"	"[R].IFQFQNFVNTR.[K]"	""	"0.000493682"	"0.000721313"	"1"	"2"	"9"	"Q5SWD9-1"	"Q5SWD9-1 [526-536]"	""	"0"	"1413.72736"	"116.341"	"1.287"	"0.423448720027354"	"0.916215054610739"	"47.89"	"65.70"	"2.6"	"294.2"	"3.2"	"38.58"	"30.14"	"94.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"4.402E-05"	"3.35"	"50.84"
"33309"	"False"	"High"	"[R].LHFFMPGFAPLTSR.[G]"	"1xOxidation [M5]"	"2.78937E-05"	"0.000721313"	"3"	"5"	"85"	"Q7TMM9; Q9D6F9; P99024"	"Q7TMM9 [263-276]; Q9D6F9 [263-276]; P99024 [263-276]"	""	"0"	"1636.83044"	"201.877"	"3.396"	"0.925138005747468"	"0.906515362333117"	"74.97"	"75.23"	"1.5"	"293.0"	"5.5"	"76.14"	"32.38"	"28.04"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.788E-06"	"3.55"	"50.15"
"33308"	"False"	"High"	"[R].LHFFMPGFAPLTSR.[G]"	""	"0.000112374"	"0.000721313"	"3"	"5"	"67"	"Q7TMM9; Q9D6F9; P99024"	"Q7TMM9 [263-276]; Q9D6F9 [263-276]; P99024 [263-276]"	""	"0"	"1620.83553"	"59.137"	"3.271"	"0.958614650351576"	"0.906515362333117"	"56.72"	"39.96"	"6.1"	"274.8"	"19.2"	"33.86"	"41.13"	"30.53"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.063E-05"	"4.19"	"56.28"
"33307"	"False"	"High"	"[R].LHFFMPGFAPLTAR.[G]"	"1xOxidation [M5]"	"7.65439E-05"	"0.000721313"	"1"	"2"	"12"	"Q9ERD7"	"Q9ERD7 [263-276]"	""	"0"	"1620.83553"	"82.952"	"3.640"	"0.979807449139508"	"0.906515362333117"	"39.65"	"35.32"	"3.4"	"284.0"	"12.6"	"25.02"	"26.79"	"32.47"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"7.362E-06"	"4.64"	"56.28"
"33258"	"False"	"High"	"[K].LGYFLALTGYR.[L]"	""	"0.000640316"	"0.000721313"	"1"	"1"	"20"	"Q8QZS1"	"Q8QZS1 [190-200]"	""	"0"	"1273.69393"	"115.532"	"3.023"	"0.940042144832625"	"0.906515362333117"	"70.33"	"60.49"	"2.3"	"291.5"	"6.2"	"57.05"	"26.59"	"17.63"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.642E-05"	"2.86"	"56.02"
"33244"	"False"	"High"	"[R].LGVMLVGWGGNNGSTLTAAVLANR.[L]"	"1xOxidation [M4]"	"0.00122667"	"0.000721313"	"1"	"1"	"1"	"Q9JHU9"	"Q9JHU9 [59-82]"	""	"0"	"2387.24999"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001044"	"3.61"	""
"33206"	"False"	"High"	"[K].LGSTMKLVSHLTSQLNELK.[E]"	"1xBiotin [K6]; 1xOxidation [M5]"	"0.000122551"	"0.000721313"	"1"	"1"	"6"	"P70227"	"P70227 [2628-2646]"	"P70227 1xBiotin [K2633]"	"1"	"2341.22541"	"0.738"	"3.674"	""	"0.906515362333117"	"58.69"	"68.62"	"61.0"	"42.6"	"196.5"	"41.55"	"44.96"	"55.01"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.156E-05"	"4.40"	"54.89"
"33205"	"False"	"High"	"[K].LGSTMKLVSHLTSQLNELK.[E]"	"1xBiotin [K6]"	"7.09745E-06"	"0.000721313"	"1"	"1"	"7"	"P70227"	"P70227 [2628-2646]"	"P70227 1xBiotin [K2633]"	"1"	"2325.23050"	"1.431"	"7.990"	"0.925138005747468"	"0.906515362333117"	"51.97"	"65.27"	"30.6"	"47.7"	"221.7"	"44.94"	"15.22"	"71.96"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.493E-07"	"4.37"	"59.38"
"33189"	"False"	"High"	"[R].LGSIFGLGLAYAGSNR.[E]"	""	"0.000102405"	"0.000721313"	"1"	"1"	"12"	"Q8VDM4"	"Q8VDM4 [479-494]"	""	"0"	"1595.85402"	"137.170"	"3.186"	"0.452995671455796"	"0.906515362333117"	"54.48"	"54.25"	"2.1"	"291.9"	"6.0"	"37.92"	"49.00"	"46.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.736E-06"	"3.62"	"56.75"
"33136"	"False"	"High"	"[K].LGQSVTTIPTVGFNVETVTYKNVK.[F]"	"1xBiotin [K]"	"0.00176742"	"0.000721313"	"1"	"1"	"7"	"P62331"	"P62331 [35-58]"	"P62331 1xBiotin [K]"	"1"	"2821.48044"	"1.408"	"1.289"	"0.50006258855182"	"0.938162963724392"	"87.78"	"90.82"	"76.5"	"120.4"	"103.1"	"108.42"	"22.41"	"70.07"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001478"	"3.63"	"56.75"
"33114"	"False"	"High"	"[K].LGPVGGVFNLAMVLR.[D]"	"1xOxidation [M12]"	"9.62554E-05"	"0.000721313"	"1"	"1"	"12"	"P19096"	"P19096 [1955-1969]"	""	"0"	"1558.87740"	"128.715"	"2.337"	"0.439658977138175"	"0.946660454198708"	"60.22"	"47.89"	"2.7"	"291.5"	"5.9"	"48.33"	"37.76"	"25.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.146E-06"	"3.25"	"61.51"
"33113"	"False"	"High"	"[K].LGPVGGVFNLAMVLR.[D]"	""	"0.000143073"	"0.000721313"	"1"	"1"	"6"	"P19096"	"P19096 [1955-1969]"	""	"0"	"1542.88248"	"27.007"	"2.256"	"0.925138005747468"	"0.943529421563326"	"144.46"	"75.30"	"7.5"	"274.7"	"17.7"	"123.41"	"96.30"	"75.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.338E-05"	"3.16"	"63.22"
"33091"	"False"	"High"	"[R].LGPKVSVLIVQQTDTSDPEK.[V]"	"1xBiotin [K4]"	"4.46048E-06"	"0.000721313"	"1"	"1"	"17"	"P46061"	"P46061 [451-470]"	"P46061 1xBiotin [K454]"	"1"	"2380.24284"	"0.132"	"0.884"	"0.00707987981668626"	"0.906515362333117"	"41.07"	"40.43"	"147.4"	"19.2"	"133.4"	"36.73"	"31.21"	"15.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.784E-07"	"5.50"	"51.30"
"32558"	"False"	"High"	"[K].IFNTNNLWISLGAVK.[R]"	""	"0.0019514"	"0.000721313"	"1"	"2"	"3"	"Q91ZJ5-1"	"Q91ZJ5-1 [326-340]"	""	"0"	"1689.93227"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001625"	"3.12"	""
"33078"	"False"	"High"	"[R].LGNTQGIISAFSTIMSVHR.[G]"	""	"3.09524E-06"	"0.000721313"	"1"	"1"	"7"	"Q9DB20"	"Q9DB20 [118-136]"	""	"0"	"2032.06442"	"53.329"	"4.263"	"0.925138005747468"	"0.906515362333117"	"97.99"	"57.65"	"5.4"	"272.6"	"22.0"	"20.76"	"75.67"	"65.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"3.361E-07"	"4.38"	"61.12"
"33042"	"False"	"High"	"[K].LGLVFDDVVGIVEIINSR.[D]"	""	"0.00171356"	"0.000721313"	"1"	"1"	"4"	"P40124"	"P40124 [377-394]"	""	"0"	"1958.09570"	"1.080"	"1.254"	""	"0.906515362333117"	"43.07"	"51.38"	"98.1"	"91.1"	"110.9"	"40.58"	"34.83"	"34.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001441"	"3.95"	"68.73"
"33041"	"False"	"High"	"[K].IGLVEALCGFQFTFK.[H]"	"1xCarbamidomethyl [C8]"	"0.000558769"	"0.000721313"	"1"	"1"	"5"	"Q9QYJ0"	"Q9QYJ0 [273-287]"	""	"0"	"1729.89819"	"1.582"	"1.669"	"0.925138005747468"	"0.937945192250145"	"85.27"	"56.90"	"67.8"	"107.3"	"125.0"	"52.89"	"140.03"	"46.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.942E-05"	"3.26"	"64.86"
"32994"	"False"	"High"	"[K].LGLKSLVSK.[G]"	"1xBiotin [K4]"	"0.00156163"	"0.000721313"	"3"	"4"	"12"	"P43276; P15864; P43277"	"P43276 [82-90]; P15864 [82-90]; P43277 [83-91]"	"P43276 1xBiotin [K85]; P15864 1xBiotin [K85]; P43277 1xBiotin [K86]"	"1"	"1170.69149"	"0.107"	"0.705"	"0.0077824636664874"	"0.906515362333117"	"60.98"	"60.96"	"167.3"	"17.7"	"115.0"	"49.09"	"34.06"	"35.67"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001317"	"2.70"	"47.72"
"32976"	"False"	"High"	"[K].IGLFGGAGVGK.[T]"	""	"0.000182158"	"0.000721313"	"1"	"1"	"20"	"P56480"	"P56480 [202-212]"	""	"0"	"975.56219"	"114.629"	"3.632"	"0.925138005747468"	"0.906515362333117"	"68.55"	"71.70"	"3.1"	"285.9"	"11.0"	"55.39"	"64.03"	"46.96"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.688E-05"	"3.09"	"40.87"
"32958"	"False"	"High"	"[R].LGKVADWTGATYQDK.[R]"	"1xBiotin [K3]"	"0.000115192"	"0.000721313"	"1"	"1"	"12"	"O70194"	"O70194 [39-53]"	"O70194 1xBiotin [K41]"	"1"	"1878.90546"	"0.144"	"0.675"	"0.925138005747468"	"0.906515362333117"	"47.22"	"28.41"	"162.7"	"24.7"	"112.6"	"16.04"	"43.09"	"41.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.085E-05"	"4.14"	"45.68"
"32956"	"False"	"High"	"[K].LGKTIVITK.[T]"	"1xBiotin [K3]"	"0.00208887"	"0.000721313"	"1"	"1"	"10"	"Q9CPW7"	"Q9CPW7 [62-70]"	"Q9CPW7 1xBiotin [K64]"	"1"	"1198.72279"	"0.146"	"0.743"	"0.925138005747468"	"0.906515362333117"	"61.30"	"89.46"	"140.4"	"26.0"	"133.6"	"51.43"	"50.97"	"60.34"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001728"	"3.05"	"41.49"
"32878"	"False"	"High"	"[K].IGGIGTVPVGR.[V]"	""	"0.00158108"	"0.000721313"	"1"	"2"	"24"	"P10126"	"P10126 [256-266]"	""	"0"	"1025.61020"	"132.407"	"3.850"	"0.925138005747468"	"0.906515362333117"	"53.65"	"62.97"	"2.2"	"289.2"	"8.6"	"57.67"	"37.73"	"84.47"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001329"	"2.46"	"33.42"
"32836"	"False"	"High"	"[K].LGEYGFQNAILVR.[Y]"	""	"2.85933E-05"	"0.000721313"	"1"	"1"	"17"	"P07724"	"P07724 [422-434]"	""	"0"	"1479.79544"	"128.843"	"4.610"	"0.925138005747468"	"0.906515362333117"	"109.60"	"114.70"	"2.2"	"287.0"	"10.7"	"85.21"	"69.51"	"65.75"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.847E-06"	"4.17"	"49.15"
"32749"	"False"	"High"	"[K].LGAVFNQVAFPLQYTPR.[K]"	""	"0.00145884"	"0.000721313"	"1"	"2"	"4"	"Q921M3-1"	"Q921M3-1 [770-786]"	""	"0"	"1921.03304"	"8.897"	"0.967"	"0.992681666347484"	"0.906515362333117"	"234.25"	"46.09"	"38.1"	"228.9"	"33.1"	"35.64"	"127.64"	"38.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001231"	"3.76"	"56.99"
"32734"	"False"	"High"	"[R].LGANSLLDLVVFGR.[A]"	""	"1.62746E-05"	"0.000721313"	"1"	"1"	"9"	"Q8K2B3"	"Q8K2B3 [452-465]"	""	"0"	"1473.84239"	"71.873"	"3.811"	"0.925138005747468"	"0.906515362333117"	"46.66"	"59.25"	"3.9"	"279.0"	"17.2"	"44.02"	"44.24"	"39.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"1.656E-06"	"4.29"	"65.76"
"32699"	"False"	"High"	"[R].IFYQFLYNNNTR.[Q]"	""	"0.000249812"	"0.000721313"	"1"	"1"	"9"	"Q80U70"	"Q80U70 [430-441]"	""	"0"	"1592.78560"	"108.988"	"2.617"	"0.925138005747468"	"0.923750342545975"	"51.69"	"59.19"	"2.6"	"290.3"	"7.1"	"48.76"	"25.05"	"40.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"2.282E-05"	"3.06"	"49.54"
"32679"	"False"	"High"	"[K].LFVLFGAEILK.[K]"	""	"0.00134604"	"0.000721313"	"1"	"1"	"8"	"Q93092"	"Q93092 [87-97]"	""	"0"	"1249.75547"	"142.002"	"3.394"	"0.430383505746853"	"0.906515362333117"	"71.97"	"63.72"	"2.0"	"290.2"	"7.8"	"48.06"	"58.53"	"44.43"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001147"	"2.47"	"62.90"
"33069"	"False"	"High"	"[K].LGNKSPNGISDYPK.[I]"	"1xBiotin [K4]"	"0.000157976"	"0.000721313"	"1"	"3"	"11"	"Q91ZX6"	"Q91ZX6 [120-133]"	"Q91ZX6 1xBiotin [K123]"	"1"	"1715.84213"	"0.156"	"0.861"	"0.925138005747468"	"0.906515362333117"	"74.53"	"65.16"	"131.2"	"24.8"	"144.0"	"56.19"	"56.79"	"40.98"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.473E-05"	"3.59"	"37.41"
"47835"	"False"	"High"	"[R].MSMDLKNNLLGSLR.[M]"	"1xBiotin [K6]"	"9.62554E-05"	"0.000721313"	"1"	"3"	"9"	"Q80Y98"	"Q80Y98 [571-584]"	"Q80Y98 1xBiotin [K576]"	"1"	"1817.90706"	"0.440"	"0.991"	"0.925138005747468"	"0.906515362333117"	"53.60"	"55.65"	"125.8"	"54.3"	"119.8"	"40.97"	"46.25"	"52.73"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.127E-06"	"3.88"	"60.43"
"31056"	"False"	"High"	"[K].LAMQEFMILPVGASSFR.[E]"	""	"2.31357E-06"	"0.000721313"	"1"	"1"	"19"	"P17182"	"P17182 [163-179]"	""	"0"	"1896.97104"	"42.946"	"18.239"	"0.654097394598927"	"0.906515362333117"	"144.38"	"69.90"	"4.8"	"208.0"	"87.2"	"49.92"	"123.51"	"51.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.542E-07"	"4.59"	"62.44"
"30963"	"False"	"High"	"[K].LALDIEIATYR.[KR]"	""	"0.000369019"	"0.000721313"	"1"	"5"	"1"	"Q6NXH9"	"Q6NXH9 [424-434]"	""	"0"	"1277.70998"	"1.222"	"0.812"	"0.982626859977453"	""	"93.62"	"58.34"	"100.5"	"125.7"	"73.9"	"38.98"	"232.11"	"54.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"3.314E-05"	"3.31"	"51.48"
"29254"	"False"	"High"	"[K].KQIQFADDMQEFTK.[F]"	"1xBiotin [K1]"	"0.000103041"	"0.000721313"	"1"	"1"	"10"	"Q80SW1"	"Q80SW1 [40-53]"	"Q80SW1 1xBiotin [K40]"	"1"	"1954.90374"	"0.612"	"1.072"	"0.925138005747468"	"0.906515362333117"	"74.68"	"86.74"	"102.0"	"73.6"	"124.4"	"57.22"	"40.19"	"46.37"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"9.767E-06"	"3.82"	"51.65"
"29123"	"False"	"High"	"[K].KPYGVLYK.[K]"	""	"0.00229205"	"0.000721313"	"1"	"1"	"19"	"Q9JJ80"	"Q9JJ80 [57-64]"	""	"0"	"967.56113"	"140.420"	"3.693"	"0.925138005747468"	"0.906515362333117"	"72.04"	"58.12"	"2.6"	"289.1"	"8.3"	"49.13"	"51.80"	"42.03"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001892"	"2.43"	"24.43"
"29116"	"False"	"High"	"[R].KPVVATISKGGYLQGNMSGR.[L]"	"1xBiotin [K9]; 1xOxidation [M17]"	"9.66154E-07"	"0.000721313"	"1"	"1"	"13"	"Q9WTR6"	"Q9WTR6 [4-23]"	"Q9WTR6 1xBiotin [K12]"	"1"	"2305.17913"	"0.048"	"0.756"	"0.00269933175492291"	"0.906515362333117"	"59.29"	"59.25"	"164.8"	"8.9"	"126.3"	"38.89"	"42.70"	"40.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.102E-07"	"5.38"	"40.44"
"29115"	"False"	"High"	"[R].KPVVATISKGGYLQGNMSGR.[L]"	"1xBiotin [K9]"	"1.12655E-07"	"0.000721313"	"1"	"1"	"15"	"Q9WTR6"	"Q9WTR6 [4-23]"	"Q9WTR6 1xBiotin [K12]"	"1"	"2289.18422"	"0.048"	"1.215"	"0.000435587880254976"	"0.938162963724392"	"71.40"	"55.60"	"143.2"	"6.6"	"150.2"	"43.01"	"64.85"	"45.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.393E-08"	"6.26"	"43.10"
"29114"	"False"	"High"	"[R].KPVVATISK.[G]"	"1xBiotin [K1]"	"0.00208887"	"0.000721313"	"1"	"1"	"3"	"Q9WTR6"	"Q9WTR6 [4-12]"	"Q9WTR6 1xBiotin [K4]"	"0"	"1168.67584"	"0.794"	"1.474"	"0.994201151226993"	"0.975028610040254"	"98.88"	"110.72"	"79.8"	"67.4"	"152.7"	"90.48"	"37.36"	"49.67"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001729"	"2.95"	"35.46"
"28954"	"False"	"High"	"[R].KPISTHTVDFAFNK.[F]"	"1xBiotin [K1]"	"0.000628531"	"0.000721313"	"1"	"1"	"3"	"O70309"	"O70309 [776-789]"	"O70309 1xBiotin [K776]"	"0"	"1830.92072"	"0.935"	"1.123"	"0.925138005747468"	"0.906515362333117"	"50.88"	"40.10"	"99.0"	"92.1"	"108.9"	"50.74"	"33.96"	"17.32"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"5.538E-05"	"3.73"	"43.65"
"28844"	"False"	"High"	"[K].KPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K1]; 2xOxidation [M13; M26]"	"9.73358E-06"	"0.000721313"	"1"	"1"	"4"	"Q99P88"	"Q99P88 [998-1025]"	"Q99P88 1xBiotin [K998]"	"0"	"3347.54934"	"1.170"	"7.752"	"0.94340856990521"	"0.906515362333117"	"94.43"	"105.84"	"30.3"	"38.9"	"230.8"	"91.35"	"39.00"	"38.81"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.011E-06"	"4.61"	"42.95"
"28843"	"False"	"High"	"[K].KPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K1]; 1xOxidation [M]"	"3.35888E-05"	"0.000721313"	"1"	"1"	"17"	"Q99P88"	"Q99P88 [998-1025]"	"Q99P88 1xBiotin [K998]"	"0"	"3331.55443"	"0.188"	"2.983"	"0.925138005747468"	"0.906515362333117"	"41.96"	"42.82"	"73.0"	"13.1"	"213.8"	"49.38"	"27.81"	"37.59"	""	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.329E-06"	"4.70"	"46.10"
"28842"	"False"	"High"	"[K].KPGPPVLSSDPNMLSNEEAGHHFEQMLK.[L]"	"1xBiotin [K1]"	"2.12142E-06"	"0.000721313"	"1"	"1"	"8"	"Q99P88"	"Q99P88 [998-1025]"	"Q99P88 1xBiotin [K998]"	"0"	"3315.55951"	"0.303"	"3.983"	"0.925138005747468"	"0.906515362333117"	"84.68"	"69.31"	"58.2"	"17.7"	"224.1"	"61.09"	"38.06"	"30.06"	""	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.341E-07"	"5.03"	"50.48"
"28814"	"False"	"High"	"[K].KPEVSGSDILDNNGTYGKIWEGSTR.[C]"	"1xBiotin [K18]"	"7.79793E-05"	"0.000721313"	"1"	"1"	"6"	"P28867-1"	"P28867-1 [317-341]"	"P28867-1 1xBiotin [K334]"	"1"	"2949.40471"	"0.303"	"0.726"	"0.925138005747468"	"0.906515362333117"	"73.88"	"77.95"	"133.5"	"41.1"	"125.4"	"56.01"	"48.15"	"54.41"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"7.461E-06"	"4.97"	"49.24"
"28646"	"False"	"High"	"[R].KNPAYLKSVSLQEPR.[G]"	"1xBiotin [K]"	"0.000861923"	"0.000721313"	"1"	"1"	"9"	"Q80WQ6"	"Q80WQ6 [51-65]"	"Q80WQ6 1xBiotin [K]"	"2"	"1956.03714"	"0.258"	"0.589"	"0.925138005747468"	"0.906515362333117"	"34.11"	"89.82"	"158.3"	"41.9"	"99.8"	"16.91"	"31.44"	"82.79"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.484E-05"	"3.72"	"41.49"
"28594"	"False"	"High"	"[K].KNIGKVLLVPGPEK.[E]"	"1xBiotin [K]"	"0.00196351"	"0.000721313"	"1"	"1"	"8"	"Q62465"	"Q62465 [391-404]"	"Q62465 1xBiotin [K]"	"2"	"1718.00332"	"0.298"	"0.817"	"0.925138005747468"	"0.906515362333117"	"42.85"	"46.66"	"148.3"	"45.4"	"106.3"	"24.34"	"42.69"	"41.66"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001637"	"3.31"	"43.78"
"29343"	"False"	"High"	"[R].KQYDQFGDDKSQAAR.[H]"	"1xBiotin [K10]"	"0.00232059"	"0.000721313"	"1"	"1"	"2"	"Q9QYI4"	"Q9QYI4 [169-183]"	"Q9QYI4 1xBiotin [K178]"	"2"	"1982.90250"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001913"	"4.18"	""
"28539"	"False"	"High"	"[R].KNFATSLYSMIK.[G]"	""	"2.37452E-05"	"0.000721313"	"1"	"1"	"18"	"P48036"	"P48036 [288-299]"	""	"1"	"1402.73990"	"107.458"	"10.558"	"0.933275865198517"	"0.906515362333117"	"102.46"	"65.88"	"2.1"	"274.1"	"23.8"	"72.30"	"67.80"	"39.33"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.385E-06"	"3.97"	"48.79"
"28223"	"False"	"High"	"[R].KLVIIEGDLER.[T]"	"1xBiotin [K1]"	"0.00190368"	"0.000721313"	"1"	"2"	"9"	"P21107"	"P21107 [169-179]"	"P21107 1xBiotin [K169]"	"1"	"1510.82978"	"0.689"	"0.888"	"0.925138005747468"	"0.906515362333117"	"63.84"	"72.85"	"109.8"	"78.1"	"112.1"	"48.99"	"42.31"	"40.92"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001589"	"2.24"	"49.10"
"28153"	"False"	"High"	"[K].KLSSAEETAFQTPKPSQTPSVPPLVKTSLFSPK.[L]"	"1xBiotin [K]"	"4.32447E-06"	"0.000721313"	"1"	"1"	"44"	"Q8VCB1"	"Q8VCB1 [404-436]"	"Q8VCB1 1xBiotin [K]"	"2"	"3753.97717"	"0.147"	"3.832"	"0.00209266529864136"	"0.906515362333117"	"198.77"	"53.56"	"60.1"	"9.4"	"230.5"	"47.87"	"151.60"	"25.62"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.648E-07"	"4.45"	"54.10"
"27998"	"False"	"High"	"[R].KLNFLPQKFPSLR.[T]"	""	"0.000322019"	"0.000721313"	"1"	"1"	"14"	"P97452"	"P97452 [325-337]"	""	"2"	"1587.93696"	"75.820"	"1.352"	"0.989369718514603"	"0.929316784206138"	"72.50"	"72.24"	"4.2"	"290.6"	"5.2"	"54.08"	"43.82"	"38.09"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.914E-05"	"3.94"	"45.09"
"27952"	"False"	"High"	"[K].KLIYFQLHR.[A]"	""	"0.00060187"	"0.000721313"	"1"	"2"	"29"	"Q62318"	"Q62318 [367-375]"	""	"1"	"1217.71534"	"97.667"	"2.360"	"0.947989303413716"	"0.906515362333117"	"59.67"	"51.93"	"2.9"	"290.8"	"6.4"	"38.31"	"40.83"	"50.45"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.312E-05"	"3.35"	"37.03"
"27801"	"False"	"High"	"[K].KIHPQTIISGWR.[E]"	""	"0.000496749"	"0.000721313"	"1"	"1"	"13"	"P80314"	"P80314 [120-131]"	""	"1"	"1435.81684"	"141.511"	"5.035"	"0.925138005747468"	"0.906515362333117"	"42.88"	"62.06"	"2.1"	"288.6"	"9.3"	"28.14"	"75.43"	"69.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.421E-05"	"3.75"	"36.13"
"27640"	"False"	"High"	"[R].KLDTTESVGIYQGFEK.[K]"	"1xBiotin [K1]"	"0.000512369"	"0.000721313"	"2"	"2"	"5"	"P28867-2; P28867-1"	"P28867-2 [301-316]; P28867-1 [301-316]"	"P28867-2 1xBiotin [K301]; P28867-1 1xBiotin [K301]"	"1"	"2040.99467"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"4.541E-05"	"3.06"	""
"27462"	"False"	"High"	"[K].KKPTGLNCNLHWR.[F]"	"1xCarbamidomethyl [C8]"	"0.001281"	"0.000721313"	"1"	"1"	"11"	"Q8CFE2"	"Q8CFE2 [95-107]"	""	"1"	"1623.85364"	"70.441"	"2.725"	"0.982626859977453"	"0.906515362333117"	"67.46"	"64.82"	"5.0"	"281.6"	"13.4"	"48.51"	"49.75"	"36.18"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001089"	"2.87"	"26.67"
"27438"	"False"	"High"	"[R].KKPAGPSVSELIVQAVSSSK.[E]"	""	"0.00138835"	"0.000721313"	"1"	"1"	"6"	"P43275"	"P43275 [35-54]"	""	"1"	"2012.13863"	"94.772"	"9.026"	"0.463973682624453"	"0.906515362333117"	"79.03"	"63.19"	"2.9"	"273.9"	"23.3"	"47.34"	"54.04"	"34.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001175"	"3.94"	"48.80"
"27369"	"False"	"High"	"[K].KKETITESAGR.[Q]"	"1xBiotin [K]"	"0.00112483"	"0.000721313"	"1"	"1"	"7"	"Q921L3"	"Q921L3 [53-63]"	"Q921L3 1xBiotin [K]"	"2"	"1445.74169"	"0.236"	"0.637"	"0.925138005747468"	"0.906515362333117"	"44.81"	"47.21"	"159.4"	"41.0"	"99.7"	"46.04"	"42.04"	"39.88"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"9.624E-05"	"4.44"	"26.13"
"27313"	"False"	"High"	"[R].KHVDPVFGFPQFVR.[F]"	"1xBiotin [K1]"	"0.000156031"	"0.000721313"	"1"	"1"	"12"	"Q9CWY8"	"Q9CWY8 [223-236]"	"Q9CWY8 1xBiotin [K223]"	"1"	"1898.97342"	"0.184"	"1.365"	"0.925138005747468"	"0.969054191468458"	"34.85"	"36.10"	"116.0"	"22.6"	"161.5"	"38.10"	"22.31"	"16.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.459E-05"	"4.12"	"55.06"
"27260"	"False"	"High"	"[R].KHFPSVNWLISYSK.[Y]"	""	"0.000106942"	"0.000721313"	"1"	"2"	"29"	"P50516-1"	"P50516-1 [443-456]"	""	"1"	"1705.90605"	"79.288"	"1.863"	"0.990670050327103"	"0.970572453270166"	"84.30"	"69.37"	"3.7"	"290.2"	"6.2"	"72.16"	"64.33"	"20.00"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"1.014E-05"	"3.65"	"46.59"
"27209"	"False"	"High"	"[K].KGVPIIFADELDDSKPPPSSSMPLILQEEK.[A]"	"1xBiotin [K1]; 1xOxidation [M22]"	"0.00027927"	"0.000721313"	"1"	"1"	"8"	"Q62165"	"Q62165 [792-821]"	"Q62165 1xBiotin [K792]"	"1"	"3522.77463"	"0.897"	"7.524"	"0.466031980976297"	"0.906515362333117"	"63.79"	"74.35"	"30.8"	"27.7"	"241.5"	"86.09"	"38.24"	"48.64"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.544E-05"	"3.42"	"57.30"
"28501"	"False"	"High"	"[R].KNAKGGGGNSSSSGSGSGSGSGSPSTGSSGSSSSPGAR.[R]"	"1xBiotin [K]"	"1.24697E-05"	"0.000721313"	"1"	"1"	"11"	"Q8BSY0"	"Q8BSY0 [5-42]"	"Q8BSY0 1xBiotin [K]"	"2"	"3399.46978"	"0.178"	"0.492"	"0.925138005747468"	"0.906515362333117"	"47.98"	"87.12"	"180.0"	"36.0"	"84.0"	"35.05"	"36.13"	"82.74"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.284E-06"	"5.26"	"18.33"
"31011"	"False"	"High"	"[R].IAIPGLAGAGNSVLLVSNLNPER.[V]"	""	"5.05485E-05"	"0.000721313"	"1"	"1"	"7"	"P17225"	"P17225 [324-346]"	""	"0"	"2275.27686"	"80.714"	"4.710"	"0.471781850843532"	"0.906515362333117"	"32.57"	"48.70"	"3.9"	"280.3"	"15.7"	"20.28"	"26.47"	"54.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"4.929E-06"	"4.74"	"60.00"
"29417"	"False"	"High"	"[K].KRPPGYYSYLK.[D]"	""	"0.00152344"	"0.000721313"	"1"	"2"	"7"	"P52479"	"P52479 [152-162]"	""	"1"	"1371.74195"	"64.773"	"1.428"	"0.957384870108493"	"0.952991370623084"	"53.17"	"61.80"	"4.7"	"287.5"	"7.8"	"54.99"	"37.61"	"45.29"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001285"	"3.56"	"27.78"
"29543"	"False"	"High"	"[K].KSEIGIAMGSGTAVAK.[T]"	"1xBiotin [K1]; 1xOxidation [M8]"	"0.000115908"	"0.000721313"	"1"	"2"	"4"	"O55143-1"	"O55143-1 [712-727]"	"O55143-1 1xBiotin [K712]"	"1"	"1761.88737"	"0.667"	"0.826"	"0.947989303413716"	"0.906515362333117"	"83.54"	"83.19"	"111.4"	"80.4"	"108.3"	"68.86"	"47.90"	"39.76"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"1.092E-05"	"3.92"	"36.48"
"30938"	"False"	"High"	"[R].IAKSFDPVLEALSR.[G]"	"1xBiotin [K3]"	"0.00232059"	"0.000721313"	"1"	"1"	"6"	"Q8K1A6"	"Q8K1A6 [282-295]"	"Q8K1A6 1xBiotin [K284]"	"1"	"1771.94112"	"0.390"	"0.566"	"0.925138005747468"	"0.906515362333117"	"64.78"	"54.46"	"151.1"	"58.2"	"90.8"	"45.64"	"43.79"	"42.99"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.000191"	"2.74"	"60.07"
"30846"	"False"	"High"	"[R].LAGKGTAEPHSASDAGMKR.[A]"	"1xBiotin [K4]"	"0.000422878"	"0.000721313"	"1"	"1"	"5"	"Q99LR1"	"Q99LR1 [42-60]"	"Q99LR1 1xBiotin [K45]"	"2"	"2110.01682"	"0.300"	"0.828"	"0.925138005747468"	"0.906515362333117"	"61.28"	"89.08"	"135.8"	"38.3"	"125.8"	"46.84"	"32.62"	"67.54"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.78E-05"	"3.63"	"26.33"
"30845"	"False"	"High"	"[R].LAGKGTAEPHSASDAGMK.[R]"	"1xBiotin [K4]; 1xOxidation [M17]"	"2.43408E-05"	"0.000721313"	"1"	"1"	"43"	"Q99LR1"	"Q99LR1 [42-59]"	"Q99LR1 1xBiotin [K45]"	"1"	"1969.91062"	"0.057"	"0.792"	"0.000251284335736687"	"0.906515362333117"	"500.56"	"50.28"	"171.0"	"9.4"	"119.6"	"27.04"	"109.07"	"41.03"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.446E-06"	"4.27"	"25.63"
"30844"	"False"	"High"	"[R].LAGKGTAEPHSASDAGMK.[R]"	"1xBiotin [K4]"	"2.85933E-05"	"0.000721313"	"1"	"1"	"10"	"Q99LR1"	"Q99LR1 [42-59]"	"Q99LR1 1xBiotin [K45]"	"1"	"1953.91571"	"0.116"	"1.419"	"0.00128069232031198"	"0.978065219415842"	"213.95"	"114.95"	"48.0"	"5.3"	"246.7"	"104.37"	"40.19"	"53.86"	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.857E-06"	"4.45"	"28.97"
"30828"	"False"	"High"	"[K].IAGAGLLFVGGGIGGTILYAK.[W]"	""	"0.0012041"	"0.000721313"	"1"	"5"	"4"	"Q8CAQ8-1"	"Q8CAQ8-1 [46-66]"	""	"0"	"1948.12661"	"30.046"	"0.915"	"0.925138005747468"	"0.906515362333117"	"142.64"	"47.72"	"9.4"	"281.8"	"8.8"	"47.74"	"128.79"	"31.04"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001027"	"2.82"	"62.58"
"30650"	"False"	"High"	"[R].KYVSISVPSK.[T]"	"1xBiotin [K1]"	"0.00101246"	"0.000721313"	"1"	"1"	"3"	"Q922Q5"	"Q922Q5 [10-19]"	"Q922Q5 1xBiotin [K10]"	"1"	"1333.71843"	"0.242"	"0.625"	"0.925138005747468"	"0.906515362333117"	"86.54"	"116.61"	"189.1"	"38.2"	"72.6"	"61.03"	"36.88"	"91.09"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"8.723E-05"	"2.84"	"41.30"
"30637"	"False"	"High"	"[R].KYSQFINFPIYVWSSK.[T]"	""	"1.54879E-05"	"0.000721313"	"1"	"1"	"50"	"P08113"	"P08113 [270-285]"	""	"1"	"2007.03746"	"218.765"	"6.187"	"0.925138005747468"	"0.906515362333117"	"46.37"	"51.64"	"1.4"	"290.9"	"7.7"	"30.93"	"42.94"	"31.65"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.584E-06"	"4.90"	"58.42"
"30542"	"False"	"High"	"[R].KYAVLYQPLFDKR.[F]"	""	"0.000632435"	"0.000721313"	"1"	"1"	"11"	"P28656"	"P28656 [105-117]"	""	"2"	"1640.91589"	"201.553"	"4.332"	"0.925138005747468"	"0.906515362333117"	"60.54"	"80.33"	"1.8"	"291.7"	"6.5"	"61.58"	"51.90"	"55.74"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"5.551E-05"	"3.39"	"40.75"
"30349"	"False"	"High"	"[K].KVPAGPKTLK.[K]"	"1xBiotin [K]"	"0.00205045"	"0.000721313"	"1"	"1"	"18"	"P14148"	"P14148 [21-30]"	"P14148 1xBiotin [K]"	"2"	"1264.74459"	"0.023"	"0.831"	"3.8461976882733E-05"	"0.906515362333117"	"76.67"	"70.17"	"178.7"	"3.9"	"117.4"	"38.35"	"227.93"	"52.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001705"	"2.98"	"29.46"
"30348"	"False"	"High"	"[K].KVNVVEQEK.[I]"	"1xBiotin [K1]"	"0.0010443"	"0.000721313"	"1"	"1"	"11"	"P17182"	"P17182 [81-89]"	"P17182 1xBiotin [K81]"	"1"	"1298.67730"	"0.154"	"0.674"	"0.0111021122550617"	"0.906515362333117"	"62.60"	"58.88"	"144.9"	"22.8"	"132.3"	"54.11"	"42.43"	"60.91"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.967E-05"	"3.17"	"30.91"
"30250"	"False"	"High"	"[K].KVHVIFNYK.[G]"	""	"0.000795265"	"0.000721313"	"1"	"1"	"40"	"P14211"	"P14211 [143-151]"	""	"1"	"1147.66224"	"109.346"	"3.512"	"0.929016530787821"	"0.906515362333117"	"43.18"	"53.37"	"2.8"	"287.3"	"9.9"	"24.08"	"58.92"	"47.42"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.935E-05"	"3.19"	"29.07"
"30157"	"False"	"High"	"[K].KVATVPGTLK.[K]"	"1xBiotin [K1]"	"0.00114592"	"0.000721313"	"1"	"1"	"9"	"P14148"	"P14148 [10-19]"	"P14148 1xBiotin [K10]"	"1"	"1239.71295"	"0.017"	"0.738"	"2.02065471673078E-05"	"0.906515362333117"	"55.71"	"58.59"	"170.8"	"2.8"	"126.4"	"43.34"	"28.42"	"22.82"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"9.807E-05"	"2.68"	"36.41"
"29542"	"False"	"High"	"[K].KSEIGIAMGSGTAVAK.[T]"	"1xBiotin [K1]"	"1.88826E-05"	"0.000721313"	"1"	"2"	"9"	"O55143-1"	"O55143-1 [712-727]"	"O55143-1 1xBiotin [K712]"	"1"	"1745.89245"	"0.188"	"0.588"	"0.925138005747468"	"0.906515362333117"	"56.62"	"101.03"	"165.2"	"29.5"	"105.3"	"32.27"	"41.35"	"93.99"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.918E-06"	"3.91"	"42.25"
"30137"	"False"	"High"	"[R].KVAHSDKPGSTSAVSFR.[D]"	"1xBiotin [K1]"	"2.46138E-06"	"0.000721313"	"1"	"1"	"25"	"Q9WV55"	"Q9WV55 [205-221]"	"Q9WV55 1xBiotin [K205]"	"1"	"2000.00182"	"0.031"	"0.787"	"6.64120188369121E-05"	"0.906515362333117"	"28.04"	"17.80"	"165.3"	"5.4"	"129.3"	"18.23"	"24.69"	"14.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.7E-07"	"4.92"	"27.72"
"30112"	"False"	"High"	"[R].KTVTAMDVVYALK.[R]"	"1xBiotin [K1]"	"0.000493682"	"0.000721313"	"1"	"1"	"11"	"P62806"	"P62806 [80-92]"	"P62806 1xBiotin [K80]"	"1"	"1664.87501"	"0.196"	"0.472"	"0.925138005747468"	"0.906515362333117"	"54.62"	"92.15"	"180.6"	"34.2"	"85.2"	"32.54"	"46.60"	"80.42"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.403E-05"	"2.75"	"56.55"
"30082"	"False"	"High"	"[R].KTSYAQHQQVR.[Q]"	"1xBiotin [K1]"	"0.000409985"	"0.000721313"	"1"	"1"	"19"	"P97351"	"P97351 [152-162]"	"P97351 1xBiotin [K152]"	"1"	"1571.77472"	"0.027"	"0.728"	"5.18589010487259E-05"	"0.906515362333117"	"60.76"	"26.85"	"170.4"	"5.6"	"124.0"	"66.23"	"38.87"	"16.42"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.675E-05"	"3.86"	"22.68"
"30070"	"False"	"High"	"[K].KTSPEFSQPLKK.[V]"	"1xBiotin [K]"	"0.000733761"	"0.000721313"	"1"	"1"	"33"	"Q8VBT0"	"Q8VBT0 [221-232]"	"Q8VBT0 1xBiotin [K]"	"2"	"1615.85124"	"0.016"	"0.671"	"1.90485214499217E-05"	"0.906515362333117"	"46.78"	"40.88"	"171.1"	"3.0"	"125.9"	"35.04"	"43.45"	"45.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.415E-05"	"3.52"	"34.27"
"30069"	"False"	"High"	"[K].KTSPEFSQPLK.[K]"	"1xBiotin [K1]"	"0.000541734"	"0.000721313"	"1"	"1"	"12"	"Q8VBT0"	"Q8VBT0 [221-231]"	"Q8VBT0 1xBiotin [K221]"	"1"	"1487.75628"	"0.064"	"0.763"	"0.000329025978196866"	"0.906515362333117"	"234.10"	"33.42"	"158.9"	"11.7"	"129.4"	"32.58"	"114.78"	"15.43"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.798E-05"	"3.25"	"38.65"
"30026"	"False"	"High"	"[K].KTPMGIILDALEQQEDNINK.[F]"	"1xBiotin [K1]"	"6.76268E-05"	"0.000721313"	"1"	"1"	"1"	"Q8R5J9"	"Q8R5J9 [159-178]"	"Q8R5J9 1xBiotin [K159]"	"1"	"2496.24727"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"6.532E-06"	"5.63"	""
"29981"	"False"	"High"	"[K].KTLLGDVPVVADPTVPNVTVTR.[L]"	"1xBiotin [K1]"	"0.000461174"	"0.000721313"	"1"	"1"	"12"	"Q61599"	"Q61599 [49-70]"	"Q61599 1xBiotin [K49]"	"1"	"2517.37452"	"0.281"	"0.910"	"0.925138005747468"	"0.906515362333117"	"39.86"	"49.61"	"137.2"	"40.3"	"122.6"	"21.77"	"41.03"	"47.81"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.122E-05"	"4.95"	"56.60"
"29947"	"False"	"High"	"[R].KTGSYGALAEISASK.[E]"	"1xBiotin [K1]"	"0.00198797"	"0.000721313"	"1"	"2"	"1"	"Q9DBR7-1"	"Q9DBR7-1 [442-456]"	"Q9DBR7-1 1xBiotin [K442]"	"1"	"1708.85745"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001656"	"2.88"	""
"29920"	"False"	"High"	"[K].KTFFEELAVEDK.[Q]"	"1xBiotin [K1]"	"0.000211348"	"0.000721313"	"1"	"1"	"3"	"Q6P542"	"Q6P542 [39-50]"	"Q6P542 1xBiotin [K39]"	"1"	"1681.81418"	"0.511"	"0.552"	"0.925138005747468"	"0.906515362333117"	"67.58"	"66.47"	"137.7"	"85.4"	"76.9"	"54.43"	"47.22"	"32.45"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"1.944E-05"	"3.75"	"55.04"
"29914"	"False"	"High"	"[R].KTEPSAWTQDTGDTNANGKDWGR.[N]"	"1xBiotin [K19]"	"6.9323E-05"	"0.000721313"	"1"	"1"	"6"	"Q80WJ7"	"Q80WJ7 [313-335]"	"Q80WJ7 1xBiotin [K331]"	"2"	"2761.22708"	"0.790"	"1.322"	"0.949662611758987"	"0.924042168607348"	"56.56"	"71.89"	"90.0"	"79.2"	"130.9"	"41.68"	"36.53"	"52.56"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"6.686E-06"	"4.94"	"39.97"
"29871"	"False"	"High"	"[K].KTALALAITDSELSDEEASILESGGFSVSR.[A]"	"1xBiotin [K1]"	"1.04198E-05"	"0.000721313"	"1"	"3"	"2"	"Q6NS82-1"	"Q6NS82-1 [293-322]"	"Q6NS82-1 1xBiotin [K293]"	"1"	"3322.63589"	"0.932"	"0.824"	""	"0.906515362333117"	"42.30"	"50.30"	"115.4"	"99.3"	"85.3"	"33.95"	"30.53"	"43.96"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.081E-06"	"5.63"	"66.11"
"29811"	"False"	"High"	"[K].KSTVLQQQYNR.[V]"	"1xBiotin [K1]"	"0.000153159"	"0.000721313"	"1"	"1"	"11"	"P26039"	"P26039 [428-438]"	"P26039 1xBiotin [K428]"	"1"	"1590.80569"	"0.872"	"1.517"	"0.925138005747468"	"0.992134392955587"	"60.69"	"107.39"	"71.2"	"73.3"	"155.6"	"89.21"	"36.62"	"81.17"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.433E-05"	"3.25"	"34.84"
"29757"	"False"	"High"	"[K].KSSGFLSNLLGGH.[-]"	"1xBiotin [K1]"	"4.14101E-06"	"0.000721313"	"1"	"4"	"17"	"Q8VE91-1"	"Q8VE91-1 [352-364]"	"Q8VE91-1 1xBiotin [K352]"	"1"	"1542.77332"	"0.116"	"1.175"	"0.0249291256582081"	"0.91398852688127"	"34.48"	"18.39"	"131.8"	"15.4"	"152.8"	"12.53"	"42.88"	"15.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.455E-07"	"4.26"	"58.24"
"30127"	"False"	"High"	"[R].KVACIGAWHPAR.[V]"	"1xCarbamidomethyl [C4]"	"0.00196351"	"0.000721313"	"1"	"1"	"3"	"P27659"	"P27659 [250-261]"	""	"1"	"1365.72083"	"101.734"	"1.048"	"0.709657575970404"	""	"61.14"	"71.33"	"2.9"	"294.0"	"3.2"	"45.82"	"25.76"	"51.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001636"	"3.28"	"26.89"
"48155"	"False"	"High"	"[K].MSSYAFFVQTCR.[E]"	"1xCarbamidomethyl [C11]"	"9.98994E-05"	"0.000721313"	"2"	"2"	"26"	"P63158; P30681"	"P63158 [13-24]; P30681 [13-24]"	""	"0"	"1496.66608"	"70.929"	"6.828"	"0.979301999091092"	"0.906515362333117"	"89.27"	"90.48"	"3.8"	"273.8"	"22.4"	"80.93"	"51.37"	"42.38"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.454E-06"	"3.60"	"46.26"
"48156"	"False"	"High"	"[K].MSSYAFFVQTCR.[E]"	"1xCarbamidomethyl [C11]; 1xOxidation [M1]"	"5.65094E-05"	"0.000721313"	"2"	"2"	"14"	"P63158; P30681"	"P63158 [13-24]; P30681 [13-24]"	""	"0"	"1512.66100"	"840.886"	"10.467"	"0.478573781684308"	"0.906515362333117"	"105.14"	"91.04"	"0.3"	"295.9"	"3.8"	"104.27"	"40.91"	"48.04"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"5.484E-06"	"3.73"	"43.32"
"48261"	"False"	"High"	"[K].MSVQPTVSLGGFEITPPVVLR.[L]"	""	"2.70432E-05"	"0.000721313"	"1"	"1"	"21"	"Q61937"	"Q61937 [81-101]"	""	"0"	"2227.21550"	"62.372"	"14.236"	"0.486690115660178"	"0.906515362333117"	"144.93"	"61.33"	"5.0"	"230.4"	"64.6"	"51.75"	"107.55"	"42.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.696E-06"	"4.89"	"61.28"
"67186"	"False"	"High"	"[R].VFSNVSIILFLNK.[T]"	""	"0.000729232"	"0.000721313"	"1"	"1"	"1"	"P27601"	"P27601 [280-292]"	""	"0"	"1493.87263"	"2.176"	"0.891"	"0.925138005747468"	""	"78.18"	"53.86"	"78.2"	"145.0"	"76.8"	"43.38"	"168.41"	"36.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"6.377E-05"	"2.25"	"61.54"
"67179"	"False"	"High"	"[K].VFSATLGLVDIVKGTNSYYK.[L]"	"1xBiotin [K]"	"0.00200031"	"0.000721313"	"1"	"2"	"5"	"P11103"	"P11103 [551-570]"	"P11103 1xBiotin [K]"	"1"	"2401.24719"	"1.117"	"1.043"	""	"0.906515362333117"	"49.22"	"38.78"	"96.7"	"109.8"	"93.5"	"19.04"	"46.06"	"50.47"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000166"	"2.93"	"63.39"
"67174"	"False"	"High"	"[K].VFQFLNAKCESAFLSK.[R]"	"1xBiotin [K8]; 1xCarbamidomethyl [C9]"	"0.000126406"	"0.000721313"	"1"	"1"	"6"	"Q8BP67"	"Q8BP67 [28-43]"	"Q8BP67 1xBiotin [K35]"	"1"	"2115.04018"	"0.266"	"0.167"	"0.925138005747468"	"0.906515362333117"	"74.85"	"68.37"	"208.1"	"59.4"	"32.5"	"64.01"	"49.83"	"70.58"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"1.192E-05"	"3.52"	"58.59"
"67138"	"False"	"High"	"[K].VFLPGFLSSNLYYK.[Y]"	""	"0.000230489"	"0.000721313"	"1"	"3"	"10"	"O88845-1"	"O88845-1 [490-503]"	""	"0"	"1647.87811"	"103.019"	"1.610"	"0.380827439155979"	"0.91398852688127"	"49.84"	"82.59"	"2.8"	"293.5"	"3.8"	"37.83"	"34.51"	"82.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.112E-05"	"3.48"	"60.18"
"67128"	"False"	"High"	"[K].VFIDQNLSPGKGVVSLVAVHPSTVNTLGK.[Q]"	"1xBiotin [K11]"	"2.78937E-05"	"0.000721313"	"1"	"1"	"9"	"Q08639"	"Q08639 [16-44]"	"Q08639 1xBiotin [K26]"	"1"	"3202.72928"	"0.357"	"2.446"	"0.925138005747468"	"0.906515362333117"	"87.07"	"105.34"	"76.3"	"30.3"	"193.5"	"85.16"	"36.62"	"67.48"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.787E-06"	"4.36"	"56.49"
"67113"	"False"	"High"	"[K].VFHGLKSTEVAK.[T]"	"1xBiotin [K6]"	"4.99262E-05"	"0.000721313"	"1"	"1"	"24"	"Q61233"	"Q61233 [77-88]"	"Q61233 1xBiotin [K82]"	"1"	"1541.81446"	"0.019"	"0.886"	"2.78752901019112E-05"	"0.906515362333117"	"40.69"	"32.23"	"156.2"	"3.1"	"140.7"	"29.01"	"34.83"	"44.40"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.86E-06"	"4.53"	"35.69"
"67085"	"False"	"High"	"[R].VFANILLYIQR.[T]"	""	"0.000644293"	"0.000721313"	"1"	"1"	"6"	"Q8QZY1"	"Q8QZY1 [335-345]"	""	"0"	"1349.79398"	"54.269"	"0.963"	"0.925138005747468"	"0.906515362333117"	"67.46"	"64.34"	"7.9"	"285.0"	"7.2"	"48.56"	"47.75"	"31.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"5.662E-05"	"2.84"	"59.96"
"67065"	"False"	"High"	"[R].VETGVLKPGMVVTFAPVNVTTEVK.[S]"	"1xOxidation [M10]"	"3.97021E-05"	"0.000721313"	"1"	"1"	"16"	"P10126"	"P10126 [267-290]"	""	"0"	"2531.37894"	"134.046"	"3.126"	"0.391080556018904"	"0.909223670800027"	"82.36"	"87.20"	"2.4"	"290.3"	"7.3"	"51.26"	"125.98"	"65.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.902E-06"	"4.10"	"48.28"
"67064"	"False"	"High"	"[R].VETGVLKPGMVVTFAPVNVTTEVK.[S]"	""	"6.55648E-05"	"0.000721313"	"1"	"1"	"10"	"P10126"	"P10126 [267-290]"	""	"0"	"2515.38402"	"1.286"	"7.725"	"0.982626859977453"	"0.906515362333117"	"86.61"	"46.64"	"29.5"	"40.0"	"230.4"	"31.08"	"149.81"	"38.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.339E-06"	"5.32"	"51.92"
"67029"	"False"	"High"	"[K].VEPAVSSIVNSIQVLASKSAILEATPK.[E]"	"1xBiotin [K18]"	"3.91167E-07"	"0.000721313"	"1"	"12"	"5"	"Q99PL5-1"	"Q99PL5-1 [149-175]"	"Q99PL5-1 1xBiotin [K166]"	"1"	"2977.62783"	"0.883"	"2.356"	""	"0.906515362333117"	"33.84"	"124.35"	"71.0"	"61.7"	"167.3"	"25.17"	"32.44"	"94.48"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.619E-08"	"6.84"	"68.25"
"66949"	"False"	"High"	"[R].VEENFLKLTHVQR.[Q]"	"1xBiotin [K7]"	"5.79267E-05"	"0.000721313"	"1"	"3"	"13"	"Q9D024"	"Q9D024 [413-425]"	"Q9D024 1xBiotin [K419]"	"1"	"1838.95816"	"0.084"	"1.091"	"0.0041333639999365"	"0.919063063983313"	"67.93"	"31.61"	"138.2"	"11.1"	"150.6"	"22.41"	"54.75"	"19.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.624E-06"	"4.17"	"46.25"
"66942"	"False"	"High"	"[R].VEEGWLSLAKAR.[Y]"	"1xBiotin [K10]"	"0.000378274"	"0.000721313"	"1"	"1"	"6"	"Q8VE99"	"Q8VE99 [35-46]"	"Q8VE99 1xBiotin [K44]"	"1"	"1584.82027"	"0.526"	"0.393"	"0.925138005747468"	"0.906515362333117"	"49.90"	"55.17"	"146.3"	"91.2"	"62.5"	"52.05"	"38.03"	"34.54"	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"3.409E-05"	"3.66"	"53.86"
"66897"	"False"	"High"	"[K].VEAKFINYVK.[N]"	"1xBiotin [K4]"	"0.000851316"	"0.000721313"	"1"	"1"	"11"	"Q61937"	"Q61937 [262-271]"	"Q61937 1xBiotin [K265]"	"1"	"1436.76063"	"0.258"	"0.764"	"0.925138005747468"	"0.906515362333117"	"63.17"	"69.67"	"131.7"	"35.8"	"132.6"	"50.04"	"33.59"	"47.60"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.413E-05"	"2.90"	"47.91"
"66832"	"False"	"High"	"[K].VDPGETSVGTYPDKGR.[N]"	"1xBiotin [K14]"	"5.05485E-05"	"0.000721313"	"1"	"2"	"12"	"Q6P1H6-1"	"Q6P1H6-1 [696-711]"	"Q6P1H6-1 1xBiotin [K709]"	"1"	"1903.88545"	"0.161"	"1.122"	"0.925138005747468"	"0.915242122105656"	"69.82"	"59.00"	"136.6"	"21.9"	"141.5"	"32.77"	"50.91"	"66.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.924E-06"	"3.88"	"36.25"
"66825"	"False"	"High"	"[K].VDNAYWLWTFQGR.[L]"	""	"0.000259269"	"0.000721313"	"1"	"1"	"11"	"Q8JZQ9"	"Q8JZQ9 [666-678]"	""	"0"	"1655.79650"	"111.697"	"2.246"	"0.427089858136149"	"0.916215054610739"	"56.77"	"75.95"	"2.7"	"289.9"	"7.4"	"40.54"	"42.95"	"44.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.374E-05"	"3.19"	"58.37"
"66722"	"False"	"High"	"[K].VDCKGAGTNGLPTK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"5.37118E-06"	"0.000721313"	"1"	"1"	"35"	"Q91WE4"	"Q91WE4 [48-61]"	"Q91WE4 1xBiotin [K51]"	"1"	"1643.78799"	"0.067"	"0.926"	"0.00035922587423852"	"0.906515362333117"	"215.13"	"48.06"	"152.3"	"11.8"	"135.9"	"47.74"	"108.61"	"24.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.725E-07"	"4.44"	"32.17"
"66629"	"False"	"High"	"[K].VAVLGASGGIGQPLSLLLK.[N]"	""	"1.52028E-05"	"0.000721313"	"1"	"1"	"25"	"P08249"	"P08249 [27-45]"	""	"0"	"1793.08950"	"158.194"	"11.258"	"0.498273231384032"	"0.906515362333117"	"61.22"	"61.80"	"1.5"	"282.5"	"16.0"	"38.09"	"41.71"	"44.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.553E-06"	"5.08"	"61.68"
"66593"	"False"	"High"	"[K].VASDWMSNLGFKR.[R]"	"1xBiotin [K12]; 1xOxidation [M6]"	"0.000322019"	"0.000721313"	"1"	"2"	"13"	"Q9JL26"	"Q9JL26 [100-112]"	"Q9JL26 1xBiotin [K111]"	"1"	"1752.81962"	"0.141"	"0.704"	"0.925138005747468"	"0.906515362333117"	"39.16"	"51.24"	"162.1"	"23.4"	"114.5"	"77.34"	"28.41"	"30.88"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.92E-05"	"3.93"	"48.12"
"66592"	"False"	"High"	"[K].VASDWMSNLGFKR.[R]"	"1xBiotin [K12]"	"4.72196E-05"	"0.000721313"	"1"	"2"	"13"	"Q9JL26"	"Q9JL26 [100-112]"	"Q9JL26 1xBiotin [K111]"	"1"	"1736.82471"	"0.140"	"0.947"	"0.925138005747468"	"0.906515362333117"	"34.69"	"78.25"	"137.7"	"18.7"	"143.6"	"49.00"	"37.97"	"69.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.626E-06"	"3.86"	"55.85"
"66562"	"False"	"High"	"[R].VAPEEHPVLLTEAPLNPKANR.[E]"	"1xBiotin [K18]"	"1.48309E-05"	"0.000721313"	"1"	"2"	"11"	"P60710"	"P60710 [96-116]"	"P60710 1xBiotin [K113]"	"1"	"2521.32315"	"0.173"	"0.979"	"0.925138005747468"	"0.916215054610739"	"56.60"	"48.39"	"136.5"	"23.1"	"140.4"	"36.63"	"41.58"	"23.48"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.517E-06"	"4.73"	"46.47"
"66561"	"False"	"High"	"[R].VAPEEHPVLLTEAPLNPK.[A]"	""	"0.00118929"	"0.000721313"	"1"	"2"	"5"	"P60710"	"P60710 [96-113]"	""	"0"	"1954.06440"	"1.758"	"1.163"	"0.944967096116098"	"0.906515362333117"	"107.24"	"89.11"	"111.0"	"73.3"	"115.8"	"52.92"	"156.12"	"61.15"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001017"	"3.29"	"40.37"
"66550"	"False"	"High"	"[K].VANVSLLALYK.[G]"	""	"0.00200031"	"0.000721313"	"1"	"1"	"7"	"P62267"	"P62267 [125-135]"	""	"0"	"1190.71434"	"154.547"	"3.004"	"0.848126083046377"	"0.906515362333117"	"84.35"	"72.54"	"1.9"	"292.6"	"5.5"	"59.86"	"46.30"	"33.37"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001666"	"2.54"	"48.97"
"66546"	"False"	"High"	"[K].VANLCGINQKLLAEALNQVTQR.[S]"	"1xBiotin [K10]; 1xCarbamidomethyl [C5]"	"7.8757E-07"	"0.000721313"	"2"	"2"	"7"	"P28867-2; P28867-1"	"P28867-2 [276-297]; P28867-1 [276-297]"	"P28867-2 1xBiotin [K285]; P28867-1 1xBiotin [K285]"	"1"	"2679.40690"	"0.841"	"7.956"	"0.925138005747468"	"0.906515362333117"	"33.92"	"34.86"	"30.4"	"27.6"	"242.0"	"21.96"	"29.36"	"44.61"	"NotUnique"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.06E-08"	"5.87"	"64.37"
"66530"	"False"	"High"	"[R].VALTGLTVAEYFR.[D]"	""	"5.34459E-05"	"0.000721313"	"1"	"1"	"12"	"P56480"	"P56480 [282-294]"	""	"0"	"1439.78929"	"167.090"	"5.435"	"0.456054347973677"	"0.906515362333117"	"49.96"	"44.79"	"1.8"	"289.0"	"9.2"	"36.09"	"37.78"	"29.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.193E-06"	"3.60"	"56.42"
"66490"	"False"	"High"	"[K].VAIDASMSIYQFLIAVR.[Q]"	"1xOxidation [M7]"	"0.000444354"	"0.000721313"	"1"	"1"	"2"	"P39749"	"P39749 [31-47]"	""	"0"	"1913.02010"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"3.973E-05"	"3.56"	""
"67191"	"False"	"High"	"[R].VFSWGFGGYGR.[L]"	""	"0.00138835"	"0.000721313"	"1"	"1"	"53"	"Q8BK67"	"Q8BK67 [349-359]"	""	"0"	"1232.58472"	"129.137"	"2.341"	"0.925138005747468"	"0.906515362333117"	"66.49"	"74.23"	"2.2"	"291.3"	"6.5"	"63.56"	"30.02"	"32.55"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001176"	"3.25"	"51.06"
"67199"	"False"	"High"	"[R].VFVHYTGWLLDGTK.[F]"	""	"3.46452E-05"	"0.000721313"	"1"	"1"	"11"	"P30416"	"P30416 [53-66]"	""	"0"	"1635.85295"	"190.911"	"8.091"	"0.439658977138175"	"0.906515362333117"	"61.41"	"33.73"	"1.5"	"285.1"	"13.4"	"23.30"	"67.07"	"43.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0001059"	"3.431E-06"	"3.90"	"49.62"
"67206"	"False"	"High"	"[K].VFVVKGLSSSSR.[R]"	"1xBiotin [K5]"	"0.000168068"	"0.000721313"	"1"	"1"	"14"	"D3Z6Q9"	"D3Z6Q9 [246-257]"	"D3Z6Q9 1xBiotin [K250]"	"1"	"1491.79881"	"0.087"	"1.112"	"0.00974188783979308"	"0.924306229746472"	"21.70"	"30.06"	"131.6"	"12.5"	"155.9"	"24.00"	"33.70"	"32.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.559E-05"	"3.56"	"45.37"
"67238"	"False"	"High"	"[R].VGDGSPVLPDKR.[N]"	"1xBiotin [K11]"	"0.000304563"	"0.000721313"	"1"	"1"	"17"	"Q8BH07"	"Q8BH07 [76-87]"	"Q8BH07 1xBiotin [K86]"	"1"	"1465.74677"	"5.483"	"1.083"	"0.585581871548498"	"0.916215054610739"	"36.52"	"35.12"	"38.2"	"217.3"	"44.5"	"16.68"	"76.41"	"26.80"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.766E-05"	"3.79"	"38.87"
"68284"	"False"	"High"	"[R].VISGVLQLGNIAFK.[K]"	""	"1.30222E-05"	"0.000721313"	"1"	"1"	"15"	"Q8VDD5"	"Q8VDD5 [342-355]"	""	"0"	"1458.86788"	"210.767"	"8.293"	"0.925138005747468"	"0.906515362333117"	"43.06"	"37.62"	"1.3"	"287.9"	"10.8"	"36.94"	"27.78"	"31.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.342E-06"	"4.23"	"56.28"
"68205"	"False"	"High"	"[K].VLQLINDNTATALSYGVFR.[R]"	""	"2.65454E-05"	"0.000721313"	"1"	"1"	"5"	"Q9JKR6"	"Q9JKR6 [199-217]"	""	"0"	"2095.11823"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"2.647E-06"	"3.80"	""
"68198"	"False"	"High"	"[R].VLQELKSVLGFK.[A]"	"1xBiotin [K6]"	"0.000628531"	"0.000721313"	"1"	"3"	"8"	"Q3ZK22-1"	"Q3ZK22-1 [582-593]"	"Q3ZK22-1 1xBiotin [K587]"	"1"	"1586.89746"	"0.802"	"1.752"	"0.925138005747468"	"0.971527943114863"	"56.62"	"41.29"	"84.5"	"67.5"	"148.0"	"25.25"	"46.39"	"38.47"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.523E-05"	"3.27"	"61.79"
"68113"	"False"	"High"	"[K].VLNKGVENPLPDRPR.[E]"	"1xBiotin [K4]"	"0.001281"	"0.000721313"	"1"	"1"	"18"	"Q07832"	"Q07832 [342-356]"	"Q07832 1xBiotin [K345]"	"1"	"1930.03273"	"0.097"	"0.906"	"0.00564840094802839"	"0.906515362333117"	"56.42"	"56.18"	"156.7"	"13.2"	"130.1"	"25.65"	"42.49"	"51.38"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001089"	"2.96"	"38.90"
"68072"	"False"	"High"	"[K].VLISVGSYKSSVESVLIK.[M]"	"1xBiotin [K9]"	"3.65859E-06"	"0.000721313"	"1"	"2"	"25"	"Q3UMB5"	"Q3UMB5 [410-427]"	"Q3UMB5 1xBiotin [K418]"	"1"	"2134.18280"	"0.069"	"3.492"	"0.00443914850595206"	"0.906515362333117"	"48.89"	"38.47"	"70.4"	"5.4"	"224.2"	"42.33"	"32.78"	"32.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.953E-07"	"4.88"	"61.96"
"67965"	"False"	"High"	"[K].VLKQVHPDTGISSK.[A]"	"1xBiotin [K3]"	"9.33206E-05"	"0.000721313"	"2"	"13"	"23"	"Q64525; Q6ZWY9"	"Q64525 [45-58]; Q6ZWY9 [45-58]"	"Q64525 1xBiotin [K47]; Q6ZWY9 1xBiotin [K47]"	"1"	"1734.92072"	"0.023"	"0.719"	"3.77289611927905E-05"	"0.906515362333117"	"46.77"	"39.94"	"173.9"	"4.0"	"122.2"	"26.63"	"45.78"	"32.57"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.902E-06"	"3.66"	"33.21"
"67928"	"False"	"High"	"[K].VIHDNFGIVEGLMTTVHAITATQK.[T]"	"1xOxidation [M13]"	"3.76433E-08"	"0.000721313"	"1"	"1"	"50"	"P16858"	"P16858 [161-184]"	""	"0"	"2611.35485"	"708.173"	"50.264"	"0.558644691043429"	"0.0412650142443358"	"53.12"	"56.88"	"0.4"	"279.0"	"20.6"	"24.60"	"43.25"	"80.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.868E-09"	"6.79"	"58.05"
"67927"	"False"	"High"	"[K].VIHDNFGIVEGLMTTVHAITATQK.[T]"	""	"1.63426E-09"	"0.000721313"	"1"	"1"	"23"	"P16858"	"P16858 [161-184]"	""	"0"	"2595.35993"	"1.011"	"47.308"	"0.207566893511627"	"0.0412650142443358"	"69.60"	"54.70"	"6.9"	"6.7"	"286.3"	"28.86"	"191.37"	"55.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001058985"	"2.391759E-10"	"8.17"	"64.09"
"67886"	"False"	"High"	"[K].VIFVQGGGSGQFSAVPLNLIGLK.[A]"	""	"9.86696E-05"	"0.000721313"	"1"	"1"	"14"	"Q99K85"	"Q99K85 [72-94]"	""	"0"	"2301.29653"	"110.366"	"8.157"	"0.427089858136149"	"0.906515362333117"	"61.87"	"57.81"	"2.3"	"278.1"	"19.5"	"51.96"	"29.29"	"47.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.345E-06"	"4.59"	"62.28"
"67880"	"False"	"High"	"[R].VLFRPSDATNSSNLDALSSNTSLKLR.[K]"	"1xBiotin [K24]"	"4.62362E-07"	"0.000721313"	"1"	"1"	"16"	"Q8K273"	"Q8K273 [99-124]"	"Q8K273 1xBiotin [K122]"	"1"	"3032.54696"	"0.027"	"1.515"	"5.18589010487259E-05"	"0.954461348772941"	"54.92"	"17.50"	"121.0"	"3.2"	"175.8"	"9.79"	"44.54"	"29.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.428E-08"	"7.26"	"51.26"
"67877"	"False"	"High"	"[R].VIFPGTGYLCLVWK.[T]"	"1xCarbamidomethyl [C10]"	"0.000211348"	"0.000721313"	"1"	"1"	"16"	"P19096"	"P19096 [884-897]"	""	"0"	"1652.88690"	"116.028"	"6.632"	"0.469769759984371"	"0.906515362333117"	"56.84"	"39.29"	"2.5"	"280.5"	"17.1"	"42.90"	"37.04"	"20.80"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.949E-05"	"3.45"	"63.40"
"67775"	"False"	"High"	"[K].VIATKVLGTVK.[W]"	"1xBiotin [K5]"	"0.0011602"	"0.000721313"	"2"	"3"	"12"	"Q9JKB3-1; P62960"	"Q9JKB3-1 [78-88]; P62960 [52-62]"	"Q9JKB3-1 1xBiotin [K82]; P62960 1xBiotin [K56]"	"1"	"1354.81267"	"0.271"	"0.847"	"0.925138005747468"	"0.906515362333117"	"59.57"	"54.50"	"137.8"	"43.8"	"118.4"	"27.58"	"50.54"	"70.03"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.92E-05"	"2.56"	"45.60"
"66483"	"False"	"High"	"[K].VAKVEPAVSSIVNSIQVLASK.[S]"	"1xBiotin [K3]"	"0.00202522"	"0.000721313"	"1"	"12"	"3"	"Q99PL5-1"	"Q99PL5-1 [146-166]"	"Q99PL5-1 1xBiotin [K148]"	"1"	"2365.31594"	"1.216"	"1.259"	""	"0.906515362333117"	"44.32"	"54.33"	"92.7"	"110.7"	"96.6"	"50.15"	"17.33"	"28.88"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001681"	"4.20"	"66.47"
"67729"	"False"	"High"	"[R].VKVTEGQDPELVR.[H]"	"1xBiotin [K2]"	"0.000911316"	"0.000721313"	"1"	"1"	"13"	"Q8VBT6"	"Q8VBT6 [446-458]"	"Q8VBT6 1xBiotin [K447]"	"1"	"1695.87343"	"0.098"	"1.064"	"0.00714950913581087"	"0.906515362333117"	"24.84"	"21.03"	"138.7"	"13.7"	"147.6"	"14.73"	"38.67"	"15.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.888E-05"	"2.93"	"37.52"
"67708"	"False"	"High"	"[K].VKTVPLHLEEDIRPEMK.[E]"	"1xBiotin [K2]"	"2.82065E-06"	"0.000721313"	"1"	"1"	"39"	"P13516"	"P13516 [31-47]"	"P13516 1xBiotin [K32]"	"1"	"2260.18282"	"0.006"	"1.331"	"2.34907335128209E-06"	"0.998316466510713"	"87.62"	"40.06"	"126.7"	"0.7"	"172.5"	"31.18"	"63.56"	"24.78"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.076E-07"	"4.84"	"45.45"
"67599"	"False"	"High"	"[K].VKHMANQLLAK.[F]"	"1xBiotin [K2]; 1xOxidation [M4]"	"0.000284507"	"0.000721313"	"1"	"3"	"6"	"Q8BML1"	"Q8BML1 [713-723]"	"Q8BML1 1xBiotin [K714]"	"1"	"1494.79195"	"0.133"	"1.365"	"0.00491485755289604"	"0.933091578902049"	"95.70"	"89.31"	"159.7"	"18.0"	"122.3"	"66.70"	"43.09"	"55.18"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"2.594E-05"	"3.52"	"29.71"
"67598"	"False"	"High"	"[K].VKHMANQLLAK.[F]"	"1xBiotin [K2]"	"0.000105626"	"0.000721313"	"1"	"3"	"13"	"Q8BML1"	"Q8BML1 [713-723]"	"Q8BML1 1xBiotin [K714]"	"1"	"1478.79704"	"0.093"	"1.067"	"0.0013811740628445"	"0.916215054610739"	"68.54"	"73.39"	"137.9"	"16.4"	"145.7"	"59.01"	"40.65"	"63.60"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.988E-06"	"3.91"	"35.86"
"67569"	"False"	"High"	"[R].VKEVLPHVPLNVIQR.[D]"	"1xBiotin [K2]"	"9.98994E-05"	"0.000721313"	"1"	"1"	"13"	"P70295"	"P70295 [304-318]"	"P70295 1xBiotin [K305]"	"1"	"1967.12590"	"0.132"	"1.370"	"0.925138005747468"	"0.937945192250145"	"52.53"	"28.72"	"115.3"	"18.0"	"166.7"	"28.66"	"47.78"	"15.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.494E-06"	"2.65"	"49.80"
"67539"	"False"	"High"	"[K].VKCLNNLAASQLK.[L]"	"1xBiotin [K2]; 1xCarbamidomethyl [C3]"	"2.52623E-05"	"0.000721313"	"1"	"2"	"32"	"O35465-1"	"O35465-1 [262-274]"	"O35465-1 1xBiotin [K263]"	"1"	"1684.88731"	"0.016"	"0.706"	"1.97313108571211E-05"	"0.906515362333117"	"54.21"	"46.40"	"165.4"	"2.9"	"131.7"	"37.95"	"37.92"	"27.86"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.529E-06"	"3.76"	"43.58"
"67416"	"False"	"High"	"[K].VGYTPDWIFLLR.[N]"	""	"0.000220711"	"0.000721313"	"1"	"1"	"12"	"Q68FD5"	"Q68FD5 [508-519]"	""	"0"	"1479.79946"	"256.318"	"7.181"	"0.925138005747468"	"0.906515362333117"	"43.83"	"52.12"	"1.1"	"291.3"	"7.6"	"36.83"	"36.33"	"57.71"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.024E-05"	"3.42"	"64.31"
"67414"	"False"	"High"	"[R].VGWEQLLTTIAR.[T]"	""	"0.000288052"	"0.000721313"	"1"	"2"	"9"	"P57780"	"P57780 [735-746]"	""	"0"	"1386.77398"	"9.368"	"2.269"	"0.998769547666767"	"0.923750342545975"	"236.15"	"45.23"	"23.2"	"222.3"	"54.5"	"34.24"	"104.78"	"35.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.614E-05"	"2.47"	"62.47"
"67319"	"False"	"High"	"[K].VGLTNYAAAYCTGLLLAR.[R]"	"1xCarbamidomethyl [C11]"	"4.4384E-05"	"0.000721313"	"1"	"1"	"8"	"P47962"	"P47962 [90-107]"	""	"0"	"1927.01059"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"4.35E-06"	"4.16"	""
"67299"	"False"	"High"	"[R].VGKVEHGSVALPAIMR.[S]"	"1xBiotin [K3]; 1xOxidation [M15]"	"0.0010443"	"0.000721313"	"1"	"1"	"8"	"P26039"	"P26039 [439-454]"	"P26039 1xBiotin [K441]"	"1"	"1906.00373"	"0.277"	"0.855"	"0.925138005747468"	"0.906515362333117"	"62.37"	"57.60"	"136.3"	"43.3"	"120.4"	"52.79"	"44.53"	"32.02"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.993E-05"	"3.44"	"40.32"
"67298"	"False"	"High"	"[R].VGKVEHGSVALPAIMR.[S]"	"1xBiotin [K3]"	"0.000115908"	"0.000721313"	"1"	"1"	"11"	"P26039"	"P26039 [439-454]"	"P26039 1xBiotin [K441]"	"1"	"1890.00882"	"0.307"	"1.073"	"0.925138005747468"	"0.937945192250145"	"31.87"	"47.02"	"125.1"	"39.4"	"135.5"	"25.83"	"25.68"	"34.60"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.091E-05"	"4.46"	"45.49"
"67289"	"False"	"High"	"[R].VGKDNFWAK.[A]"	"1xBiotin [K3]"	"0.00151404"	"0.000721313"	"1"	"3"	"13"	"Q62418"	"Q62418 [174-182]"	"Q62418 1xBiotin [K176]"	"1"	"1290.62995"	"0.116"	"1.032"	"0.0161949594671225"	"0.906515362333117"	"29.94"	"24.66"	"142.5"	"16.4"	"141.1"	"19.65"	"34.22"	"22.78"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001278"	"2.96"	"44.64"
"67251"	"False"	"High"	"[R].VGDVQGQELESQLPTKIILTGQK.[T]"	"1xBiotin [K16]"	"0.00018329"	"0.000721313"	"1"	"2"	"12"	"Q8CDG3"	"Q8CDG3 [675-697]"	"Q8CDG3 1xBiotin [K690]"	"1"	"2707.43349"	"0.136"	"0.218"	"0.925138005747468"	"0.906515362333117"	"39.44"	"110.16"	"224.4"	"30.4"	"45.2"	"34.45"	"31.15"	"106.99"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.7E-05"	"4.50"	"55.81"
"67709"	"False"	"High"	"[K].VKTVPLHLEEDIRPEMK.[E]"	"1xBiotin [K2]; 1xOxidation [M16]"	"0.000378274"	"0.000721313"	"1"	"1"	"42"	"P13516"	"P13516 [31-47]"	"P13516 1xBiotin [K32]"	"1"	"2276.17774"	"0.005"	"0.825"	"1.80439751069628E-06"	"0.906515362333117"	"88.38"	"32.53"	"167.9"	"0.8"	"131.4"	"15.18"	"149.79"	"32.59"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.406E-05"	"3.47"	"42.69"
"66471"	"False"	"High"	"[K].VAHSDKPGSTSAVSFR.[D]"	"1xBiotin [K6]"	"1.95974E-05"	"0.000721313"	"1"	"1"	"27"	"Q9WV55"	"Q9WV55 [206-221]"	"Q9WV55 1xBiotin [K211]"	"0"	"1871.90686"	"0.080"	"0.850"	"0.000560817701602245"	"0.906515362333117"	"401.03"	"31.52"	"150.6"	"12.8"	"136.6"	"23.15"	"141.65"	"26.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.987E-06"	"4.99"	"34.44"
"66444"	"False"	"High"	"[R].VAGGSGSESPLLKGR.[R]"	"1xBiotin [K13]"	"4.04466E-05"	"0.000721313"	"1"	"2"	"14"	"Q9Z1X2-1"	"Q9Z1X2-1 [8-22]"	"Q9Z1X2-1 1xBiotin [K20]"	"1"	"1640.84247"	"0.135"	"0.855"	"0.0877671060542071"	"0.906515362333117"	"55.47"	"42.00"	"146.8"	"24.2"	"128.9"	"41.47"	"42.80"	"26.66"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.972E-06"	"4.52"	"38.76"
"66436"	"False"	"High"	"[K].VAFTGSTEVGHLIQVAAGSSNLK.[R]"	""	"0.000289842"	"0.000721313"	"1"	"1"	"6"	"P47738"	"P47738 [260-282]"	""	"0"	"2286.20884"	"1.610"	"1.987"	"0.925138005747468"	"0.972584510444091"	"64.08"	"63.97"	"75.9"	"102.6"	"121.5"	"47.22"	"214.96"	"54.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.637E-05"	"3.74"	"55.02"
"65145"	"False"	"High"	"[K].TPAQKAPAPK.[A]"	"1xBiotin [K5]"	"0.000458327"	"0.000721313"	"1"	"1"	"20"	"Q9CR57"	"Q9CR57 [202-211]"	"Q9CR57 1xBiotin [K206]"	"1"	"1234.66125"	"0.052"	"0.820"	"0.00506928978733612"	"0.906515362333117"	"68.74"	"48.83"	"152.5"	"9.2"	"138.3"	"37.37"	"54.06"	"32.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.096E-05"	"3.50"	"25.16"
"65112"	"False"	"High"	"[K].TNTLAAQSVIKK.[D]"	"1xBiotin [K11]"	"0.000129576"	"0.000721313"	"1"	"2"	"10"	"Q9CQ56"	"Q9CQ56 [196-207]"	"Q9CQ56 1xBiotin [K206]"	"1"	"1499.82502"	"0.139"	"0.886"	"0.00949190333671434"	"0.906515362333117"	"28.10"	"26.44"	"150.5"	"21.2"	"128.3"	"11.16"	"29.97"	"27.61"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.216E-05"	"3.46"	"37.92"
"65055"	"False"	"High"	"[R].TNLATGLPSSKVK.[Y]"	"1xBiotin [K11]"	"0.000104973"	"0.000721313"	"1"	"1"	"43"	"Q8CIB6"	"Q8CIB6 [6-18]"	"Q8CIB6 1xBiotin [K16]"	"1"	"1541.83559"	"0.056"	"1.348"	"0.000243386835361558"	"0.998099211977233"	"453.81"	"48.10"	"118.7"	"7.7"	"173.6"	"22.87"	"116.54"	"41.20"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.922E-06"	"3.87"	"40.20"
"65020"	"False"	"High"	"[R].TNAENEFVTIK.[K]"	""	"0.000334209"	"0.000721313"	"1"	"1"	"13"	"P04104"	"P04104 [286-296]"	""	"0"	"1265.63721"	"52.669"	"0.764"	"0.940224683987853"	"0.906515362333117"	"98.54"	"125.42"	"5.8"	"289.8"	"4.4"	"78.01"	"87.12"	"121.86"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"3.023E-05"	"3.21"	"35.51"
"64908"	"False"	"High"	"[K].TLVLSNLSYSATK.[E]"	""	"0.0012191"	"0.000721313"	"1"	"1"	"7"	"P09405"	"P09405 [488-500]"	""	"0"	"1396.76822"	"90.046"	"2.480"	"0.434853540501642"	"0.923750342545975"	"74.90"	"58.62"	"3.3"	"289.7"	"7.0"	"41.04"	"51.71"	"35.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001043"	"3.01"	"42.31"
"64883"	"False"	"High"	"[R].TLTLALVWQLMR.[R]"	"1xOxidation [M11]"	"5.65094E-05"	"0.000721313"	"1"	"1"	"25"	"Q61233"	"Q61233 [489-500]"	""	"0"	"1460.82938"	"236.687"	"6.465"	"0.925138005747468"	"0.906515362333117"	"104.17"	"102.72"	"1.4"	"289.6"	"9.0"	"97.88"	"105.44"	"77.62"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.497E-06"	"3.63"	"60.60"
"64882"	"False"	"High"	"[R].TLTLALVWQLMR.[R]"	""	"5.97485E-05"	"0.000721313"	"1"	"1"	"19"	"Q61233"	"Q61233 [489-500]"	""	"0"	"1444.83447"	"157.533"	"10.318"	"0.925138005747468"	"0.906515362333117"	"125.02"	"111.81"	"1.6"	"281.5"	"17.0"	"95.44"	"83.20"	"92.88"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.79E-06"	"3.61"	"67.50"
"64880"	"False"	"High"	"[K].TLTGKTITLEVEPSDTIENVK.[A]"	""	"0.000306454"	"0.000721313"	"1"	"4"	"1"	"P62984"	"P62984 [7-27]"	""	"1"	"2288.22315"	"2.076"	"1.568"	"0.367277538787618"	""	"65.25"	"56.17"	"67.3"	"120.2"	"112.5"	"42.90"	"239.07"	"26.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.773E-05"	"3.42"	"42.95"
"64728"	"False"	"High"	"[R].TINKAWVESR.[E]"	"1xBiotin [K4]"	"0.00214122"	"0.000721313"	"1"	"1"	"6"	"Q9CXW3"	"Q9CXW3 [210-219]"	"Q9CXW3 1xBiotin [K213]"	"1"	"1429.72564"	"0.397"	"0.987"	"0.925138005747468"	"0.906515362333117"	"92.26"	"61.63"	"127.5"	"50.5"	"122.0"	"69.81"	"32.06"	"29.94"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001775"	"2.70"	"43.51"
"64664"	"False"	"High"	"[R].TLLIKTVETR.[D]"	"1xBiotin [K5]"	"0.000761533"	"0.000721313"	"1"	"1"	"37"	"P20152"	"P20152 [441-450]"	"P20152 1xBiotin [K445]"	"1"	"1399.79775"	"0.569"	"0.807"	"0.0213737311917877"	"0.906515362333117"	"44.14"	"37.47"	"130.6"	"71.1"	"98.3"	"20.06"	"37.18"	"35.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.665E-05"	"3.08"	"46.99"
"64576"	"False"	"High"	"[K].TIHGSKSVDSGIYLDSSYK.[M]"	"1xBiotin [K6]"	"3.13381E-06"	"0.000721313"	"1"	"1"	"12"	"P70677"	"P70677 [20-38]"	"P70677 1xBiotin [K25]"	"1"	"2283.09617"	"0.143"	"0.711"	"0.0456018622152403"	"0.906515362333117"	"39.22"	"49.23"	"162.3"	"22.3"	"115.4"	"28.81"	"19.49"	"53.28"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.417E-07"	"6.11"	"41.50"
"64540"	"False"	"High"	"[K].TIGGGDDSFNTFFSETGAGKHVPR.[A]"	"1xBiotin [K20]"	"5.4719E-06"	"0.000721313"	"1"	"4"	"12"	"P05213"	"P05213 [41-64]"	"P05213 1xBiotin [K60]"	"1"	"2723.25184"	"0.198"	"1.606"	"0.925138005747468"	"0.954044461176668"	"48.39"	"33.70"	"109.9"	"22.4"	"167.7"	"20.25"	"42.55"	"26.69"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.807E-07"	"4.11"	"52.48"
"65261"	"False"	"High"	"[K].TPLQVAKGGLGLILK.[R]"	"1xBiotin [K7]"	"6.54843E-06"	"0.000721313"	"1"	"1"	"27"	"Q9Z2X2"	"Q9Z2X2 [207-221]"	"Q9Z2X2 1xBiotin [K213]"	"1"	"1734.03462"	"0.218"	"1.465"	"0.925138005747468"	"0.96247554139247"	"91.14"	"50.37"	"122.8"	"19.0"	"158.2"	"47.38"	"56.54"	"31.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.919E-07"	"4.02"	"63.49"
"64535"	"False"	"High"	"[K].TLGAGAFGKVVEATAFGLGK.[E]"	"1xBiotin [K9]"	"8.66368E-05"	"0.000721313"	"1"	"1"	"17"	"P09581"	"P09581 [585-604]"	"P09581 1xBiotin [K593]"	"1"	"2120.12087"	"0.713"	"5.424"	"0.925138005747468"	"0.906515362333117"	"70.13"	"77.74"	"40.0"	"33.8"	"226.2"	"81.15"	"29.37"	"64.50"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.249E-06"	"4.65"	"64.28"
"64447"	"False"	"High"	"[K].TLAGMGLQPGNISPTSKLISR.[S]"	"1xBiotin [K17]; 1xOxidation [M5]"	"4.03469E-07"	"0.000721313"	"1"	"1"	"35"	"P23298"	"P23298 [305-325]"	"P23298 1xBiotin [K321]"	"1"	"2383.24721"	"0.026"	"0.781"	"4.70874917181922E-05"	"0.906515362333117"	"29.05"	"43.16"	"173.4"	"4.5"	"122.0"	"33.30"	"23.79"	"19.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.748E-08"	"5.73"	"49.61"
"64446"	"False"	"High"	"[K].TLAGMGLQPGNISPTSKLISR.[S]"	"1xBiotin [K17]"	"1.27667E-06"	"0.000721313"	"1"	"1"	"16"	"P23298"	"P23298 [305-325]"	"P23298 1xBiotin [K321]"	"1"	"2367.25230"	"0.014"	"1.401"	"1.51548195882678E-05"	"0.983025330649738"	"61.25"	"36.38"	"127.8"	"1.4"	"170.9"	"30.30"	"55.95"	"26.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.434E-07"	"5.95"	"53.60"
"64437"	"False"	"High"	"[K].TLAESALQLLYTAK.[E]"	""	"0.00010052"	"0.000721313"	"1"	"1"	"9"	"P26039"	"P26039 [1767-1780]"	""	"0"	"1521.85229"	"47.308"	"1.758"	"0.925138005747468"	"0.936238272383155"	"52.58"	"56.12"	"7.6"	"281.4"	"11.0"	"37.60"	"43.38"	"45.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"9.531E-06"	"3.92"	"60.28"
"64430"	"False"	"High"	"[R].TLAAKVELVDIQR.[E]"	"1xBiotin [K5]"	"1.76391E-05"	"0.000721313"	"1"	"1"	"29"	"Q9JID9"	"Q9JID9 [177-189]"	"Q9JID9 1xBiotin [K181]"	"1"	"1681.93055"	"0.088"	"1.115"	"0.00954375355120574"	"0.906515362333117"	"58.74"	"17.26"	"135.0"	"12.3"	"152.7"	"11.66"	"54.27"	"15.66"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.787E-06"	"4.03"	"54.45"
"64399"	"False"	"High"	"[R].TKSFLNYYADLETSAR.[E]"	"1xBiotin [K2]"	"0.000217994"	"0.000721313"	"1"	"3"	"9"	"Q9DBR4-1"	"Q9DBR4-1 [158-173]"	"Q9DBR4-1 1xBiotin [K159]"	"1"	"2105.00082"	"0.621"	"0.595"	"0.925138005747468"	"0.906515362333117"	"44.75"	"81.34"	"125.6"	"83.4"	"91.0"	"109.12"	"37.00"	"58.35"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.006E-05"	"3.95"	"57.92"
"64396"	"False"	"High"	"[R].TKSDASCIIQR.[R]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"0.000867277"	"0.000721313"	"1"	"3"	"8"	"Q8CB96"	"Q8CB96 [140-150]"	"Q8CB96 1xBiotin [K141]"	"1"	"1504.72466"	"26.778"	"0.464"	"0.925138005747468"	"0.906515362333117"	"61.85"	"71.41"	"11.8"	"281.1"	"7.1"	"47.62"	"42.79"	"51.98"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.521E-05"	"2.13"	"34.51"
"64373"	"False"	"High"	"[R].TKPDYFAVGYYGQGFPSFLR.[N]"	""	"0.00193936"	"0.000721313"	"1"	"1"	"3"	"Q8C3J5"	"Q8C3J5 [1337-1356]"	""	"0"	"2313.13388"	"111.265"	"4.587"	"0.925138005747468"	"0.906515362333117"	"74.60"	"75.61"	"2.2"	"287.5"	"10.2"	"57.89"	"44.11"	"66.56"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001611"	"4.47"	"57.77"
"64353"	"False"	"High"	"[R].TKLLNGPDVETGTSTAIPQKK.[W]"	"1xBiotin [K2]"	"7.37519E-05"	"0.000721313"	"1"	"1"	"6"	"P52875"	"P52875 [207-227]"	"P52875 1xBiotin [K208]"	"2"	"2424.28029"	"0.485"	"1.054"	"0.934305189957301"	"0.924306229746472"	"87.48"	"98.78"	"111.2"	"65.5"	"123.3"	"79.99"	"31.90"	"54.89"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.099E-06"	"4.10"	"39.95"
"64339"	"False"	"High"	"[K].TKHSVESMITTLDPGMAPYIK.[S]"	"1xBiotin [K2]; 2xOxidation [M8; M16]"	"0.000702637"	"0.000721313"	"1"	"1"	"6"	"Q3UPH1"	"Q3UPH1 [231-251]"	"Q3UPH1 1xBiotin [K232]"	"1"	"2577.23974"	"0.565"	"2.144"	"0.925138005747468"	"0.906515362333117"	"96.14"	"111.96"	"72.6"	"47.3"	"180.1"	"99.06"	"49.86"	"100.45"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"6.167E-05"	"4.71"	"45.96"
"64338"	"False"	"High"	"[K].TKHSVESMITTLDPGMAPYIK.[S]"	"1xBiotin [K2]; 1xOxidation [M]"	"0.000535067"	"0.000721313"	"1"	"1"	"10"	"Q3UPH1"	"Q3UPH1 [231-251]"	"Q3UPH1 1xBiotin [K232]"	"1"	"2561.24483"	"0.995"	"11.933"	""	"0.906515362333117"	"63.09"	"61.01"	"22.4"	"24.1"	"253.5"	"38.99"	"42.92"	"57.41"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.739E-05"	"4.66"	"53.57"
"64337"	"False"	"High"	"[K].TKHSVESMITTLDPGMAPYIK.[S]"	"1xBiotin [K2]"	"8.03331E-06"	"0.000721313"	"1"	"1"	"6"	"Q3UPH1"	"Q3UPH1 [231-251]"	"Q3UPH1 1xBiotin [K232]"	"1"	"2545.24991"	"0.820"	"5.335"	""	"0.906515362333117"	"58.70"	"85.90"	"34.6"	"35.0"	"230.4"	"39.22"	"43.82"	"52.48"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.439E-07"	"5.36"	"59.04"
"64291"	"False"	"High"	"[R].TKDDIIICEIGEVFK.[A]"	"1xBiotin [K2]; 1xCarbamidomethyl [C8]"	"3.7783E-05"	"0.000721313"	"1"	"1"	"6"	"Q8BGH2"	"Q8BGH2 [58-72]"	"Q8BGH2 1xBiotin [K59]"	"1"	"2005.99731"	"1.207"	"3.373"	""	"0.906515362333117"	"31.66"	"34.20"	"52.8"	"65.5"	"181.7"	"29.77"	"35.72"	"30.19"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.732E-06"	"3.49"	"66.50"
"64527"	"False"	"High"	"[R].TLFSNIVLSGGSTLFK.[G]"	""	"0.000525219"	"0.000721313"	"1"	"2"	"13"	"P61164"	"P61164 [293-308]"	""	"0"	"1683.93160"	"78.059"	"3.206"	"0.624680760389159"	"0.906515362333117"	"53.71"	"68.85"	"3.7"	"288.2"	"8.1"	"44.58"	"42.88"	"57.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.658E-05"	"3.89"	"62.48"
"68287"	"False"	"High"	"[R].VISHYAGQDATDPFVAFHINKGLVR.[K]"	"1xBiotin [K21]"	"5.64399E-06"	"0.000721313"	"1"	"1"	"3"	"Q920L1"	"Q920L1 [61-85]"	"Q920L1 1xBiotin [K81]"	"1"	"2981.50906"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"5.985E-07"	"4.19"	""
"65364"	"False"	"High"	"[K].TPTGPDLDTSYKGYMK.[L]"	"1xBiotin [K12]"	"0.000277546"	"0.000721313"	"1"	"4"	"6"	"Q6ZWR6-1"	"Q6ZWR6-1 [8363-8378]"	"Q6ZWR6-1 1xBiotin [K8374]"	"1"	"1999.91398"	"0.620"	"0.539"	"0.929016530787821"	"0.906515362333117"	"82.82"	"82.89"	"136.0"	"91.9"	"72.1"	"72.35"	"45.66"	"82.86"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"2.528E-05"	"3.68"	"45.67"
"65489"	"False"	"High"	"[K].TQQLLHPVDWNFAQEEAKGSR.[Q]"	"1xBiotin [K18]"	"3.59567E-05"	"0.000721313"	"1"	"1"	"4"	"Q9QUK3"	"Q9QUK3 [254-274]"	"Q9QUK3 1xBiotin [K271]"	"1"	"2680.29364"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.55E-06"	"5.74"	""
"66392"	"False"	"High"	"[K].VACIGAWHPAR.[V]"	"1xCarbamidomethyl [C3]"	"0.000464039"	"0.000721313"	"1"	"1"	"13"	"P27659"	"P27659 [251-261]"	""	"0"	"1237.62587"	"123.868"	"3.502"	"0.926317884229189"	"0.906515362333117"	"60.26"	"64.49"	"2.7"	"287.6"	"9.7"	"62.70"	"37.38"	"34.52"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.148E-05"	"3.16"	"30.70"
"66384"	"False"	"High"	"[R].VAASGSPGKSSTHASVSPASEPSR.[M]"	"1xBiotin [K9]"	"7.46711E-05"	"0.000721313"	"1"	"2"	"16"	"Q3UPF5-1"	"Q3UPF5-1 [548-571]"	"Q3UPF5-1 1xBiotin [K556]"	"1"	"2480.18342"	"0.101"	"0.909"	"0.00572026790853718"	"0.906515362333117"	"45.94"	"44.38"	"151.1"	"14.9"	"134.0"	"11.81"	"37.46"	"30.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.171E-06"	"3.59"	"27.20"
"66346"	"False"	"High"	"[K].TYSECEDGTYSPEISWHHGKGSK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C5]"	"0.0002437"	"0.000721313"	"1"	"1"	"17"	"Q99LH2"	"Q99LH2 [415-437]"	"Q99LH2 1xBiotin [K]"	"1"	"2881.21922"	"0.156"	"1.179"	"0.492402657881146"	"0.906515362333117"	"34.54"	"78.02"	"116.1"	"19.2"	"164.7"	"38.60"	"15.89"	"60.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.23E-05"	"3.90"	"37.46"
"66333"	"False"	"High"	"[K].TYKNAWADNANACAK.[Q]"	"1xBiotin [K3]; 1xCarbamidomethyl [C13]"	"0.000185574"	"0.000721313"	"1"	"1"	"8"	"Q9EP69"	"Q9EP69 [433-447]"	"Q9EP69 1xBiotin [K435]"	"1"	"1923.84763"	"0.325"	"0.470"	"0.925138005747468"	"0.906515362333117"	"72.96"	"87.84"	"166.7"	"60.7"	"72.6"	"54.18"	"50.29"	"65.76"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.714E-05"	"2.99"	"38.56"
"66320"	"False"	"High"	"[K].TYGEPESVGMSKSFR.[Q]"	"1xBiotin [K12]; 1xOxidation [M10]"	"3.39655E-06"	"0.000721313"	"1"	"1"	"72"	"O08579"	"O08579 [105-119]"	"O08579 1xBiotin [K116]"	"1"	"1916.85171"	"0.007"	"1.005"	"3.34465522240183E-06"	"0.916215054610739"	"32.55"	"40.87"	"149.2"	"1.0"	"149.8"	"8.30"	"40.83"	"35.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.676E-07"	"3.53"	"39.19"
"66319"	"False"	"High"	"[K].TYGEPESVGMSKSFR.[Q]"	"1xBiotin [K12]"	"2.03142E-06"	"0.000721313"	"1"	"1"	"36"	"O08579"	"O08579 [105-119]"	"O08579 1xBiotin [K116]"	"1"	"1900.85679"	"0.010"	"0.974"	"9.24583087648604E-06"	"0.913391459617641"	"63.99"	"28.55"	"153.8"	"1.6"	"144.6"	"25.12"	"215.98"	"15.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.253E-07"	"3.83"	"43.37"
"66315"	"False"	"High"	"[K].TYFFQLWYNQEYAR.[F]"	""	"9.44836E-05"	"0.000721313"	"1"	"2"	"11"	"P13864"	"P13864 [866-879]"	""	"0"	"1928.89661"	"106.926"	"2.201"	"0.430383505746853"	"0.948559167397718"	"70.89"	"82.46"	"2.7"	"291.4"	"5.9"	"44.64"	"57.25"	"61.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.972E-06"	"3.85"	"61.17"
"66269"	"False"	"High"	"[R].TVYSVFGFSFK.[L]"	""	"0.000963538"	"0.000721313"	"1"	"1"	"12"	"Q9D0R2"	"Q9D0R2 [484-494]"	""	"0"	"1281.65140"	"128.578"	"3.600"	"0.932172616415912"	"0.906515362333117"	"40.07"	"47.80"	"2.3"	"290.9"	"6.7"	"35.67"	"22.11"	"37.52"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"8.325E-05"	"2.99"	"58.60"
"66267"	"False"	"High"	"[K].TVYLQSALSSSSSAEKFPSPHPSPAK.[L]"	"1xBiotin [K16]"	"0.00101246"	"0.000721313"	"1"	"1"	"2"	"Q61070"	"Q61070 [308-333]"	"Q61070 1xBiotin [K323]"	"1"	"2929.44003"	"0.746"	"1.088"	"0.925158317651619"	"0.906515362333117"	"83.37"	"87.54"	"92.9"	"81.7"	"125.3"	"69.68"	"61.25"	"39.54"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"8.703E-05"	"3.53"	"46.13"
"66238"	"False"	"High"	"[K].TVTKGPAVNGEQPLKV.[-]"	"1xBiotin [K4]"	"0.00078063"	"0.000721313"	"1"	"2"	"21"	"Q9DCC3-1"	"Q9DCC3-1 [227-242]"	"Q9DCC3-1 1xBiotin [K230]"	"2"	"1863.99969"	"0.040"	"0.623"	"0.00188051652282846"	"0.906515362333117"	"39.18"	"41.89"	"178.2"	"6.9"	"114.9"	"30.26"	"59.46"	"43.73"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.822E-05"	"2.83"	"41.99"
"66180"	"False"	"High"	"[K].TVPKPIALEPCFGNKAAVLSVFVR.[L]"	"1xBiotin [K15]; 1xCarbamidomethyl [C11]"	"6.78794E-07"	"0.000721313"	"1"	"1"	"12"	"Q9WU60"	"Q9WU60 [1350-1373]"	"Q9WU60 1xBiotin [K1364]"	"1"	"2839.53612"	"0.663"	"26.473"	"0.928461841781804"	"0.213226184944796"	"57.00"	"48.81"	"10.6"	"8.0"	"281.4"	"49.56"	"41.38"	"35.52"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.851E-08"	"6.21"	"64.16"
"66179"	"False"	"High"	"[K].TVPKPIALEPCFGNK.[A]"	"1xBiotin [K4]; 1xCarbamidomethyl [C11]"	"0.00137978"	"0.000721313"	"1"	"1"	"20"	"Q9WU60"	"Q9WU60 [1350-1364]"	"Q9WU60 1xBiotin [K1353]"	"0"	"1896.97104"	"0.063"	"0.714"	"0.00210926933735622"	"0.906515362333117"	"57.33"	"23.57"	"164.5"	"11.2"	"124.2"	"16.08"	"49.20"	"20.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001173"	"2.02"	"50.70"
"65415"	"False"	"High"	"[R].TQCNSLAPVSKSSLGR.[S]"	"1xBiotin [K11]; 1xCarbamidomethyl [C3]"	"0.000664552"	"0.000721313"	"1"	"1"	"6"	"Q7TPN9"	"Q7TPN9 [344-359]"	"Q7TPN9 1xBiotin [K354]"	"1"	"1930.94734"	"0.678"	"1.113"	"0.945458315571006"	"0.937945192250145"	"79.17"	"39.77"	"107.2"	"84.8"	"108.1"	"67.29"	"39.30"	"72.64"	""	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"5.822E-05"	"3.67"	"40.94"
"66176"	"False"	"High"	"[R].TVPFCSTFAAFFTR.[A]"	"1xCarbamidomethyl [C5]"	"0.000395031"	"0.000721313"	"1"	"1"	"24"	"P40142"	"P40142 [382-395]"	""	"0"	"1651.79372"	"174.236"	"6.359"	"0.925138005747468"	"0.906515362333117"	"44.04"	"55.52"	"1.6"	"288.1"	"10.3"	"43.68"	"20.74"	"38.48"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.557E-05"	"2.45"	"63.06"
"65955"	"False"	"High"	"[K].TTPLLSPVKAVPLGGSDGLK.[AD]"	"1xBiotin [K9]"	"0.00129696"	"0.000721313"	"1"	"4"	"29"	"Q6P1H6-1"	"Q6P1H6-1 [270-289]"	"Q6P1H6-1 1xBiotin [K278]"	"1"	"2176.20460"	"0.030"	"0.736"	"7.64506547934583E-05"	"0.906515362333117"	"24.55"	"36.14"	"174.2"	"5.2"	"120.7"	"21.76"	"16.73"	"26.33"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001103"	"2.94"	"54.88"
"65951"	"False"	"High"	"[K].TTPDVIFVFGFR.[T]"	""	"0.00111789"	"0.000721313"	"1"	"3"	"13"	"P62849-1"	"P62849-1 [50-61]"	""	"0"	"1398.74161"	"164.463"	"3.784"	"0.925138005747468"	"0.906515362333117"	"76.97"	"107.71"	"1.5"	"292.1"	"6.5"	"67.66"	"42.66"	"69.28"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.597E-05"	"2.97"	"61.77"
"65911"	"False"	"High"	"[K].TTKESLAQTSSSITESLMGISR.[M]"	"1xBiotin [K3]"	"9.14906E-06"	"0.000721313"	"1"	"1"	"9"	"Q6QD59"	"Q6QD59 [126-147]"	"Q6QD59 1xBiotin [K128]"	"1"	"2553.25348"	"0.736"	"1.644"	"0.927310003527173"	"0.974397579791771"	"76.13"	"107.25"	"81.2"	"60.4"	"158.4"	"77.01"	"49.91"	"79.83"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.546E-07"	"5.27"	"61.47"
"65910"	"False"	"High"	"[R].TTKDGWVYYANHTEEK.[T]"	"1xBiotin [K3]"	"6.79634E-06"	"0.000721313"	"1"	"4"	"44"	"Q91WL8"	"Q91WL8 [26-41]"	"Q91WL8 1xBiotin [K28]"	"1"	"2167.97533"	"0.012"	"0.785"	"1.00116880024954E-05"	"0.906515362333117"	"50.07"	"45.48"	"163.7"	"2.3"	"134.0"	"28.47"	"44.97"	"33.96"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.171E-07"	"4.39"	"42.36"
"65905"	"False"	"High"	"[R].TTGIVMDSGDGVTHTVPIYEGYALPHAILR.[L]"	"1xOxidation [M6]"	"0.000656373"	"0.000721313"	"1"	"3"	"6"	"P60710"	"P60710 [148-177]"	""	"0"	"3199.60922"	"9.265"	"1.333"	"0.925138005747468"	"0.906515362333117"	"240.47"	"70.74"	"26.5"	"235.2"	"38.3"	"44.77"	"132.17"	"60.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"5.766E-05"	"3.23"	"50.38"
"65904"	"False"	"High"	"[R].TTGIVMDSGDGVTHTVPIYEGYALPHAILR.[L]"	""	"0.000324019"	"0.000721313"	"1"	"3"	"2"	"P60710"	"P60710 [148-177]"	""	"0"	"3183.61431"	"0.664"	"2.196"	""	"0.983025330649738"	"63.21"	"67.42"	"86.9"	"51.8"	"161.2"	"40.98"	"48.09"	"53.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"2.94E-05"	"4.14"	"52.41"
"65807"	"False"	"High"	"[K].TSSLVLEKCSLSALVSK.[E]"	"1xBiotin [K8]; 1xCarbamidomethyl [C9]"	"0.000594462"	"0.000721313"	"1"	"1"	"4"	"Q6ZPJ0"	"Q6ZPJ0 [395-411]"	"Q6ZPJ0 1xBiotin [K402]"	"1"	"2048.07662"	"1.112"	"0.927"	"0.925138005747468"	"0.906515362333117"	"36.82"	"35.09"	"101.5"	"102.9"	"95.6"	"31.07"	"20.12"	"23.43"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"5.247E-05"	"3.29"	"58.20"
"65768"	"False"	"High"	"[K].TSPKTSNPFLVAIHDSEADYVTTDNLSK.[V]"	"1xBiotin [K4]"	"3.89713E-05"	"0.000721313"	"1"	"2"	"9"	"Q99P72-2"	"Q99P72-2 [488-515]"	"Q99P72-2 1xBiotin [K491]"	"1"	"3276.57290"	"0.348"	"9.678"	"0.925138005747468"	"0.906515362333117"	"71.02"	"72.98"	"31.8"	"14.9"	"253.3"	"65.27"	"29.67"	"33.23"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.835E-06"	"4.53"	"58.67"
"65763"	"False"	"High"	"[K].TSPEFSQPLKK.[V]"	"1xBiotin [K10]"	"0.000963538"	"0.000721313"	"1"	"1"	"27"	"Q8VBT0"	"Q8VBT0 [222-232]"	"Q8VBT0 1xBiotin [K231]"	"1"	"1487.75628"	"0.048"	"0.764"	"0.000167077281852403"	"0.906515362333117"	"305.44"	"34.47"	"159.6"	"8.8"	"131.5"	"32.48"	"115.53"	"15.85"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.323E-05"	"3.12"	"38.65"
"65725"	"False"	"High"	"[K].TSLFSPKLSTPNVSSPFGTPFGSSVVNR.[M]"	"1xBiotin [K7]"	"1.93084E-07"	"0.000721313"	"1"	"1"	"21"	"Q8VCB1"	"Q8VCB1 [430-457]"	"Q8VCB1 1xBiotin [K436]"	"1"	"3136.57720"	"0.042"	"4.132"	"0.00124163632836457"	"0.906515362333117"	"52.25"	"45.81"	"51.8"	"2.8"	"245.4"	"39.56"	"34.65"	"21.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.34E-08"	"7.64"	"61.36"
"65678"	"False"	"High"	"[K].TSFFQALGITTK.[I]"	""	"0.000366741"	"0.000721313"	"1"	"1"	"21"	"P14869"	"P14869 [135-146]"	""	"0"	"1313.70998"	"217.228"	"5.386"	"0.925138005747468"	"0.906515362333117"	"77.05"	"72.45"	"1.3"	"290.4"	"8.3"	"63.51"	"28.40"	"29.22"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.31E-05"	"3.29"	"56.01"
"65644"	"False"	"High"	"[K].TSDKNTYFPLDVPAK.[G]"	"1xBiotin [K4]"	"0.00136281"	"0.000721313"	"1"	"1"	"6"	"Q8CJF7"	"Q8CJF7 [1277-1291]"	"Q8CJF7 1xBiotin [K1280]"	"1"	"1921.93643"	"0.207"	"0.907"	"0.925138005747468"	"0.906515362333117"	"53.01"	"58.38"	"148.8"	"30.8"	"120.5"	"35.06"	"37.80"	"42.78"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.000116"	"2.78"	"49.91"
"66007"	"False"	"High"	"[K].TTVSGPSHSYQGSQDLSKLTQR.[R]"	"1xBiotin [K18]"	"1.8535E-05"	"0.000721313"	"1"	"2"	"11"	"Q5SS80-1"	"Q5SS80-1 [345-366]"	"Q5SS80-1 1xBiotin [K362]"	"1"	"2603.25184"	"0.757"	"0.769"	"0.925158317651619"	"0.906515362333117"	"38.23"	"92.33"	"124.7"	"95.4"	"79.8"	"40.91"	"22.72"	"68.85"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.879E-06"	"5.54"	"39.69"
"68328"	"False"	"High"	"[K].VLTKEAEEK.[L]"	"1xBiotin [K4]"	"0.00202522"	"0.000721313"	"1"	"2"	"12"	"Q99P72-2"	"Q99P72-2 [942-950]"	"Q99P72-2 1xBiotin [K945]"	"1"	"1272.65041"	"0.048"	"0.844"	"0.000100121628068498"	"0.906515362333117"	"40.32"	"30.53"	"165.7"	"7.6"	"126.7"	"19.68"	"38.62"	"22.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000168"	"2.85"	"30.60"
"68393"	"False"	"High"	"[K].VLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHR.[S]"	""	"0.000993832"	"0.000721313"	"1"	"1"	"2"	"P35550"	"P35550 [169-201]"	""	"0"	"3416.74849"	"0.597"	"1.274"	""	"0.906515362333117"	"45.92"	"51.99"	"107.3"	"58.3"	"134.4"	"24.70"	"40.41"	"42.64"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"8.589E-05"	"4.14"	"59.29"
"68504"	"False"	"High"	"[R].VMVGVIILYDHVHPVGAFAK.[T]"	"1xOxidation [M2]"	"0.000137003"	"0.000721313"	"1"	"1"	"1"	"Q921M7"	"Q921M7 [256-275]"	""	"0"	"2181.18889"	"0.829"	"1.211"	"0.975052343286225"	""	"54.90"	"41.70"	"96.2"	"82.3"	"121.6"	"54.57"	"238.47"	"31.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.287E-05"	"3.22"	"51.43"
"71773"	"False"	"High"	"[K].YLFIFSVANMR.[N]"	"1xOxidation [M10]"	"0.00166134"	"0.000721313"	"1"	"1"	"20"	"Q9D0I8"	"Q9D0I8 [39-49]"	""	"0"	"1376.70312"	"203.080"	"2.863"	"0.925138005747468"	"0.906515362333117"	"87.37"	"75.18"	"1.2"	"296.1"	"2.7"	"67.13"	"67.30"	"43.84"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001398"	"2.41"	"57.15"
"71772"	"False"	"High"	"[K].YLFIFSVANMR.[N]"	""	"0.000771022"	"0.000721313"	"1"	"1"	"18"	"Q9D0I8"	"Q9D0I8 [39-49]"	""	"0"	"1360.70820"	"40.861"	"3.016"	"0.68239459813538"	"0.906515362333117"	"82.43"	"99.26"	"6.7"	"272.6"	"20.7"	"52.04"	"92.57"	"66.97"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.747E-05"	"3.14"	"61.65"
"71717"	"False"	"High"	"[K].YLAKHSSIFDQLDVVSYEEVVR.[L]"	"1xBiotin [K4]"	"2.87E-07"	"0.000721313"	"1"	"1"	"8"	"P70290"	"P70290 [255-276]"	"P70290 1xBiotin [K258]"	"1"	"2823.40219"	"1.085"	"18.259"	"0.925138005747468"	"0.906515362333117"	"61.54"	"64.55"	"15.5"	"15.9"	"268.7"	"53.51"	"42.08"	"20.03"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.425E-08"	"6.66"	"59.22"
"71705"	"False"	"High"	"[K].YKRPGYGAYDAFK.[H]"	""	"0.00113182"	"0.000721313"	"1"	"1"	"4"	"Q6ZWX6"	"Q6ZWX6 [142-154]"	""	"1"	"1535.76414"	"177.107"	"3.540"	"0.925138005747468"	"0.906515362333117"	"48.59"	"47.43"	"1.5"	"292.1"	"6.4"	"37.75"	"37.81"	"39.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"9.684E-05"	"3.42"	"29.72"
"71667"	"False"	"High"	"[K].YKEVGIHLNYKEDSCVR.[L]"	"2xBiotin [K2; K11]; 1xCarbamidomethyl [C15]"	"1.81938E-05"	"0.000721313"	"1"	"2"	"16"	"Q64735-1"	"Q64735-1 [441-457]"	"Q64735-1 2xBiotin [K442; K451]"	"2"	"2562.19380"	"0.072"	"1.284"	"0.00338850492409696"	"0.969054191468458"	"47.78"	"35.29"	"134.7"	"10.4"	"154.9"	"40.28"	"31.06"	"22.70"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.843E-06"	"4.40"	"47.60"
"71666"	"False"	"High"	"[K].YKEVGIHLNYK.[E]"	"1xBiotin [K2]"	"2.52623E-05"	"0.000721313"	"1"	"2"	"33"	"Q64735-1"	"Q64735-1 [441-451]"	"Q64735-1 1xBiotin [K442]"	"1"	"1589.81446"	"0.007"	"0.813"	"3.88278458712235E-06"	"0.906515362333117"	"52.43"	"37.25"	"161.3"	"1.2"	"137.6"	"26.33"	"46.09"	"33.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.525E-06"	"4.84"	"41.46"
"71655"	"False"	"High"	"[K].YKDNPFSLGETFGSR.[W]"	"1xBiotin [K2]"	"1.00273E-06"	"0.000721313"	"1"	"2"	"43"	"Q99K28"	"Q99K28 [357-371]"	"Q99K28 1xBiotin [K358]"	"1"	"1943.89562"	"0.028"	"1.878"	"5.34078846841602E-05"	"0.906777072223237"	"39.81"	"78.26"	"96.6"	"2.8"	"200.6"	"28.53"	"10.05"	"54.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.142E-07"	"4.24"	"54.57"
"71558"	"False"	"High"	"[K].YGTQNKYTGLSK.[G]"	"1xBiotin [K6]"	"8.34766E-05"	"0.000721313"	"1"	"1"	"14"	"P03975"	"P03975 [56-67]"	"P03975 1xBiotin [K61]"	"1"	"1585.76790"	"0.063"	"0.715"	"0.00291896125041642"	"0.906515362333117"	"53.47"	"28.96"	"163.1"	"11.2"	"125.7"	"21.36"	"44.43"	"21.55"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.969E-06"	"3.83"	"36.43"
"71527"	"False"	"High"	"[R].YGPVVSFWFGR.[R]"	""	"0.00188027"	"0.000721313"	"1"	"1"	"11"	"Q8BKE6"	"Q8BKE6 [65-75]"	""	"0"	"1314.66297"	"104.221"	"2.619"	"0.486690115660178"	"0.916215054610739"	"49.97"	"38.54"	"2.9"	"289.5"	"7.7"	"29.98"	"34.92"	"48.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001565"	"2.31"	"59.00"
"71520"	"False"	"High"	"[K].YGPKGYGYGQGAGTLSTDKGESLGIK.[H]"	"1xBiotin [K4]"	"2.73127E-07"	"0.000721313"	"1"	"1"	"12"	"P97315"	"P97315 [66-91]"	"P97315 1xBiotin [K69]"	"2"	"2830.37162"	"0.067"	"0.670"	"0.00377588650983478"	"0.906515362333117"	"50.05"	"41.12"	"165.5"	"14.6"	"119.9"	"37.92"	"37.45"	"27.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.262E-08"	"4.95"	"42.78"
"71487"	"False"	"High"	"[K].YGLIFHSTFIGR.[A]"	""	"3.48604E-05"	"0.000721313"	"1"	"1"	"29"	"Q9D6Z1"	"Q9D6Z1 [348-359]"	""	"0"	"1410.75285"	"109.013"	"2.747"	"0.929016530787821"	"0.906515362333117"	"64.83"	"43.98"	"2.7"	"290.9"	"6.4"	"32.64"	"50.84"	"28.87"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.445E-06"	"3.02"	"47.44"
"71483"	"False"	"High"	"[K].YGLFKEQNPYEKF.[-]"	"1xBiotin [K5]"	"1.4114E-05"	"0.000721313"	"1"	"1"	"23"	"Q8R143"	"Q8R143 [162-174]"	"Q8R143 1xBiotin [K166]"	"2"	"1888.89383"	"55.699"	"2.093"	"0.947989303413716"	"0.906515362333117"	"85.40"	"40.05"	"4.9"	"284.6"	"10.5"	"31.31"	"76.03"	"30.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.447E-06"	"3.99"	"53.15"
"71778"	"False"	"High"	"[R].YIFTMLSPLAR.[L]"	""	"0.00200031"	"0.000721313"	"1"	"1"	"9"	"Q01320"	"Q01320 [804-814]"	""	"0"	"1311.71296"	"10.375"	"3.322"	"0.925138005747468"	"0.906515362333117"	"151.37"	"66.55"	"26.9"	"192.1"	"81.0"	"56.45"	"131.03"	"46.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001661"	"2.47"	"57.49"
"71482"	"False"	"High"	"[K].YGLFKEQNPYEK.[F]"	"1xBiotin [K5]"	"2.51063E-05"	"0.000721313"	"1"	"1"	"28"	"Q8R143"	"Q8R143 [162-173]"	"Q8R143 1xBiotin [K166]"	"1"	"1741.82542"	"0.024"	"0.692"	"3.97676679121269E-05"	"0.906515362333117"	"42.68"	"33.95"	"173.0"	"4.4"	"122.7"	"26.78"	"30.79"	"15.85"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.514E-06"	"4.22"	"46.72"
"71387"	"False"	"High"	"[K].YFVTFPYPYMNGR.[L]"	""	"0.00186867"	"0.000721313"	"1"	"1"	"8"	"Q8BMJ2"	"Q8BMJ2 [48-60]"	""	"0"	"1654.77226"	"38.162"	"2.387"	"0.925138005747468"	"0.907108336447894"	"145.26"	"57.24"	"7.2"	"277.2"	"15.6"	"33.92"	"103.93"	"44.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001562"	"2.64"	"55.38"
"71358"	"False"	"High"	"[R].YFPTQALNFAFK.[D]"	""	"0.000756833"	"0.000721313"	"2"	"3"	"42"	"P48962; P51881"	"P48962 [81-92]; P51881 [81-92]"	""	"0"	"1446.74161"	"116.151"	"3.707"	"0.925138005747468"	"0.906515362333117"	"21.96"	"35.54"	"2.6"	"287.8"	"9.6"	"41.08"	"16.75"	"29.76"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.59E-05"	"3.30"	"56.54"
"71269"	"False"	"High"	"[R].YFAGNLASGGAAGATSLCFVYPLDFAR.[T]"	"1xCarbamidomethyl [C18]"	"0.000502939"	"0.000721313"	"2"	"2"	"9"	"P48962; P51881"	"P48962 [112-138]; P51881 [112-138]"	""	"0"	"2796.34501"	"2.080"	"3.596"	"0.932172616415912"	"0.906515362333117"	"61.84"	"49.00"	"44.5"	"98.9"	"156.7"	"77.58"	"227.22"	"51.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.484E-05"	"4.43"	"62.90"
"71228"	"False"	"High"	"[K].YEISSVPTFLFFK.[N]"	""	"0.00226386"	"0.000721313"	"1"	"1"	"10"	"Q9CQM9"	"Q9CQM9 [82-94]"	""	"0"	"1577.82501"	"82.173"	"3.984"	"0.925138005747468"	"0.906515362333117"	"56.54"	"58.59"	"3.1"	"286.4"	"10.5"	"36.62"	"33.38"	"43.15"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001865"	"2.30"	"62.98"
"71150"	"False"	"High"	"[R].YDSRPGGYGYGYGR.[S]"	""	"2.20173E-06"	"0.000721313"	"1"	"1"	"25"	"O89086"	"O89086 [115-128]"	""	"0"	"1567.69243"	"135.267"	"4.403"	"0.925138005747468"	"0.906515362333117"	"46.59"	"59.88"	"1.9"	"289.2"	"8.9"	"29.83"	"45.60"	"47.15"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.425E-07"	"4.64"	"26.87"
"70953"	"False"	"High"	"[R].YAICSALAASALPALVMSK.[G]"	"1xCarbamidomethyl [C4]; 1xOxidation [M17]"	"0.00229205"	"0.000721313"	"1"	"1"	"8"	"Q9D8E6"	"Q9D8E6 [122-140]"	""	"0"	"1953.01838"	"113.806"	"3.061"	"0.925138005747468"	"0.906515362333117"	"65.62"	"62.85"	"3.3"	"287.2"	"9.5"	"41.53"	"50.07"	"48.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001889"	"2.86"	"56.74"
"70952"	"False"	"High"	"[R].YAICSALAASALPALVMSK.[G]"	"1xCarbamidomethyl [C4]"	"4.38377E-05"	"0.000721313"	"1"	"1"	"12"	"Q9D8E6"	"Q9D8E6 [122-140]"	""	"0"	"1937.02347"	"4.734"	"5.412"	"0.936509618400951"	"0.906515362333117"	"244.70"	"78.63"	"28.2"	"127.8"	"144.0"	"26.18"	"133.90"	"70.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.302E-06"	"3.97"	"60.55"
"70911"	"False"	"High"	"[K].WYYNAAGFNK.[L]"	""	"0.00136281"	"0.000721313"	"1"	"1"	"12"	"Q9D855"	"Q9D855 [20-29]"	""	"0"	"1233.56873"	"397.370"	"14.357"	"0.925138005747468"	"0.906515362333117"	"60.51"	"70.04"	"0.7"	"288.5"	"10.8"	"144.84"	"65.43"	"59.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001157"	"2.47"	"40.29"
"70902"	"False"	"High"	"[R].WYQMGAYQPFFR.[A]"	"1xOxidation [M4]"	"2.73803E-05"	"0.000721313"	"1"	"3"	"36"	"Q8BHN3"	"Q8BHN3 [663-674]"	""	"0"	"1609.72565"	"126.158"	"2.678"	"0.925138005747468"	"0.906515362333117"	"32.21"	"16.32"	"2.3"	"291.6"	"6.1"	"63.07"	"22.96"	"13.29"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.742E-06"	"3.45"	"49.15"
"70901"	"False"	"High"	"[R].WYQMGAYQPFFR.[A]"	""	"8.7175E-05"	"0.000721313"	"1"	"3"	"27"	"Q8BHN3"	"Q8BHN3 [663-674]"	""	"0"	"1593.73073"	"56.942"	"2.643"	"0.953730823665515"	"0.906515362333117"	"71.45"	"36.98"	"4.7"	"283.4"	"12.0"	"38.52"	"56.78"	"16.32"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.301E-06"	"3.69"	"55.08"
"70878"	"False"	"High"	"[R].WYASLQKPSWHPPR.[W]"	""	"8.98065E-06"	"0.000721313"	"1"	"1"	"31"	"P50637"	"P50637 [33-46]"	""	"0"	"1752.89688"	"98.792"	"2.970"	"0.945683295219289"	"0.906515362333117"	"66.40"	"35.47"	"3.2"	"287.6"	"9.2"	"41.98"	"42.87"	"12.20"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.367E-07"	"3.26"	"38.37"
"70817"	"False"	"High"	"[K].WTTLNSLQLHGLQLR.[I]"	""	"0.000987698"	"0.000721313"	"1"	"2"	"2"	"Q1HFZ0-1"	"Q1HFZ0-1 [287-301]"	""	"0"	"1779.98643"	"85.640"	"0.747"	"0.450835049418009"	"0.906515362333117"	"58.79"	"117.35"	"3.9"	"293.8"	"2.3"	"33.87"	"46.40"	"135.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0001059"	"8.534E-05"	"2.51"	"50.40"
"71394"	"False"	"High"	"[R].YFYFYNTGLQNQR.[V]"	""	"0.000117352"	"0.000721313"	"1"	"1"	"30"	"Q9QUR6"	"Q9QUR6 [86-98]"	""	"0"	"1713.80198"	"66.008"	"1.718"	"0.982626859977453"	"0.919063063983313"	"33.59"	"31.70"	"4.4"	"288.2"	"7.4"	"36.77"	"23.19"	"31.15"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.107E-05"	"3.89"	"47.85"
"70815"	"False"	"High"	"[R].WTQLGAFYPFMR.[N]"	"1xOxidation [M11]"	"0.000499834"	"0.000721313"	"1"	"1"	"10"	"P70699"	"P70699 [661-672]"	""	"0"	"1532.73548"	"139.586"	"1.483"	"0.72349736755548"	"0.938631779069411"	"54.16"	"75.80"	"2.1"	"294.6"	"3.3"	"46.03"	"25.25"	"68.15"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.439E-05"	"2.72"	"55.03"
"71793"	"False"	"High"	"[R].YIGIVKQAGLDR.[M]"	"1xBiotin [K6]"	"8.88098E-05"	"0.000721313"	"1"	"2"	"19"	"Q9Z2X1-1"	"Q9Z2X1-1 [219-230]"	"Q9Z2X1-1 1xBiotin [K224]"	"1"	"1558.84101"	"0.014"	"0.884"	"1.41832256192242E-05"	"0.906515362333117"	"50.45"	"50.37"	"151.4"	"2.1"	"146.6"	"40.74"	"38.25"	"33.39"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.473E-06"	"3.47"	"46.02"
"71855"	"False"	"High"	"[R].YLMSGVVAPVKR.[R]"	"1xBiotin [K11]; 1xOxidation [M3]"	"4.60643E-05"	"0.000721313"	"1"	"1"	"13"	"Q69ZF3"	"Q69ZF3 [567-578]"	"Q69ZF3 1xBiotin [K577]"	"1"	"1561.82292"	"0.049"	"0.906"	"0.00167058118291389"	"0.906515362333117"	"46.04"	"48.15"	"155.6"	"7.2"	"137.2"	"19.85"	"58.93"	"41.13"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.506E-06"	"3.06"	"40.18"
"72751"	"False"	"High"	"[K].YYVTIIDAPGHR.[D]"	""	"0.0015909"	"0.000721313"	"1"	"1"	"13"	"P10126"	"P10126 [85-96]"	""	"0"	"1404.72703"	"153.237"	"3.964"	"0.925138005747468"	"0.906515362333117"	"48.07"	"43.53"	"1.7"	"290.9"	"7.4"	"30.80"	"44.21"	"28.85"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001337"	"2.57"	"37.81"
"72733"	"False"	"High"	"[R].YYNYVFGFYK.[R]"	""	"0.00132948"	"0.000721313"	"1"	"1"	"17"	"P20060"	"P20060 [80-89]"	""	"0"	"1363.63575"	"85.980"	"2.390"	"0.973358748574628"	"0.906515362333117"	"32.10"	"30.85"	"3.1"	"289.2"	"7.6"	"37.73"	"31.04"	"34.46"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001128"	"2.76"	"52.70"
"72630"	"False"	"High"	"[R].YVVTSVSWWSHK.[V]"	""	"0.00107713"	"0.000721313"	"1"	"1"	"12"	"Q8JZQ9"	"Q8JZQ9 [654-665]"	""	"0"	"1478.74268"	"132.706"	"2.975"	"0.925138005747468"	"0.906515362333117"	"73.01"	"56.25"	"2.0"	"291.4"	"6.6"	"86.67"	"42.83"	"77.81"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"9.252E-05"	"2.78"	"44.13"
"72615"	"False"	"High"	"[K].YVPKYAPLADVK.[S]"	"1xBiotin [K4]"	"0.000382988"	"0.000721313"	"1"	"4"	"67"	"Q61029"	"Q61029 [389-400]"	"Q61029 1xBiotin [K392]"	"1"	"1589.83961"	"0.060"	"0.890"	"0.000283609081991781"	"0.906515362333117"	"103.83"	"42.79"	"154.3"	"9.2"	"136.5"	"24.63"	"115.01"	"33.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.446E-05"	"3.51"	"47.48"
"72586"	"False"	"High"	"[K].YVKGLIEGK.[S]"	"1xBiotin [K3]"	"0.0012041"	"0.000721313"	"1"	"2"	"17"	"Q3U7R1"	"Q3U7R1 [337-345]"	"Q3U7R1 1xBiotin [K339]"	"1"	"1232.67076"	"0.023"	"0.964"	"3.77289611927905E-05"	"0.909223670800027"	"64.34"	"34.88"	"148.6"	"4.0"	"147.4"	"30.67"	"47.86"	"23.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001028"	"3.11"	"40.93"
"72561"	"False"	"High"	"[K].YVATLGVEVHPLVFHTNR.[G]"	""	"0.00102508"	"0.000721313"	"1"	"1"	"9"	"P62827"	"P62827 [39-56]"	""	"0"	"2052.10252"	"187.466"	"7.416"	"0.350404165214715"	"0.906515362333117"	"51.42"	"47.64"	"1.5"	"287.5"	"11.0"	"46.73"	"32.57"	"34.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"8.809E-05"	"2.89"	"44.40"
"72560"	"False"	"High"	"[R].YVASYLLAALGGNSSPSAK.[D]"	""	"1.42899E-05"	"0.000721313"	"1"	"1"	"12"	"P99027"	"P99027 [3-21]"	""	"0"	"1868.97525"	"77.348"	"5.788"	"0.463973682624453"	"0.906515362333117"	"53.27"	"47.43"	"3.8"	"273.4"	"22.8"	"37.73"	"42.07"	"56.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.463E-06"	"4.43"	"56.69"
"72550"	"False"	"High"	"[R].YTVGGSETFDSLTDLVEHFK.[K]"	""	"0.00234949"	"0.000721313"	"1"	"3"	"1"	"P29351"	"P29351 [176-195]"	""	"0"	"2245.06592"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001933"	"3.35"	""
"72547"	"False"	"High"	"[K].YTVAPTSLVVSPGQQALLGLKQAVVQTTPPR.[D]"	"1xBiotin [K21]"	"0.000170163"	"0.000721313"	"1"	"3"	"10"	"Q8BRG8"	"Q8BRG8 [88-118]"	"Q8BRG8 1xBiotin [K108]"	"1"	"3445.88757"	"1.757"	"7.187"	""	"0.906515362333117"	"39.35"	"44.02"	"31.4"	"56.2"	"212.4"	"37.35"	"26.92"	"16.49"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.58E-05"	"3.84"	"66.18"
"72543"	"False"	"High"	"[K].YTTLIAKLK.[S]"	"1xBiotin [K]"	"0.00230628"	"0.000721313"	"1"	"2"	"20"	"P47226-1"	"P47226-1 [77-85]"	"P47226-1 1xBiotin [K]"	"1"	"1276.73336"	"0.022"	"0.789"	"3.61097378948738E-05"	"0.906515362333117"	"50.62"	"28.14"	"160.8"	"3.9"	"135.4"	"25.89"	"53.82"	"17.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001904"	"2.83"	"50.59"
"72499"	"False"	"High"	"[K].YTGLSKGLEPEEK.[L]"	"1xBiotin [K6]"	"2.04657E-05"	"0.000721313"	"1"	"1"	"24"	"P03975"	"P03975 [62-74]"	"P03975 1xBiotin [K67]"	"1"	"1676.82000"	"0.019"	"0.786"	"2.73340848125914E-05"	"0.906515362333117"	"54.75"	"25.68"	"159.2"	"3.7"	"137.1"	"26.42"	"42.55"	"21.70"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.069E-06"	"4.24"	"40.79"
"72432"	"False"	"High"	"[K].YSQFINFPIYVWSSK.[T]"	""	"4.2501E-05"	"0.000721313"	"1"	"1"	"46"	"P08113"	"P08113 [271-285]"	""	"0"	"1878.94250"	"132.454"	"7.551"	"0.925138005747468"	"0.906515362333117"	"58.00"	"68.92"	"2.3"	"283.4"	"14.3"	"36.41"	"55.25"	"49.90"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.171E-06"	"4.27"	"62.51"
"71854"	"False"	"High"	"[R].YLMSGVVAPVKR.[R]"	"1xBiotin [K11]"	"0.000605609"	"0.000721313"	"1"	"1"	"15"	"Q69ZF3"	"Q69ZF3 [567-578]"	"Q69ZF3 1xBiotin [K577]"	"1"	"1545.82800"	"0.094"	"0.904"	"0.00671530157851783"	"0.906515362333117"	"49.94"	"27.75"	"147.4"	"15.0"	"137.7"	"33.97"	"50.93"	"15.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.339E-05"	"3.60"	"46.91"
"72421"	"False"	"High"	"[R].YSNVIQPSSFPKSTPWGGSR.[D]"	"1xBiotin [K12]"	"0.000237738"	"0.000721313"	"1"	"2"	"14"	"Q8CIC2"	"Q8CIC2 [56-75]"	"Q8CIC2 1xBiotin [K67]"	"1"	"2421.16559"	"0.232"	"1.223"	"0.925138005747468"	"0.92308690840413"	"71.58"	"71.26"	"116.3"	"29.9"	"153.8"	"70.50"	"41.93"	"54.17"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.185E-05"	"3.94"	"50.97"
"72376"	"False"	"High"	"[R].YSGLQPHVVVLVATVR.[A]"	""	"0.0015909"	"0.000721313"	"1"	"1"	"1"	"Q922D8"	"Q922D8 [687-702]"	""	"0"	"1738.00102"	"0.825"	"0.846"	"0.994201151226993"	"0.906515362333117"	"77.24"	"55.71"	"118.1"	"85.2"	"96.7"	"41.65"	"236.04"	"38.14"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001341"	"3.03"	"45.51"
"72272"	"False"	"High"	"[K].YQVFFFGTHETAFLGPK.[D]"	""	"0.000131191"	"0.000721313"	"1"	"1"	"16"	"P51859"	"P51859 [45-61]"	""	"0"	"1988.99051"	"319.669"	"9.936"	"0.925138005747468"	"0.906515362333117"	"63.75"	"57.91"	"0.9"	"290.4"	"8.6"	"39.11"	"49.82"	"54.41"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.235E-05"	"3.50"	"55.18"
"72265"	"False"	"High"	"[K].YQSNSIQIQWFWR.[A]"	""	"0.000531764"	"0.000721313"	"1"	"2"	"8"	"Q7TMY8"	"Q7TMY8 [4274-4286]"	""	"0"	"1755.86016"	"27.664"	"0.960"	"0.925138005747468"	""	"139.20"	"75.49"	"9.2"	"282.6"	"8.2"	"48.59"	"89.53"	"50.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"4.714E-05"	"2.90"	"58.82"
"72104"	"False"	"High"	"[K].YNQATPIFHQWR.[D]"	""	"0.00154242"	"0.000721313"	"1"	"1"	"9"	"P70460"	"P70460 [72-83]"	""	"0"	"1560.77062"	"128.644"	"4.061"	"0.925138005747468"	"0.906515362333117"	"49.47"	"52.41"	"2.5"	"287.3"	"10.2"	"31.36"	"42.71"	"37.81"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001299"	"2.73"	"38.65"
"72084"	"False"	"High"	"[R].YNLKSPAVK.[R]"	"1xBiotin [K4]"	"0.00181172"	"0.000721313"	"1"	"1"	"12"	"Q9JJZ4"	"Q9JJZ4 [5-13]"	"Q9JJZ4 1xBiotin [K8]"	"1"	"1245.66600"	"0.091"	"1.077"	"0.00465337135088874"	"0.909223670800027"	"38.96"	"24.53"	"134.1"	"12.8"	"153.2"	"13.23"	"36.62"	"24.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001513"	"2.60"	"37.51"
"72060"	"False"	"High"	"[K].YNCSGLNFGKVDVGR.[Y]"	"1xBiotin [K10]; 1xCarbamidomethyl [C3]"	"1.75302E-05"	"0.000721313"	"1"	"1"	"11"	"Q9D710"	"Q9D710 [184-198]"	"Q9D710 1xBiotin [K193]"	"1"	"1911.88401"	"0.362"	"0.456"	"0.925138005747468"	"0.906515362333117"	"104.34"	"112.64"	"167.9"	"59.3"	"72.8"	"88.49"	"40.73"	"51.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.777E-06"	"4.33"	"48.20"
"72018"	"False"	"High"	"[K].YMNSGPVVAMVWEGLNVVK.[T]"	"1xOxidation [M2]"	"0.00189194"	"0.000721313"	"1"	"1"	"4"	"Q01768"	"Q01768 [67-85]"	""	"0"	"2109.05074"	"1.290"	"1.433"	""	"0.916215054610739"	"61.45"	"73.03"	"83.1"	"113.2"	"103.8"	"45.27"	"34.97"	"52.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001577"	"3.71"	"64.27"
"71957"	"False"	"High"	"[K].YMACCLLYR.[G]"	"2xCarbamidomethyl [C4; C5]; 1xOxidation [M2]"	"0.001281"	"0.000721313"	"1"	"5"	"30"	"P05213"	"P05213 [312-320]"	""	"0"	"1265.54755"	"141.792"	"3.354"	"0.925138005747468"	"0.906515362333117"	"30.02"	"40.16"	"2.2"	"290.6"	"7.3"	"27.47"	"17.36"	"30.05"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001091"	"3.00"	"37.67"
"71954"	"False"	"High"	"[K].YLYVDKNFINNPLAQADWAAK.[K]"	"1xBiotin [K6]"	"0.000112374"	"0.000721313"	"1"	"1"	"6"	"Q8VDD5"	"Q8VDD5 [9-29]"	"Q8VDD5 1xBiotin [K14]"	"1"	"2680.32282"	"0.914"	"4.698"	""	"0.906515362333117"	"54.61"	"97.40"	"40.7"	"35.8"	"223.5"	"37.70"	"44.86"	"63.65"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.063E-05"	"4.93"	"61.56"
"71943"	"False"	"High"	"[R].YLVYAILWSLSGDSR.[L]"	""	"0.00105731"	"0.000721313"	"1"	"1"	"5"	"Q9JHU4"	"Q9JHU4 [2491-2505]"	""	"0"	"1742.91120"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"9.106E-05"	"3.30"	""
"71885"	"False"	"High"	"[R].YIQKDQGLHVDFGVENTDPSPR.[D]"	"1xBiotin [K4]"	"1.81938E-05"	"0.000721313"	"1"	"2"	"6"	"Q3UMB5"	"Q3UMB5 [617-638]"	"Q3UMB5 1xBiotin [K620]"	"1"	"2741.29879"	"0.119"	"0.992"	"0.00381985704995526"	"0.906515362333117"	"37.59"	"36.43"	"151.0"	"18.6"	"130.4"	"28.69"	"27.38"	"31.10"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.844E-06"	"4.83"	"47.05"
"71879"	"False"	"High"	"[R].YLQDNPASGEKFAYVPFGAGR.[H]"	"1xBiotin [K11]"	"4.24487E-06"	"0.000721313"	"1"	"1"	"36"	"Q8K0C4"	"Q8K0C4 [426-446]"	"Q8K0C4 1xBiotin [K436]"	"1"	"2513.19180"	"0.025"	"1.209"	"4.63294365889296E-05"	"0.963980326976613"	"27.05"	"25.76"	"135.8"	"3.7"	"160.5"	"15.26"	"24.15"	"38.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.564E-07"	"4.41"	"55.48"
"72415"	"False"	"High"	"[K].YSNFVSFPLYLNGK.[R]"	""	"0.000288052"	"0.000721313"	"1"	"1"	"4"	"Q9CQN1"	"Q9CQN1 [279-292]"	""	"0"	"1648.83697"	"66.957"	"1.175"	"0.925138005747468"	"0.906515362333117"	"49.11"	"99.12"	"3.7"	"292.4"	"3.9"	"42.07"	"52.02"	"84.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"2.627E-05"	"3.22"	"56.40"
"64161"	"False"	"High"	"[K].THINIVVIGHVDSGK.[S]"	""	"8.03331E-06"	"0.000721313"	"1"	"2"	"17"	"P10126"	"P10126 [6-20]"	""	"0"	"1588.88057"	"294.028"	"6.091"	"0.925138005747468"	"0.906515362333117"	"68.95"	"107.45"	"0.9"	"291.8"	"7.3"	"152.73"	"32.02"	"55.18"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.426E-07"	"4.21"	"34.98"
"70814"	"False"	"High"	"[R].WTQLGAFYPFMR.[N]"	""	"0.00163078"	"0.000721313"	"1"	"1"	"1"	"P70699"	"P70699 [661-672]"	""	"0"	"1516.74057"	"6.592"	"2.174"	"0.925138005747468"	"0.985364111986862"	"153.87"	"59.51"	"27.5"	"206.3"	"66.2"	"45.86"	"118.73"	"36.04"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001371"	"2.76"	"59.65"
"70601"	"False"	"High"	"[K].WNQLQAFWGTGK.[G]"	""	"0.000135317"	"0.000721313"	"1"	"1"	"17"	"Q8BTS4"	"Q8BTS4 [144-155]"	""	"0"	"1435.71171"	"117.170"	"4.010"	"0.947989303413716"	"0.906515362333117"	"63.05"	"68.57"	"2.7"	"286.2"	"11.1"	"51.45"	"39.59"	"38.45"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.268E-05"	"3.44"	"51.55"
"69869"	"False"	"High"	"[K].VVTHPFKTIELQMK.[K]"	"1xBiotin [K7]; 1xOxidation [M13]"	"0.000409985"	"0.000721313"	"1"	"1"	"14"	"Q61093"	"Q61093 [300-313]"	"Q61093 1xBiotin [K306]"	"1"	"1913.00234"	"0.156"	"0.989"	"0.0101331705361546"	"0.906515362333117"	"140.58"	"73.60"	"147.3"	"16.5"	"136.2"	"55.12"	"154.10"	"50.84"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.685E-05"	"4.22"	"42.36"
"69868"	"False"	"High"	"[K].VVTHPFKTIELQMK.[K]"	"1xBiotin [K7]"	"0.00129696"	"0.000721313"	"1"	"1"	"17"	"Q61093"	"Q61093 [300-313]"	"Q61093 1xBiotin [K306]"	"1"	"1897.00742"	"0.069"	"0.739"	"0.00344785569694831"	"0.906515362333117"	"60.37"	"66.22"	"167.5"	"12.1"	"120.4"	"60.06"	"34.79"	"38.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001106"	"3.96"	"47.70"
"69783"	"False"	"High"	"[K].VVNEINIEDLCLTKAAYCR.[C]"	"1xBiotin [K14]; 2xCarbamidomethyl [C11; C18]"	"1.93323E-06"	"0.000721313"	"1"	"1"	"58"	"Q9CQB5"	"Q9CQB5 [82-100]"	"Q9CQB5 1xBiotin [K95]"	"1"	"2507.20911"	"0.293"	"1.591"	"0.00671530157851783"	"0.937500052802293"	"37.43"	"47.20"	"108.8"	"30.3"	"160.9"	"28.07"	"27.04"	"53.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.147E-07"	"5.95"	"57.53"
"69541"	"False"	"High"	"[R].VTPQSLFILFGVYGDVQR.[V]"	""	"3.65859E-06"	"0.000721313"	"1"	"1"	"27"	"P17225"	"P17225 [347-364]"	""	"0"	"2039.09604"	"404.464"	"18.357"	"0.925138005747468"	"0.906515362333117"	"58.37"	"42.40"	"0.7"	"286.4"	"12.9"	"37.37"	"69.49"	"32.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.957E-07"	"4.64"	"67.00"
"69503"	"False"	"High"	"[R].VTLTLPVLNAAQSIIFVATGEGK.[A]"	""	"0.000302682"	"0.000721313"	"1"	"1"	"6"	"Q9CQ60"	"Q9CQ60 [186-208]"	""	"0"	"2342.33297"	"1.446"	"2.400"	""	"0.938545084416247"	"76.34"	"94.72"	"65.0"	"117.2"	"117.8"	"60.10"	"32.82"	"95.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.742E-05"	"3.99"	"68.56"
"69481"	"False"	"High"	"[KR].VTIAQGGVLPNIQAVLLPK.[K]"	""	"1.52784E-06"	"0.000721313"	"2"	"8"	"73"	"Q64523; Q8BFU2"	"Q64523 [101-119]; Q8BFU2 [101-119]"	""	"0"	"1931.16881"	"472.542"	"26.620"	"0.72349736755548"	"0.213226184944796"	"83.10"	"86.11"	"0.7"	"281.0"	"18.3"	"96.62"	"54.70"	"40.85"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.712E-07"	"4.54"	"60.35"
"69441"	"False"	"High"	"[R].VTFEADENENITVVKGIR.[L]"	"1xBiotin [K15]"	"0.000230489"	"0.000721313"	"1"	"1"	"11"	"Q9CRB9"	"Q9CRB9 [10-27]"	"Q9CRB9 1xBiotin [K24]"	"1"	"2260.12781"	"0.375"	"1.283"	"0.925138005747468"	"0.995674964380212"	"121.53"	"54.63"	"115.0"	"37.0"	"148.1"	"63.43"	"220.24"	"15.95"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.121E-05"	"3.29"	"50.29"
"69395"	"False"	"High"	"[K].VTAIKSLSIEIGHEVK.[N]"	"1xBiotin [K5]"	"1.81713E-06"	"0.000721313"	"1"	"1"	"66"	"O35623"	"O35623 [43-58]"	"O35623 1xBiotin [K47]"	"1"	"1950.07286"	"1.500"	"1.377"	"0.106233518554242"	"0.990231025792746"	"39.13"	"26.75"	"75.6"	"117.5"	"107.0"	"10.32"	"35.77"	"34.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.014E-07"	"5.48"	"51.98"
"69363"	"False"	"High"	"[K].VSVFFGGLSIK.[K]"	""	"0.00139697"	"0.000721313"	"1"	"1"	"12"	"Q8VDW0-1"	"Q8VDW0-1 [144-154]"	""	"0"	"1153.66157"	"171.410"	"5.208"	"0.925138005747468"	"0.906515362333117"	"78.54"	"72.00"	"1.5"	"290.9"	"7.6"	"60.10"	"32.56"	"21.90"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001188"	"2.69"	"54.02"
"69352"	"False"	"High"	"[R].VSTMRPLATAYKASTSDYQVISDR.[Q]"	"1xBiotin [K12]; 1xOxidation [M4]"	"4.01474E-06"	"0.000721313"	"1"	"1"	"20"	"Q8R4R6"	"Q8R4R6 [282-305]"	"Q8R4R6 1xBiotin [K293]"	"1"	"2902.40735"	"0.058"	"0.634"	"9.87614285871791E-05"	"0.906515362333117"	"41.03"	"30.24"	"172.1"	"9.9"	"118.0"	"35.33"	"25.60"	"15.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.331E-07"	"6.95"	"44.54"
"69351"	"False"	"High"	"[R].VSTMRPLATAYKASTSDYQVISDR.[Q]"	"1xBiotin [K12]"	"1.51841E-06"	"0.000721313"	"1"	"1"	"18"	"Q8R4R6"	"Q8R4R6 [282-305]"	"Q8R4R6 1xBiotin [K293]"	"1"	"2886.41244"	"0.054"	"1.084"	"0.00189277727692803"	"0.929117268927915"	"44.01"	"55.12"	"143.2"	"7.7"	"149.1"	"38.85"	"35.83"	"64.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.702E-07"	"6.95"	"48.41"
"69332"	"False"	"High"	"[K].VSSLPWLLPYWK.[D]"	""	"0.000594462"	"0.000721313"	"1"	"1"	"14"	"Q9DB29"	"Q9DB29 [221-232]"	""	"0"	"1488.82495"	"144.378"	"4.451"	"0.288862049528175"	"0.906515362333117"	"48.58"	"36.77"	"1.8"	"290.4"	"7.8"	"25.33"	"38.75"	"41.33"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.233E-05"	"3.13"	"64.05"
"69889"	"False"	"High"	"[K].VVVHPLVLLSVVDHFNR.[I]"	""	"0.000545099"	"0.000721313"	"1"	"1"	"2"	"P26516"	"P26516 [9-25]"	""	"0"	"1943.12253"	"1.245"	"1.336"	"0.925138005747468"	"0.906515362333117"	"90.70"	"47.09"	"86.4"	"98.2"	"115.4"	"38.39"	"164.01"	"42.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"4.842E-05"	"3.98"	"58.94"
"69330"	"False"	"High"	"[K].VSSLLGKLVSYTNLTQGAK.[E]"	"1xBiotin [K7]"	"0.000245214"	"0.000721313"	"1"	"1"	"8"	"Q9JIS8"	"Q9JIS8 [79-97]"	"Q9JIS8 1xBiotin [K85]"	"1"	"2205.19476"	"0.825"	"6.248"	""	"0.906515362333117"	"49.02"	"81.54"	"41.1"	"32.5"	"226.4"	"39.56"	"33.00"	"103.01"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.24E-05"	"4.38"	"65.06"
"69056"	"False"	"High"	"[R].VRPGFCFHLCSR.[A]"	"2xCarbamidomethyl [C6; C10]"	"0.000101773"	"0.000721313"	"1"	"3"	"28"	"O70133"	"O70133 [770-781]"	""	"0"	"1535.73583"	"78.079"	"2.717"	"0.990760391051192"	"0.906515362333117"	"61.07"	"50.94"	"4.3"	"284.2"	"11.4"	"36.00"	"61.72"	"35.59"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.63E-06"	"3.43"	"36.61"
"68868"	"False"	"High"	"[K].VQALKSEVDTTLYEQVLLEK.[E]"	"1xBiotin [K5]"	"7.60713E-05"	"0.000721313"	"1"	"4"	"4"	"Q8BH79"	"Q8BH79 [467-486]"	"Q8BH79 1xBiotin [K471]"	"1"	"2532.32657"	"1.025"	"1.174"	""	"0.906515362333117"	"62.46"	"71.21"	"84.3"	"99.7"	"116.0"	"40.18"	"43.30"	"49.38"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"7.283E-06"	"4.93"	"60.63"
"68839"	"False"	"High"	"[K].VPVDPATYGQFYGGDSYIILYNYR.[H]"	""	"0.00017122"	"0.000721313"	"1"	"2"	"7"	"P13020-1"	"P13020-1 [456-479]"	""	"0"	"2771.33516"	"12.025"	"3.143"	"0.925138005747468"	"0.906515362333117"	"190.05"	"76.90"	"16.8"	"218.9"	"64.3"	"58.93"	"109.70"	"29.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.589E-05"	"5.19"	"59.69"
"68813"	"False"	"High"	"[K].VPSGFYVGSYVHGVTQSPSLQNLVLGK.[Y]"	""	"0.000196211"	"0.000721313"	"1"	"1"	"2"	"Q9CZR8"	"Q9CZR8 [206-232]"	""	"0"	"2833.48830"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.817E-05"	"4.50"	""
"68680"	"False"	"High"	"[R].VPEKGGFSPFGNTQGPSR.[V]"	"1xBiotin [K4]"	"3.29299E-06"	"0.000721313"	"1"	"1"	"54"	"Q8BMG7"	"Q8BMG7 [441-458]"	"Q8BMG7 1xBiotin [K444]"	"1"	"2087.99673"	"0.014"	"0.910"	"1.5422364838643E-05"	"0.906515362333117"	"59.56"	"40.51"	"163.7"	"2.2"	"134.0"	"32.76"	"63.36"	"29.42"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.583E-07"	"4.88"	"46.11"
"68661"	"False"	"High"	"[R].VPAYDLCSAESANLVLKK.[S]"	"1xBiotin [K]; 1xCarbamidomethyl [C7]"	"0.0019514"	"0.000721313"	"1"	"1"	"7"	"Q99KC8"	"Q99KC8 [639-656]"	"Q99KC8 1xBiotin [K]"	"1"	"2204.10899"	"0.506"	"0.798"	"0.925138005747468"	"0.906515362333117"	"48.78"	"53.27"	"121.8"	"73.0"	"105.3"	"41.50"	"39.75"	"43.66"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001623"	"4.01"	"50.59"
"68660"	"False"	"High"	"[R].VPATKTVHLQSR.[A]"	"1xBiotin [K5]"	"0.000147572"	"0.000721313"	"1"	"2"	"41"	"Q9CQ56"	"Q9CQ56 [114-125]"	"Q9CQ56 1xBiotin [K118]"	"1"	"1562.84716"	"0.012"	"1.075"	"1.13151529478306E-05"	"0.926236034373985"	"38.59"	"25.39"	"140.6"	"1.8"	"157.7"	"17.12"	"28.87"	"19.76"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.382E-05"	"3.29"	"32.55"
"68639"	"False"	"High"	"[K].VNVNLLIFLLNK.[K]"	""	"0.000181034"	"0.000721313"	"1"	"1"	"13"	"Q9JKF1"	"Q9JKF1 [1641-1652]"	""	"0"	"1399.86715"	"124.814"	"3.266"	"0.43793902538563"	"0.906515362333117"	"85.48"	"62.14"	"4.5"	"284.1"	"11.4"	"46.88"	"70.82"	"36.88"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.679E-05"	"3.49"	"65.63"
"68596"	"False"	"High"	"[R].VNQAIWLLCTGAR.[E]"	"1xCarbamidomethyl [C9]"	"0.000883536"	"0.000721313"	"1"	"1"	"12"	"P97461"	"P97461 [147-159]"	""	"0"	"1501.79439"	"92.524"	"2.598"	"0.452844787848141"	"0.925996497600899"	"55.56"	"78.74"	"3.4"	"288.7"	"7.9"	"35.40"	"39.64"	"82.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.658E-05"	"3.20"	"50.85"
"68582"	"False"	"High"	"[R].VNPCIGGVILFHETLYQK.[A]"	"1xCarbamidomethyl [C4]"	"2.52623E-05"	"0.000721313"	"1"	"1"	"12"	"P05064"	"P05064 [70-87]"	""	"0"	"2088.09466"	"184.102"	"8.344"	"0.925138005747468"	"0.906515362333117"	"51.48"	"39.01"	"1.4"	"286.2"	"12.4"	"33.56"	"39.54"	"30.48"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.526E-06"	"4.19"	"52.32"
"68580"	"False"	"High"	"[K].VNNSSLIGLGYTQTLKPGIK.[L]"	""	"0.0019514"	"0.000721313"	"1"	"2"	"4"	"Q60932-1"	"Q60932-1 [250-269]"	""	"0"	"2103.18083"	"0.863"	"0.951"	"0.925138005747468"	"0.906515362333117"	"145.34"	"63.98"	"101.3"	"87.4"	"111.3"	"30.63"	"155.14"	"73.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001629"	"2.35"	"44.41"
"68537"	"False"	"High"	"[K].VNGKAGNLGGGVVTIER.[S]"	"1xBiotin [K4]"	"0.000162944"	"0.000721313"	"1"	"1"	"11"	"P67984"	"P67984 [49-65]"	"P67984 1xBiotin [K52]"	"1"	"1866.98544"	"0.298"	"0.812"	"0.925138005747468"	"0.906515362333117"	"44.52"	"60.46"	"143.3"	"44.4"	"112.3"	"53.14"	"23.76"	"87.01"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.516E-05"	"4.13"	"42.59"
"69270"	"False"	"High"	"[R].VSNVLKEEWSR.[I]"	"1xBiotin [K6]"	"0.000138711"	"0.000721313"	"1"	"1"	"12"	"Q922Y2"	"Q922Y2 [281-291]"	"Q922Y2 1xBiotin [K286]"	"1"	"1572.78389"	"0.171"	"0.818"	"0.925138005747468"	"0.906515362333117"	"59.56"	"37.58"	"151.2"	"28.5"	"120.3"	"44.94"	"38.69"	"20.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.296E-05"	"3.72"	"46.78"
"70620"	"False"	"High"	"[R].WPGFYILQWK.[F]"	""	"0.000338374"	"0.000721313"	"1"	"3"	"12"	"A8Y5H7"	"A8Y5H7 [628-637]"	""	"0"	"1337.70411"	"124.687"	"3.923"	"0.47146597463384"	"0.906515362333117"	"46.31"	"54.20"	"2.2"	"288.5"	"9.3"	"30.54"	"36.28"	"47.16"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.058E-05"	"2.98"	"63.05"
"69930"	"False"	"High"	"[R].VWFVSNIDGTHIAK.[T]"	""	"0.00177839"	"0.000721313"	"1"	"1"	"3"	"P06745"	"P06745 [181-194]"	""	"0"	"1586.83255"	"99.790"	"1.834"	"0.925138005747468"	"0.954461348772941"	"61.63"	"55.42"	"2.8"	"292.1"	"5.1"	"53.41"	"29.46"	"27.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"0.0001486"	"3.10"	"45.41"
"69978"	"False"	"High"	"[K].VYFLPITLHYVTQVIR.[N]"	""	"0.000636364"	"0.000721313"	"1"	"2"	"4"	"B2RQC6"	"B2RQC6 [450-465]"	""	"0"	"1962.12113"	"2.061"	"1.859"	"0.925138005747468"	"0.943485193068069"	"61.09"	"42.65"	"58.8"	"121.1"	"120.1"	"35.75"	"190.79"	"35.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"5.59E-05"	"3.25"	"62.70"
"70509"	"False"	"High"	"[R].WIQPSASCDKTLVIPSK.[V]"	"1xBiotin [K10]; 1xCarbamidomethyl [C8]"	"0.000113072"	"0.000721313"	"1"	"2"	"35"	"Q9WU40-1"	"Q9WU40-1 [757-773]"	"Q9WU40-1 1xBiotin [K766]"	"1"	"2156.08786"	"1.900"	"0.929"	"0.149535467288086"	"0.906515362333117"	"122.59"	"23.83"	"75.8"	"153.3"	"70.9"	"20.77"	"94.27"	"11.98"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.068E-05"	"4.52"	"49.34"
"70503"	"False"	"High"	"[R].WLPLGLGLNHLGK.[G]"	""	"0.00027927"	"0.000721313"	"1"	"1"	"12"	"Q8VDM4"	"Q8VDM4 [557-569]"	""	"0"	"1417.83143"	"165.500"	"6.804"	"0.925138005747468"	"0.906515362333117"	"63.87"	"62.16"	"1.6"	"285.7"	"12.7"	"52.26"	"42.57"	"26.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.539E-05"	"2.92"	"53.26"
"70482"	"False"	"High"	"[K].WLLLTGISAQQNR.[V]"	""	"7.15032E-05"	"0.000721313"	"1"	"1"	"20"	"Q68FD5"	"Q68FD5 [164-176]"	""	"0"	"1499.83289"	"217.512"	"6.113"	"0.925138005747468"	"0.906515362333117"	"60.01"	"60.68"	"1.2"	"291.2"	"7.6"	"47.34"	"18.60"	"12.15"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.875E-06"	"3.40"	"53.06"
"70459"	"False"	"High"	"[K].WIGLDLVHGKPR.[D]"	""	"0.000565732"	"0.000721313"	"1"	"2"	"3"	"P11983"	"P11983 [485-496]"	""	"0"	"1390.79538"	"149.918"	"5.657"	"0.452844787848141"	"0.906515362333117"	"57.27"	"64.18"	"2.1"	"287.3"	"10.6"	"39.52"	"73.60"	"55.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"5.018E-05"	"3.14"	"41.12"
"70396"	"False"	"High"	"[K].WKPPMIDNPNYQGIWKPR.[K]"	"1xOxidation [M5]"	"0.000269084"	"0.000721313"	"1"	"1"	"32"	"P35564"	"P35564 [384-401]"	""	"0"	"2256.13825"	"232.309"	"6.018"	"0.925138005747468"	"0.906515362333117"	"74.04"	"104.54"	"1.3"	"291.7"	"7.0"	"82.71"	"29.25"	"55.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.46E-05"	"2.87"	"44.20"
"70395"	"False"	"High"	"[K].WKPPMIDNPNYQGIWKPR.[K]"	""	"9.74551E-05"	"0.000721313"	"1"	"1"	"13"	"P35564"	"P35564 [384-401]"	""	"0"	"2240.14334"	"77.883"	"15.956"	"0.411571035193858"	"0.906515362333117"	"89.02"	"43.12"	"3.7"	"243.5"	"52.8"	"45.49"	"87.48"	"24.56"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"9.274E-06"	"2.93"	"46.49"
"70383"	"False"	"High"	"[R].WKLQVQEQR.[K]"	"1xBiotin [K2]"	"0.00137127"	"0.000721313"	"2"	"2"	"10"	"Q9JJR8; Q9CR23"	"Q9JJR8 [180-188]; Q9CR23 [164-172]"	"Q9JJR8 1xBiotin [K181]; Q9CR23 1xBiotin [K165]"	"1"	"1440.74163"	"0.149"	"0.635"	"0.925138005747468"	"0.906515362333117"	"48.87"	"67.80"	"160.1"	"23.4"	"116.5"	"35.36"	"37.48"	"76.91"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001168"	"2.37"	"42.31"
"70362"	"False"	"High"	"[R].WKDSWDILIR.[K]"	"1xBiotin [K2]"	"0.000939969"	"0.000721313"	"1"	"1"	"2"	"Q8R2R1"	"Q8R2R1 [736-745]"	"Q8R2R1 1xBiotin [K737]"	"1"	"1557.78825"	"0.640"	"1.241"	"0.925138005747468"	"0.906515362333117"	"55.43"	"49.16"	"100.6"	"60.7"	"138.7"	"37.65"	"34.12"	"28.71"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"8.134E-05"	"2.82"	"60.14"
"70325"	"False"	"High"	"[K].WGTLTDCVVMR.[D]"	"1xCarbamidomethyl [C7]; 1xOxidation [M10]"	"0.00202522"	"0.000721313"	"1"	"2"	"3"	"Q8BG05"	"Q8BG05 [58-68]"	""	"0"	"1353.62897"	"83.526"	"1.503"	"0.528662158103966"	"0.936238272383155"	"43.82"	"33.78"	"3.7"	"290.3"	"6.0"	"34.17"	"29.13"	"19.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001685"	"2.34"	"39.04"
"70287"	"False"	"High"	"[K].WGEGTPKTLSTDAVQYHLQMEDR.[N]"	"1xBiotin [K7]; 1xOxidation [M20]"	"1.45579E-05"	"0.000721313"	"1"	"1"	"6"	"Q8BX90"	"Q8BX90 [971-993]"	"Q8BX90 1xBiotin [K977]"	"1"	"2904.32910"	"0.176"	"1.074"	"0.00647114688363378"	"0.906515362333117"	"108.82"	"115.71"	"112.3"	"26.2"	"161.6"	"126.88"	"31.22"	"47.70"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.494E-06"	"4.69"	"48.12"
"70282"	"False"	"High"	"[R].WGAKTIEGSGR.[T]"	"1xBiotin [K4]"	"7.0187E-05"	"0.000721313"	"1"	"1"	"24"	"P49710"	"P49710 [38-48]"	"P49710 1xBiotin [K41]"	"1"	"1387.67869"	"0.011"	"0.891"	"9.24583087648604E-06"	"0.906515362333117"	"47.03"	"27.17"	"162.3"	"1.7"	"136.0"	"11.73"	"43.97"	"31.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.75E-06"	"3.34"	"38.59"
"70274"	"False"	"High"	"[R].WFVLSNGLLSYYR.[S]"	""	"0.000203639"	"0.000721313"	"1"	"1"	"11"	"Q3B7Z2"	"Q3B7Z2 [107-119]"	""	"0"	"1617.84239"	"63.805"	"0.810"	"0.486690115660178"	"0.906515362333117"	"66.56"	"85.99"	"4.6"	"292.0"	"3.4"	"35.69"	"67.02"	"84.30"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.877E-05"	"2.90"	"61.60"
"69957"	"False"	"High"	"[KR].VYAILTHGIFSGPAISR.[I]"	""	"5.20741E-06"	"0.000721313"	"1"	"2"	"11"	"Q9CS42"	"Q9CS42 [244-260]"	""	"0"	"1801.99593"	"158.195"	"4.923"	"0.402522714189559"	"0.906515362333117"	"45.12"	"54.07"	"1.9"	"290.1"	"8.1"	"36.17"	"29.65"	"49.64"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.535E-07"	"4.07"	"50.61"
"70271"	"False"	"High"	"[K].WFTDTSIILFLNKK.[D]"	""	"0.000310274"	"0.000721313"	"1"	"4"	"10"	"P08752"	"P08752 [259-272]"	""	"1"	"1725.95742"	"62.782"	"1.874"	"0.925138005747468"	"0.969054191468458"	"45.87"	"68.36"	"4.7"	"285.9"	"9.5"	"36.17"	"34.17"	"43.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.821E-05"	"3.10"	"60.36"
"70263"	"False"	"High"	"[R].WFLTCINQPQFR.[A]"	"1xCarbamidomethyl [C5]"	"5.54692E-05"	"0.000721313"	"1"	"1"	"30"	"Q9D8N0"	"Q9D8N0 [190-201]"	""	"0"	"1609.79439"	"129.023"	"3.517"	"0.925138005747468"	"0.906515362333117"	"53.96"	"60.61"	"2.5"	"287.2"	"10.3"	"51.20"	"24.40"	"24.75"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.389E-06"	"3.95"	"54.22"
"70259"	"False"	"High"	"[R].WFLAVPLVSLGFK.[T]"	""	"2.89497E-05"	"0.000721313"	"1"	"1"	"14"	"Q9DC69"	"Q9DC69 [222-234]"	""	"0"	"1476.86133"	"116.174"	"0.874"	"0.466031980976297"	"0.906515362333117"	"130.55"	"75.07"	"2.6"	"294.9"	"2.6"	"38.71"	"88.02"	"141.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.877E-06"	"3.66"	"67.70"
"70255"	"False"	"High"	"[R].WFGISFDTFGR.[T]"	""	"0.000815207"	"0.000721313"	"1"	"1"	"11"	"Q68FL6"	"Q68FL6 [348-358]"	""	"0"	"1332.63715"	"190.509"	"4.839"	"0.925138005747468"	"0.906515362333117"	"51.33"	"28.65"	"1.5"	"291.0"	"7.4"	"28.22"	"45.50"	"16.77"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.1E-05"	"2.82"	"61.27"
"70253"	"False"	"High"	"[R].WFGFLEAQQAFR.[S]"	""	"0.000128776"	"0.000721313"	"1"	"1"	"13"	"Q8CGC7"	"Q8CGC7 [150-161]"	""	"0"	"1499.74301"	"172.256"	"3.618"	"0.925138005747468"	"0.906515362333117"	"30.31"	"48.73"	"1.6"	"292.5"	"5.9"	"22.31"	"20.25"	"51.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"1.213E-05"	"2.97"	"59.69"
"70245"	"False"	"High"	"[K].WFATTDWIAIYQR.[K]"	""	"0.000109624"	"0.000721313"	"1"	"6"	"12"	"P05132-1"	"P05132-1 [297-309]"	""	"0"	"1670.83255"	"88.147"	"2.784"	"0.487524984662636"	"0.916215054610739"	"67.56"	"63.34"	"3.4"	"286.8"	"9.8"	"42.61"	"48.02"	"47.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.037E-05"	"3.81"	"60.23"
"70177"	"False"	"High"	"[K].WDTGENPIYKSAVTTVVNPK.[Y]"	"1xBiotin [K10]"	"8.8701E-06"	"0.000721313"	"1"	"1"	"28"	"P09055"	"P09055 [775-794]"	"P09055 1xBiotin [K784]"	"1"	"2445.21187"	"0.101"	"0.897"	"0.000937069727545392"	"0.906515362333117"	"245.18"	"56.90"	"138.8"	"17.0"	"144.2"	"58.16"	"114.04"	"33.96"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.264E-07"	"5.29"	"53.49"
"70077"	"False"	"High"	"[R].WAFSCGTWLPSR.[A]"	"1xCarbamidomethyl [C5]"	"0.00113182"	"0.000721313"	"1"	"2"	"10"	"Q9CQF6"	"Q9CQF6 [19-30]"	""	"0"	"1467.68378"	"79.410"	"2.116"	"0.925138005747468"	"0.996577388780604"	"45.33"	"68.61"	"4.7"	"286.4"	"8.9"	"34.18"	"35.74"	"55.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.691E-05"	"2.76"	"52.94"
"70041"	"False"	"High"	"[R].VYTPSISKPLAKGEVSGLTK.[AE]"	"1xBiotin [K12]"	"0.000126406"	"0.000721313"	"1"	"2"	"19"	"Q91WE6"	"Q91WE6 [496-515]"	"Q91WE6 1xBiotin [K507]"	"1"	"2301.25228"	"0.014"	"0.739"	"1.5422364838643E-05"	"0.906515362333117"	"43.63"	"32.23"	"167.2"	"2.1"	"130.7"	"25.27"	"33.40"	"25.31"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.189E-05"	"3.78"	"44.58"
"70040"	"False"	"High"	"[R].VYTPSISKPLAK.[G]"	"1xBiotin [K8]"	"0.00126524"	"0.000721313"	"1"	"2"	"17"	"Q91WE6"	"Q91WE6 [496-507]"	"Q91WE6 1xBiotin [K503]"	"0"	"1529.83961"	"0.053"	"0.485"	"0.00031943710732563"	"0.906515362333117"	"47.25"	"50.00"	"198.2"	"12.1"	"89.7"	"33.00"	"37.26"	"41.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001078"	"2.25"	"43.53"
"70013"	"False"	"High"	"[K].VYNYNHLMPTR.[Y]"	""	"0.00137127"	"0.000721313"	"1"	"1"	"8"	"P61358"	"P61358 [74-84]"	""	"0"	"1407.68378"	"45.203"	"4.658"	"0.925138005747468"	"0.906515362333117"	"97.57"	"73.45"	"6.8"	"267.1"	"26.1"	"60.47"	"71.78"	"64.93"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001167"	"2.82"	"33.71"
"70009"	"False"	"High"	"[R].VYNGILEKSCSMHQLSSGIPVPHPR.[H]"	"1xBiotin [K8]; 1xCarbamidomethyl [C10]; 1xOxidation [M12]"	"0.00125743"	"0.000721313"	"1"	"1"	"16"	"P83093"	"P83093 [670-694]"	"P83093 1xBiotin [K677]"	"1"	"3048.48523"	"0.070"	"1.087"	"0.00691466369426171"	"0.916215054610739"	"47.73"	"33.18"	"141.2"	"11.0"	"147.8"	"33.17"	"37.29"	"33.74"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000107"	"3.59"	"45.64"
"70008"	"False"	"High"	"[R].VYNGILEKSCSMHQLSSGIPVPHPR.[H]"	"1xBiotin [K8]; 1xCarbamidomethyl [C10]"	"8.4517E-05"	"0.000721313"	"1"	"1"	"21"	"P83093"	"P83093 [670-694]"	"P83093 1xBiotin [K677]"	"1"	"3032.49031"	"0.062"	"2.167"	"0.000867144843793512"	"0.906515362333117"	"47.96"	"37.47"	"89.7"	"6.0"	"204.3"	"30.66"	"41.24"	"28.36"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.083E-06"	"3.56"	"51.12"
"70270"	"False"	"High"	"[K].WFTDTSIILFLNK.[K]"	""	"0.00111099"	"0.000721313"	"1"	"4"	"6"	"P08752"	"P08752 [259-271]"	""	"0"	"1597.86246"	"25.339"	"1.289"	"0.925138005747468"	"0.906515362333117"	"141.03"	"30.81"	"11.3"	"274.0"	"14.8"	"26.34"	"88.58"	"15.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"9.517E-05"	"2.02"	"64.66"
"22671"	"False"	"High"	"[R].GQVGGDVNVEMDAAPGVDLSR.[I]"	"1xOxidation [M11]"	"0.000170163"	"0.000721313"	"1"	"2"	"1"	"Q61781"	"Q61781 [268-288]"	""	"0"	"2101.98187"	"1.021"	"1.238"	"0.989369718514603"	""	"66.38"	"61.12"	"90.0"	"95.6"	"114.4"	"37.41"	"238.31"	"45.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.577E-05"	"4.69"	"37.88"
"64068"	"False"	"High"	"[K].TGSKSVDAAK.[L]"	"1xBiotin [K4]"	"0.000590793"	"0.000721313"	"1"	"1"	"23"	"Q61712"	"Q61712 [190-199]"	"Q61712 1xBiotin [K193]"	"1"	"1189.58815"	"0.017"	"0.708"	"2.02065471673078E-05"	"0.906515362333117"	"44.14"	"40.26"	"171.8"	"2.8"	"125.4"	"27.63"	"196.33"	"31.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.229E-05"	"3.42"	"24.15"
"63987"	"False"	"High"	"[K].TGLLIAAGGGGAAKTGIK.[N]"	"1xBiotin [K14]"	"6.13999E-08"	"0.000721313"	"1"	"1"	"46"	"Q9WUQ2"	"Q9WUQ2 [25-42]"	"Q9WUQ2 1xBiotin [K38]"	"1"	"1781.99421"	"0.006"	"0.816"	"3.10100120986365E-06"	"0.906515362333117"	"49.97"	"38.64"	"160.9"	"1.1"	"137.9"	"52.37"	"44.72"	"48.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.816E-09"	"6.55"	"45.96"
"55480"	"False"	"High"	"[K].QVFTNNIPKAGFLINPQDPIPR.[R]"	"1xBiotin [K9]"	"3.48604E-05"	"0.000721313"	"1"	"2"	"26"	"Q4FZC9-1"	"Q4FZC9-1 [766-787]"	"Q4FZC9-1 1xBiotin [K774]"	"1"	"2705.42320"	"0.052"	"2.243"	"0.00338850492409696"	"0.906515362333117"	"54.97"	"56.57"	"92.3"	"4.5"	"203.2"	"43.47"	"45.68"	"33.62"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.451E-06"	"4.95"	"59.54"
"55374"	"False"	"High"	"[K].QTSAYNISNSSTFTKSLSR.[Y]"	"1xBiotin [K15]"	"0.00142316"	"0.000721313"	"1"	"1"	"5"	"P70206"	"P70206 [1602-1620]"	"P70206 1xBiotin [K1616]"	"1"	"2318.10813"	"0.707"	"0.588"	"0.925138005747468"	"0.906515362333117"	"59.61"	"64.64"	"120.7"	"92.4"	"86.9"	"82.55"	"45.00"	"43.31"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001203"	"3.67"	"45.46"
"55342"	"False"	"High"	"[R].QTLMWSATWPK.[E]"	""	"0.000975543"	"0.000721313"	"2"	"3"	"1"	"Q501J6; Q61656"	"Q501J6 [272-282]; Q61656 [274-284]"	""	"0"	"1348.67182"	"0.999"	"1.702"	""	"0.943951159824348"	"40.97"	"53.87"	"85.7"	"86.3"	"128.0"	"25.93"	"33.44"	"54.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"8.432E-05"	"2.88"	"50.18"
"55256"	"False"	"High"	"[R].QSVTNSIKAGLTDQVSHHAR.[L]"	"1xBiotin [K8]"	"0.000304563"	"0.000721313"	"1"	"2"	"6"	"Q6PA06-1"	"Q6PA06-1 [560-579]"	"Q6PA06-1 1xBiotin [K567]"	"1"	"2375.18845"	"0.141"	"0.923"	"0.925138005747468"	"0.906515362333117"	"47.74"	"39.27"	"130.5"	"21.8"	"147.6"	"25.96"	"42.13"	"37.69"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.771E-05"	"4.28"	"44.84"
"55208"	"False"	"High"	"[K].QSSLPAMSKVR.[R]"	"1xBiotin [K9]; 1xOxidation [M7]"	"0.000392593"	"0.000721313"	"1"	"2"	"17"	"Q6DID7"	"Q6DID7 [411-421]"	"Q6DID7 1xBiotin [K419]"	"1"	"1445.72393"	"0.073"	"0.064"	"0.00352391563172597"	"0.625665755000974"	"35.84"	"34.62"	"260.7"	"21.2"	"18.1"	"22.11"	"31.99"	"31.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.536E-05"	"3.33"	"32.75"
"55207"	"False"	"High"	"[K].QSSLPAMSKVR.[R]"	"1xBiotin [K9]"	"0.000458327"	"0.000721313"	"1"	"2"	"30"	"Q6DID7"	"Q6DID7 [411-421]"	"Q6DID7 1xBiotin [K419]"	"1"	"1429.72902"	"0.059"	"1.199"	"0.000261618330848083"	"0.960422171904683"	"116.03"	"60.37"	"140.5"	"7.3"	"152.3"	"76.67"	"40.47"	"31.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.08E-05"	"3.30"	"40.80"
"55070"	"False"	"High"	"[K].QSEGLTKEYDR.[L]"	"1xBiotin [K7]"	"0.0012191"	"0.000721313"	"1"	"1"	"7"	"Q61335"	"Q61335 [214-224]"	"Q61335 1xBiotin [K220]"	"1"	"1551.71078"	"0.304"	"1.305"	"0.925138005747468"	"0.921351549947431"	"118.36"	"48.01"	"127.1"	"29.4"	"143.5"	"63.96"	"41.75"	"22.79"	""	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001039"	"2.96"	"35.07"
"54865"	"False"	"High"	"[R].QQQYKFLPSELRDEH.[-]"	"1xBiotin [K5]"	"0.000707001"	"0.000721313"	"1"	"1"	"14"	"P26039"	"P26039 [2527-2541]"	"P26039 1xBiotin [K2531]"	"2"	"2144.02295"	"0.050"	"0.944"	"0.000976870509206647"	"0.906515362333117"	"26.67"	"14.55"	"149.5"	"7.5"	"143.0"	"21.78"	"45.74"	"22.68"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.205E-05"	"3.62"	"46.79"
"54864"	"False"	"High"	"[R].QQQYKFLPSELR.[D]"	"1xBiotin [K5]"	"0.000132826"	"0.000721313"	"1"	"1"	"41"	"P26039"	"P26039 [2527-2538]"	"P26039 1xBiotin [K2531]"	"1"	"1762.89450"	"0.044"	"0.948"	"0.000246409124667082"	"0.906777072223237"	"32.01"	"35.52"	"147.5"	"7.1"	"145.4"	"23.77"	"25.92"	"23.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.243E-05"	"3.33"	"50.94"
"54456"	"False"	"High"	"[K].QNIAKGWQDVTATNAYK.[K]"	"1xBiotin [K5]"	"0.000289842"	"0.000721313"	"1"	"3"	"8"	"Q62393-1"	"Q62393-1 [120-136]"	"Q62393-1 1xBiotin [K124]"	"1"	"2134.03860"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"2.63E-05"	"2.87"	""
"54230"	"False"	"High"	"[K].QIVWNGPVGVFEWEAFAR.[G]"	""	"5.75691E-05"	"0.000721313"	"1"	"1"	"14"	"P09411"	"P09411 [333-350]"	""	"0"	"2105.06032"	"2.408"	"4.794"	"0.925138005747468"	"0.906515362333117"	"107.82"	"77.75"	"38.0"	"60.2"	"201.8"	"63.06"	"155.49"	"24.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.583E-06"	"3.77"	"65.32"
"54173"	"False"	"High"	"[R].QLSYCKNDIR.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C5]"	"0.00212801"	"0.000721313"	"1"	"3"	"11"	"Q9DBR4-1"	"Q9DBR4-1 [449-458]"	"Q9DBR4-1 1xBiotin [K454]"	"1"	"1522.71409"	"0.428"	"0.704"	"0.925138005747468"	"0.906515362333117"	"47.44"	"68.09"	"151.0"	"54.1"	"95.0"	"28.55"	"33.02"	"65.85"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001762"	"2.87"	"38.28"
"54144"	"False"	"High"	"[R].QISFKAEVNSSGK.[T]"	"1xBiotin [K5]"	"8.66368E-05"	"0.000721313"	"1"	"1"	"24"	"Q9JJZ4"	"Q9JJZ4 [182-194]"	"Q9JJZ4 1xBiotin [K186]"	"1"	"1620.80502"	"0.023"	"1.041"	"3.77583843240853E-05"	"0.919063063983313"	"55.63"	"44.28"	"143.5"	"3.7"	"152.8"	"32.97"	"39.94"	"34.09"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.288E-06"	"3.86"	"42.15"
"54048"	"False"	"High"	"[R].QINWTVLYR.[R]"	""	"0.00216789"	"0.000721313"	"1"	"1"	"25"	"Q8BP67"	"Q8BP67 [48-56]"	""	"0"	"1192.64732"	"153.626"	"4.580"	"0.925138005747468"	"0.906515362333117"	"73.14"	"70.26"	"1.8"	"289.2"	"9.0"	"62.32"	"29.65"	"27.41"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001792"	"2.71"	"49.69"
"53833"	"False"	"High"	"[K].QIFILLFQR.[L]"	""	"0.00146789"	"0.000721313"	"1"	"1"	"6"	"Q9ERK4"	"Q9ERK4 [769-777]"	""	"0"	"1177.70919"	"110.184"	"2.798"	"0.925138005747468"	"0.919235111389825"	"56.36"	"55.33"	"2.8"	"290.1"	"7.1"	"49.07"	"29.43"	"30.84"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001239"	"2.59"	"60.40"
"53778"	"False"	"High"	"[R].QIEGKVVEISR.[L]"	"1xBiotin [K5]"	"5.79267E-05"	"0.000721313"	"1"	"3"	"28"	"Q8VDS8-1"	"Q8VDS8-1 [254-264]"	"Q8VDS8-1 1xBiotin [K258]"	"1"	"1483.79372"	"2.061"	"0.718"	"0.168488111728953"	"0.906515362333117"	"36.01"	"31.24"	"75.2"	"170.8"	"54.0"	"22.06"	"49.45"	"27.73"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.631E-06"	"3.36"	"42.02"
"53613"	"False"	"High"	"[K].QKSALLSPEEPPASHR.[D]"	"1xBiotin [K2]"	"6.01197E-05"	"0.000721313"	"1"	"1"	"57"	"Q9EPE9"	"Q9EPE9 [912-927]"	"Q9EPE9 1xBiotin [K913]"	"1"	"1972.99092"	"0.004"	"0.749"	"1.05627524059028E-06"	"0.906515362333117"	"51.54"	"37.32"	"176.4"	"0.6"	"123.0"	"16.72"	"148.11"	"35.19"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.806E-06"	"4.81"	"37.35"
"53574"	"False"	"High"	"[K].QKLTSIQFTCDTDIAQFR.[Q]"	"1xBiotin [K2]; 1xCarbamidomethyl [C10]"	"4.35134E-06"	"0.000721313"	"1"	"4"	"48"	"Q9R1S3-1"	"Q9R1S3-1 [760-777]"	"Q9R1S3-1 1xBiotin [K761]"	"1"	"2398.15298"	"0.026"	"1.065"	"4.74751708900864E-05"	"0.924012263950894"	"54.53"	"49.52"	"132.6"	"4.1"	"163.2"	"39.72"	"38.40"	"25.87"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.68E-07"	"4.71"	"54.35"
"53419"	"False"	"High"	"[R].QHAPVKGEAPAK.[S]"	"1xBiotin [K6]"	"0.002335"	"0.000721313"	"1"	"2"	"5"	"A2AKQ0"	"A2AKQ0 [8-19]"	"A2AKQ0 1xBiotin [K13]"	"1"	"1458.75219"	"0.185"	"0.751"	"0.925138005747468"	"0.906515362333117"	"38.12"	"44.94"	"156.4"	"28.9"	"114.7"	"27.55"	"27.30"	"38.67"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001921"	"2.72"	"23.18"
"53396"	"False"	"High"	"[K].QGVVLLKDSVR.[D]"	"1xBiotin [K7]"	"0.0012041"	"0.000721313"	"1"	"1"	"6"	"P29452"	"P29452 [289-299]"	"P29452 1xBiotin [K295]"	"1"	"1439.80390"	"0.760"	"0.997"	"0.925138005747468"	"0.906515362333117"	"48.04"	"75.88"	"108.0"	"84.3"	"107.7"	"33.96"	"43.06"	"58.50"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000103"	"3.39"	"46.08"
"53386"	"False"	"High"	"[K].QGVKSVAGK.[M]"	"1xBiotin [K4]"	"0.00201273"	"0.000721313"	"1"	"2"	"11"	"Q99K28"	"Q99K28 [493-501]"	"Q99K28 1xBiotin [K496]"	"1"	"1099.59284"	"0.067"	"0.897"	"0.00319529564856822"	"0.906515362333117"	"65.69"	"19.74"	"154.4"	"11.0"	"134.5"	"26.84"	"56.85"	"11.58"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000167"	"2.68"	"27.85"
"53198"	"False"	"High"	"[R].QGGGKLNFDELR.[Q]"	"1xBiotin [K5]"	"0.00171356"	"0.000721313"	"1"	"3"	"7"	"O35245-1"	"O35245-1 [729-740]"	"O35245-1 1xBiotin [K733]"	"1"	"1559.76349"	"0.271"	"0.734"	"0.925138005747468"	"0.906515362333117"	"51.27"	"28.79"	"146.9"	"39.8"	"113.3"	"19.95"	"45.96"	"20.11"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001441"	"2.14"	"47.79"
"53098"	"False"	"High"	"[K].QFVVFEGNHYFYSPYPTK.[T]"	""	"0.00220851"	"0.000721313"	"1"	"1"	"1"	"Q91YQ5"	"Q91YQ5 [153-170]"	""	"0"	"2223.05457"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001825"	"3.64"	""
"52611"	"False"	"High"	"[K].QDNNPLYKSAITTTVNPR.[F]"	"1xBiotin [K8]"	"0.000840839"	"0.000721313"	"1"	"1"	"7"	"P26011"	"P26011 [771-788]"	"P26011 1xBiotin [K778]"	"1"	"2258.12339"	"0.174"	"0.949"	"0.925138005747468"	"0.906515362333117"	"77.12"	"87.99"	"137.4"	"33.8"	"128.8"	"64.22"	"44.49"	"53.26"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.305E-05"	"3.94"	"47.28"
"52141"	"False"	"High"	"[K].QAALKSHYADVDPENQNFLLESNLGK.[K]"	"1xBiotin [K5]"	"6.9323E-05"	"0.000721313"	"1"	"1"	"9"	"Q8CFE6"	"Q8CFE6 [34-59]"	"Q8CFE6 1xBiotin [K38]"	"1"	"3127.51532"	"0.145"	"1.251"	"0.00989344685723132"	"0.906777072223237"	"37.75"	"43.59"	"133.9"	"17.9"	"148.2"	"32.65"	"33.48"	"47.54"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.685E-06"	"5.30"	"50.76"
"55613"	"False"	"High"	"[R].QVTITGSAASISLAQYLINAR.[L]"	""	"0.000138711"	"0.000721313"	"1"	"1"	"14"	"P60335"	"P60335 [326-346]"	""	"0"	"2177.19246"	"64.870"	"2.679"	"0.701855987919616"	"0.913702580837398"	"72.93"	"106.53"	"5.3"	"280.5"	"14.2"	"41.61"	"66.07"	"71.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.296E-05"	"4.23"	"60.69"
"55615"	"False"	"High"	"[R].QVTITGSAASISLAQYLINVR.[L]"	""	"0.00027413"	"0.000721313"	"1"	"3"	"4"	"Q61990"	"Q61990 [331-351]"	""	"0"	"2205.22376"	"6.490"	"1.200"	"0.992871679916025"	"0.906515362333117"	"210.82"	"61.31"	"34.2"	"223.0"	"42.8"	"40.30"	"142.47"	"46.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.499E-05"	"3.39"	"62.08"
"55655"	"False"	"High"	"[K].QVYVDKLAELK.[S]"	"1xBiotin [K6]"	"9.98994E-05"	"0.000721313"	"1"	"1"	"16"	"Q61316"	"Q61316 [670-680]"	"Q61316 1xBiotin [K675]"	"1"	"1531.81888"	"0.113"	"1.037"	"0.0111855025150411"	"0.906515362333117"	"41.06"	"29.16"	"146.5"	"16.8"	"136.7"	"21.98"	"42.71"	"54.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.492E-06"	"3.70"	"51.02"
"56211"	"False"	"High"	"[K].REEAAPPTPAPDDLAQLKNLR.[S]"	"1xBiotin [K18]"	"0.000202382"	"0.000721313"	"1"	"1"	"3"	"Q80WJ7"	"Q80WJ7 [89-109]"	"Q80WJ7 1xBiotin [K106]"	"2"	"2528.29258"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"1.873E-05"	"4.19"	""
"58779"	"False"	"High"	"[K].SAVGFNEMEAPTTAYKK.[T]"	"1xBiotin [K]; 1xOxidation [M8]"	"0.000344719"	"0.000721313"	"1"	"1"	"17"	"P49710"	"P49710 [208-224]"	"P49710 1xBiotin [K]"	"1"	"2085.96199"	"0.071"	"0.423"	"0.00365313584763886"	"0.906515362333117"	"33.93"	"78.21"	"207.4"	"13.7"	"78.9"	"18.06"	"27.85"	"81.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.117E-05"	"4.36"	"40.05"
"58778"	"False"	"High"	"[K].SAVGFNEMEAPTTAYKK.[T]"	"1xBiotin [K]"	"2.94562E-06"	"0.000721313"	"1"	"1"	"23"	"P49710"	"P49710 [208-224]"	"P49710 1xBiotin [K]"	"1"	"2069.96707"	"0.065"	"0.856"	"0.000885693613086906"	"0.906515362333117"	"66.46"	"39.83"	"151.4"	"11.6"	"137.0"	"33.40"	"50.96"	"23.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.215E-07"	"4.50"	"45.00"
"58724"	"False"	"High"	"[R].SASKPAFSINHLSGKGLSSSTSHDSSCSLR.[S]"	"1xBiotin [K15]; 1xCarbamidomethyl [C27]"	"7.93442E-06"	"0.000721313"	"1"	"5"	"9"	"Q9D666-1"	"Q9D666-1 [97-126]"	"Q9D666-1 1xBiotin [K111]"	"1"	"3331.57940"	"0.147"	"1.256"	"0.925138005747468"	"0.927892136092816"	"56.19"	"51.24"	"121.8"	"19.2"	"159.0"	"42.77"	"40.65"	"38.22"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"8.308E-07"	"3.98"	"39.71"
"58658"	"False"	"High"	"[K].SANSELGGIWSVGQR.[I]"	""	"1.36836E-05"	"0.000721313"	"1"	"1"	"13"	"Q8VBV7"	"Q8VBV7 [66-80]"	""	"0"	"1560.77649"	"94.462"	"2.561"	"0.981653263460989"	"0.924306229746472"	"59.60"	"64.37"	"3.1"	"288.0"	"8.9"	"52.83"	"40.18"	"49.32"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.403E-06"	"3.85"	"45.45"
"58634"	"False"	"High"	"[K].SALSGHLETVILGLLK.[T]"	""	"0.000332146"	"0.000721313"	"1"	"1"	"9"	"P07356"	"P07356 [89-104]"	""	"0"	"1650.97888"	"34.284"	"4.046"	"0.925138005747468"	"0.906515362333117"	"117.96"	"73.73"	"7.8"	"261.1"	"31.2"	"31.54"	"87.81"	"66.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.009E-05"	"3.29"	"64.05"
"58607"	"False"	"High"	"[K].SALASVIMGLSPILGK.[D]"	"1xOxidation [M8]"	"0.000889024"	"0.000721313"	"1"	"1"	"1"	"Q76MZ3"	"Q76MZ3 [343-358]"	""	"0"	"1572.90294"	"1.097"	"1.317"	"0.925138005747468"	"0.906515362333117"	"92.42"	"53.13"	"86.5"	"94.9"	"118.6"	"24.64"	"189.59"	"49.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"7.686E-05"	"3.33"	"62.76"
"58581"	"False"	"High"	"[R].SAHGTLGSSSQPLFEPQAEKR.[S]"	"1xBiotin [K20]"	"7.88544E-06"	"0.000721313"	"1"	"2"	"8"	"Q8K078"	"Q8K078 [45-65]"	"Q8K078 1xBiotin [K64]"	"1"	"2453.18778"	"0.342"	"0.810"	"0.925138005747468"	"0.906515362333117"	"65.88"	"81.14"	"136.0"	"58.0"	"106.1"	"52.44"	"33.07"	"63.85"	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.285E-07"	"5.11"	"40.38"
"58537"	"False"	"High"	"[K].SAGAGVKGIEK.[E]"	"1xBiotin [K7]"	"0.00171356"	"0.000721313"	"1"	"2"	"6"	"Q6Y685-2"	"Q6Y685-2 [110-120]"	"Q6Y685-2 1xBiotin [K116]"	"1"	"1242.65108"	"0.620"	"0.952"	"0.967871122183686"	"0.906515362333117"	"90.38"	"92.18"	"112.3"	"67.6"	"120.1"	"74.75"	"25.49"	"54.49"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001436"	"2.70"	"32.14"
"58476"	"False"	"High"	"[R].SAASKTVNIYFPK.[K]"	"1xBiotin [K5]"	"5.97485E-05"	"0.000721313"	"1"	"1"	"25"	"P27612"	"P27612 [525-537]"	"P27612 1xBiotin [K529]"	"1"	"1651.85124"	"0.041"	"0.756"	"0.000205599624331098"	"0.906515362333117"	"51.59"	"32.97"	"162.9"	"7.8"	"129.3"	"35.82"	"38.60"	"51.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.777E-06"	"4.36"	"48.27"
"57640"	"False"	"High"	"[R].RPYWCISR.[Q]"	"1xCarbamidomethyl [C5]"	"0.00210184"	"0.000721313"	"1"	"1"	"22"	"Q8BIJ6"	"Q8BIJ6 [517-524]"	""	"0"	"1137.56221"	"173.055"	"7.872"	"0.925138005747468"	"0.906515362333117"	"62.10"	"73.80"	"1.9"	"287.2"	"10.8"	"51.03"	"32.25"	"46.15"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001748"	"2.48"	"33.49"
"57563"	"False"	"High"	"[K].RPPSGFFLFCSEFRPK.[I]"	"1xCarbamidomethyl [C10]"	"0.00214122"	"0.000721313"	"1"	"1"	"2"	"O54879"	"O54879 [95-110]"	""	"0"	"1971.98980"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001775"	"3.94"	""
"57562"	"False"	"High"	"[K].RPPSAFFLFCSEYRPK.[I]"	"1xCarbamidomethyl [C10]"	"9.25165E-07"	"0.000721313"	"1"	"1"	"58"	"P63158"	"P63158 [97-112]"	""	"0"	"2002.00036"	"165.798"	"3.039"	"0.925138005747468"	"0.906515362333117"	"83.16"	"75.04"	"2.1"	"291.3"	"6.5"	"69.91"	"57.61"	"31.73"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.055E-07"	"5.42"	"48.26"
"52070"	"False"	"High"	"[K].NYKNASGVVNSSPR.[S]"	"1xBiotin [K3]"	"1.8535E-05"	"0.000721313"	"1"	"1"	"13"	"Q7TQE6"	"Q7TQE6 [321-334]"	"Q7TQE6 1xBiotin [K323]"	"1"	"1718.82788"	"0.108"	"0.857"	"0.0152931016899052"	"0.906515362333117"	"40.79"	"47.87"	"148.5"	"16.6"	"134.9"	"34.24"	"30.83"	"48.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.875E-06"	"4.13"	"33.93"
"57561"	"False"	"High"	"[K].RPPSAFFLFCSENRPK.[I]"	"1xCarbamidomethyl [C10]"	"0.00011099"	"0.000721313"	"1"	"1"	"16"	"P30681"	"P30681 [97-112]"	""	"0"	"1952.97996"	"247.079"	"8.024"	"0.925138005747468"	"0.906515362333117"	"110.04"	"115.03"	"1.3"	"290.1"	"8.6"	"113.90"	"23.97"	"38.22"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.048E-05"	"4.29"	"44.53"
"57527"	"False"	"High"	"[K].RPMSAYMLWLNASR.[E]"	"2xOxidation [M3; M7]"	"0.00181172"	"0.000721313"	"1"	"2"	"4"	"Q08943"	"Q08943 [549-562]"	""	"0"	"1727.83561"	"241.701"	"1.685"	"0.925138005747468"	""	"90.58"	"71.38"	"1.3"	"296.6"	"2.1"	"57.01"	"86.91"	"24.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001519"	"2.98"	"43.28"
"57526"	"False"	"High"	"[K].RPMSAYMLWLNASR.[E]"	"1xOxidation [M3]"	"0.00147701"	"0.000721313"	"1"	"2"	"3"	"Q08943"	"Q08943 [549-562]"	""	"0"	"1711.84069"	"57.377"	"1.241"	"0.488903359827608"	"0.978504945007661"	"56.36"	"103.52"	"4.7"	"290.0"	"5.3"	"65.87"	"16.50"	"110.69"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001247"	"3.36"	"46.91"
"57518"	"False"	"High"	"[K].RPLWFICSGMGTQWR.[G]"	"1xCarbamidomethyl [C7]; 1xOxidation [M10]"	"6.46782E-06"	"0.000721313"	"1"	"1"	"37"	"P19096"	"P19096 [490-504]"	""	"0"	"1910.91525"	"87.315"	"1.678"	"0.97035293201683"	"0.963188257025838"	"35.39"	"47.11"	"3.2"	"291.8"	"5.0"	"29.67"	"23.02"	"57.65"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.829E-07"	"4.13"	"49.98"
"57517"	"False"	"High"	"[K].RPLWFICSGMGTQWR.[G]"	"1xCarbamidomethyl [C7]"	"2.16388E-05"	"0.000721313"	"1"	"1"	"17"	"P19096"	"P19096 [490-504]"	""	"0"	"1894.92034"	"74.841"	"3.670"	"0.973358748574628"	"0.906515362333117"	"79.31"	"75.95"	"4.5"	"277.9"	"17.6"	"82.35"	"43.92"	"25.32"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.179E-06"	"5.25"	"54.27"
"57513"	"False"	"High"	"[K].RPITGGSGGGEGAGLGGGKYVSFEDR.[H]"	"1xBiotin [K19]"	"1.42017E-05"	"0.000721313"	"1"	"1"	"6"	"Q9R059"	"Q9R059 [226-251]"	"Q9R059 1xBiotin [K244]"	"1"	"2707.28929"	"1.057"	"1.603"	"0.986643544569185"	"0.952991370623084"	"82.31"	"81.40"	"80.9"	"94.0"	"125.1"	"117.89"	"35.69"	"101.87"	""	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.457E-06"	"5.57"	"43.32"
"57494"	"False"	"High"	"[R].RPIKGAAGRPLELSDFR.[M]"	"1xBiotin [K4]"	"6.27833E-05"	"0.000721313"	"1"	"4"	"31"	"Q61029"	"Q61029 [364-380]"	"Q61029 1xBiotin [K367]"	"1"	"2109.13859"	"0.008"	"1.186"	"5.80133690868974E-06"	"0.956952577191092"	"21.84"	"28.31"	"136.9"	"1.2"	"161.9"	"13.51"	"26.25"	"48.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.068E-06"	"4.02"	"42.47"
"57442"	"False"	"High"	"[K].RPFGVSLLYIGWDK.[H]"	""	"0.00014219"	"0.000721313"	"1"	"1"	"13"	"Q9R1P0"	"Q9R1P0 [128-141]"	""	"0"	"1650.90024"	"164.766"	"4.631"	"0.925138005747468"	"0.906515362333117"	"93.58"	"59.24"	"1.9"	"289.9"	"8.2"	"55.26"	"76.08"	"42.18"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"1.334E-05"	"4.37"	"57.13"
"57441"	"False"	"High"	"[R].RPFGISALIVGFDFDGTPR.[L]"	""	"1.62746E-05"	"0.000721313"	"1"	"1"	"14"	"Q9Z2U0"	"Q9Z2U0 [125-143]"	""	"0"	"2065.08654"	"85.951"	"4.733"	"0.49465175579792"	"0.906515362333117"	"65.46"	"67.66"	"3.3"	"282.9"	"13.8"	"25.83"	"60.87"	"54.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.663E-06"	"4.63"	"62.23"
"57312"	"False"	"High"	"[K].RNDFQLIGIQDGYLSLLQDSGEVR.[E]"	""	"3.94084E-06"	"0.000721313"	"1"	"1"	"5"	"P63242"	"P63242 [86-109]"	""	"1"	"2736.39513"	"1.586"	"1.494"	"0.925138005747468"	"0.935866453494337"	"66.62"	"94.51"	"72.5"	"119.6"	"108.0"	"41.37"	"204.98"	"91.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"4.254E-07"	"6.24"	"61.51"
"56903"	"False"	"High"	"[K].RLEGLSKQLDWDVR.[S]"	"1xBiotin [K7]"	"0.00163078"	"0.000721313"	"1"	"1"	"9"	"Q8C172"	"Q8C172 [98-111]"	"Q8C172 1xBiotin [K104]"	"2"	"1941.00109"	"0.538"	"0.656"	"0.925138005747468"	"0.906515362333117"	"44.06"	"61.12"	"141.7"	"75.4"	"82.9"	"33.91"	"26.77"	"56.61"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001371"	"3.70"	"49.34"
"56709"	"False"	"High"	"[R].RHWGGNVLGPK.[S]"	""	"0.000326032"	"0.000721313"	"1"	"1"	"24"	"P12970"	"P12970 [235-245]"	""	"1"	"1220.66470"	"131.987"	"3.556"	"0.925138005747468"	"0.906515362333117"	"75.64"	"79.24"	"2.2"	"289.0"	"8.8"	"57.67"	"54.18"	"47.99"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.946E-05"	"4.39"	"24.52"
"56464"	"False"	"High"	"[K].RGFGFVYFQSHDAADK.[A]"	""	"0.0012731"	"0.000721313"	"1"	"1"	"4"	"Q9CX86"	"Q9CX86 [139-154]"	""	"1"	"1844.87146"	"80.742"	"0.726"	"0.530693687265835"	""	"83.01"	"58.80"	"3.7"	"293.7"	"2.7"	"38.40"	"63.03"	"42.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001087"	"4.50"	"41.44"
"57558"	"False"	"High"	"[R].RPPQDGSSAQNCSSSPAKQELIAWEK.[E]"	"1xBiotin [K18]; 1xCarbamidomethyl [C12]"	"1.19112E-07"	"0.000721313"	"1"	"1"	"47"	"P31651"	"P31651 [585-610]"	"P31651 1xBiotin [K602]"	"1"	"3097.44659"	"0.072"	"0.810"	"0.00338850492409696"	"0.906515362333117"	"58.22"	"47.02"	"152.9"	"10.7"	"136.4"	"46.37"	"226.55"	"25.63"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.473E-08"	"7.56"	"47.70"
"52058"	"False"	"High"	"[K].NYDIGAALDTIQYSKHPPPL.[-]"	"1xBiotin [K15]"	"0.00011168"	"0.000721313"	"1"	"2"	"8"	"Q64337"	"Q64337 [423-442]"	"Q64337 1xBiotin [K437]"	"1"	"2439.20131"	"0.515"	"3.434"	"0.925138005747468"	"0.906515362333117"	"77.06"	"34.91"	"59.6"	"25.2"	"215.2"	"35.04"	"57.43"	"24.59"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.056E-05"	"4.12"	"60.42"
"52037"	"False"	"High"	"[R].NWMNSLGVNPR.[V]"	"1xOxidation [M3]"	"0.000430807"	"0.000721313"	"1"	"1"	"20"	"Q61233"	"Q61233 [402-412]"	""	"0"	"1303.62118"	"622.158"	"8.996"	"0.604421892980025"	"0.906515362333117"	"33.05"	"67.67"	"0.5"	"295.3"	"4.2"	"10.94"	"38.57"	"50.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.862E-05"	"2.62"	"36.72"
"52036"	"False"	"High"	"[R].NWMNSLGVNPR.[V]"	""	"0.00139697"	"0.000721313"	"1"	"1"	"13"	"Q61233"	"Q61233 [402-412]"	""	"0"	"1287.62627"	"43.527"	"5.348"	"0.648384706721422"	"0.906515362333117"	"121.53"	"65.17"	"6.7"	"255.3"	"38.0"	"68.38"	"88.90"	"35.58"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001186"	"2.88"	"44.78"
"50371"	"False"	"High"	"[R].NKTEDLEATSEHFK.[T]"	"1xBiotin [K2]"	"6.59721E-05"	"0.000721313"	"1"	"1"	"17"	"O70404"	"O70404 [46-59]"	"O70404 1xBiotin [K47]"	"1"	"1874.85890"	"0.037"	"0.688"	"9.56190873519663E-05"	"0.906515362333117"	"68.94"	"20.49"	"172.9"	"6.8"	"120.2"	"18.54"	"219.26"	"10.62"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.368E-06"	"4.22"	"40.74"
"50366"	"False"	"High"	"[K].NKSNVYSK.[I]"	"1xBiotin [K2]"	"0.00170299"	"0.000721313"	"1"	"1"	"13"	"Q91YX0"	"Q91YX0 [603-610]"	"Q91YX0 1xBiotin [K604]"	"1"	"1165.56702"	"0.072"	"0.880"	"0.00375902477549748"	"0.906515362333117"	"50.50"	"43.75"	"153.4"	"11.6"	"135.0"	"38.74"	"39.17"	"37.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001433"	"2.80"	"26.16"
"50315"	"False"	"High"	"[K].NKMLFSHLEGPESPR.[Y]"	"1xBiotin [K2]; 1xOxidation [M3]"	"0.000115908"	"0.000721313"	"1"	"1"	"21"	"Q9JHL0-1"	"Q9JHL0-1 [83-97]"	"Q9JHL0-1 1xBiotin [K84]"	"1"	"1983.94153"	"0.051"	"0.648"	"0.0028103014004041"	"0.906515362333117"	"78.45"	"53.31"	"182.8"	"9.4"	"107.8"	"71.37"	"55.97"	"22.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.092E-05"	"3.49"	"43.45"
"50314"	"False"	"High"	"[K].NKMLFSHLEGPESPR.[Y]"	"1xBiotin [K2]"	"3.52948E-05"	"0.000721313"	"1"	"1"	"13"	"Q9JHL0-1"	"Q9JHL0-1 [83-97]"	"Q9JHL0-1 1xBiotin [K84]"	"1"	"1967.94661"	"0.165"	"1.336"	"0.0112285882026406"	"0.925487989474001"	"44.25"	"31.28"	"116.8"	"20.5"	"162.8"	"24.04"	"33.98"	"25.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.492E-06"	"3.13"	"46.01"
"50299"	"False"	"High"	"[R].NKIISIFSGTEK.[G]"	"1xBiotin [K2]"	"6.0869E-05"	"0.000721313"	"1"	"1"	"40"	"Q8CIN4"	"Q8CIN4 [51-62]"	"Q8CIN4 1xBiotin [K52]"	"1"	"1562.82469"	"0.003"	"0.925"	"4.02494379603269E-07"	"0.906515362333117"	"61.14"	"35.29"	"155.7"	"0.4"	"143.9"	"25.45"	"51.07"	"23.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.884E-06"	"4.02"	"53.96"
"50293"	"False"	"High"	"[K].NKLENKMEGIGLK.[K]"	"1xBiotin [K6]"	"5.05485E-05"	"0.000721313"	"1"	"1"	"18"	"Q8R5J9"	"Q8R5J9 [146-158]"	"Q8R5J9 1xBiotin [K151]"	"2"	"1699.88697"	"0.056"	"1.031"	"9.33744372157228E-05"	"0.916215054610739"	"44.04"	"27.88"	"141.5"	"8.2"	"150.3"	"19.99"	"213.93"	"23.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"4.937E-06"	"4.01"	"46.87"
"50271"	"False"	"High"	"[K].NKGDSHLNVQVSNFKSGK.[G]"	"1xBiotin [K]"	"0.000226247"	"0.000721313"	"1"	"1"	"22"	"Q80WJ7"	"Q80WJ7 [246-263]"	"Q80WJ7 1xBiotin [K]"	"2"	"2185.08186"	"0.047"	"1.038"	"0.0018110534264957"	"0.916215054610739"	"42.44"	"28.83"	"139.4"	"7.1"	"153.4"	"22.55"	"35.38"	"28.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.082E-05"	"4.28"	"37.52"
"50270"	"False"	"High"	"[K].NKGDSHLNVQVSNFK.[S]"	"1xBiotin [K2]"	"0.000145756"	"0.000721313"	"1"	"1"	"13"	"Q80WJ7"	"Q80WJ7 [246-260]"	"Q80WJ7 1xBiotin [K247]"	"1"	"1912.93341"	"0.034"	"0.813"	"0.000677570504100214"	"0.906515362333117"	"73.15"	"26.69"	"159.7"	"7.1"	"133.2"	"45.16"	"59.17"	"16.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.366E-05"	"3.78"	"38.53"
"50229"	"False"	"High"	"[R].NKALGVAVGGGADGSR.[D]"	"1xBiotin [K2]"	"8.34766E-05"	"0.000721313"	"1"	"3"	"12"	"Q8VDS8-1"	"Q8VDS8-1 [20-35]"	"Q8VDS8-1 1xBiotin [K21]"	"1"	"1654.83296"	"0.097"	"0.692"	"0.922052627369978"	"0.906515362333117"	"37.65"	"29.26"	"167.0"	"16.2"	"116.9"	"24.87"	"32.76"	"19.98"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.967E-06"	"3.32"	"38.23"
"50172"	"False"	"High"	"[K].NHFKGGQSGLSQSK.[N]"	"1xBiotin [K4]"	"3.57347E-05"	"0.000721313"	"1"	"2"	"33"	"Q60848-1"	"Q60848-1 [733-746]"	"Q60848-1 1xBiotin [K736]"	"1"	"1700.81731"	"0.011"	"0.889"	"9.24583087648604E-06"	"0.906515362333117"	"55.49"	"43.48"	"164.6"	"1.7"	"133.7"	"26.49"	"48.41"	"60.08"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.54E-06"	"3.58"	"27.29"
"50103"	"False"	"High"	"[K].NGPVEGAFTVFSDFLTYK.[S]"	""	"0.000916976"	"0.000721313"	"1"	"1"	"5"	"P10605"	"P10605 [246-263]"	""	"0"	"1991.97492"	"1.101"	"1.154"	""	"0.906515362333117"	"62.17"	"59.05"	"90.5"	"106.4"	"103.1"	"25.37"	"47.64"	"42.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.943E-05"	"3.76"	"67.60"
"49936"	"False"	"High"	"[R].NFSDNQLQEGKNVIGLQMGTNR.[G]"	"1xBiotin [K11]; 1xOxidation [M18]"	"1.60743E-05"	"0.000721313"	"1"	"1"	"20"	"Q9WVA4"	"Q9WVA4 [161-182]"	"Q9WVA4 1xBiotin [K171]"	"1"	"2705.27701"	"6.186"	"1.295"	"0.558644691043429"	"0.970525080472744"	"75.42"	"42.15"	"33.3"	"222.8"	"43.9"	"35.96"	"62.05"	"25.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.636E-06"	"5.46"	"49.02"
"50381"	"False"	"High"	"[R].NKVFASSAER.[H]"	"1xBiotin [K2]"	"0.00142316"	"0.000721313"	"1"	"2"	"19"	"Q8R570"	"Q8R570 [312-321]"	"Q8R570 1xBiotin [K313]"	"1"	"1334.65215"	"0.009"	"0.757"	"5.80133690868974E-06"	"0.906515362333117"	"59.77"	"43.82"	"172.1"	"1.3"	"126.6"	"27.56"	"65.22"	"44.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001206"	"3.05"	"34.78"
"49935"	"False"	"High"	"[R].NFSDNQLQEGKNVIGLQMGTNR.[G]"	"1xBiotin [K11]"	"2.04657E-05"	"0.000721313"	"1"	"1"	"15"	"Q9WVA4"	"Q9WVA4 [161-182]"	"Q9WVA4 1xBiotin [K171]"	"1"	"2689.28209"	"0.053"	"1.860"	"0.000475801716048528"	"0.909223670800027"	"56.03"	"44.05"	"97.0"	"5.0"	"198.0"	"31.57"	"233.36"	"28.76"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.062E-06"	"5.10"	"53.58"
"49872"	"False"	"High"	"[K].NFATSLYSMIK.[G]"	"1xOxidation [M9]"	"0.0015329"	"0.000721313"	"1"	"1"	"16"	"P48036"	"P48036 [289-299]"	""	"0"	"1290.63985"	"270.948"	"3.838"	"0.925138005747468"	"0.906515362333117"	"85.66"	"78.03"	"1.0"	"294.9"	"4.1"	"75.05"	"57.34"	"29.84"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001296"	"2.42"	"49.56"
"49871"	"False"	"High"	"[K].NFATSLYSMIK.[G]"	""	"0.0011602"	"0.000721313"	"1"	"1"	"18"	"P48036"	"P48036 [289-299]"	""	"0"	"1274.64494"	"97.551"	"7.095"	"0.935694807094878"	"0.906515362333117"	"62.21"	"65.93"	"3.2"	"272.5"	"24.3"	"75.23"	"40.92"	"34.51"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.929E-05"	"2.93"	"57.94"
"49362"	"False"	"High"	"[K].NAFTEEVTKSMR.[N]"	"1xBiotin [K9]"	"0.00114592"	"0.000721313"	"1"	"1"	"5"	"Q9CXR1"	"Q9CXR1 [244-255]"	"Q9CXR1 1xBiotin [K252]"	"1"	"1638.76144"	"0.619"	"0.941"	"0.925138005747468"	"0.906515362333117"	"29.03"	"30.98"	"114.2"	"69.2"	"116.6"	"23.58"	"22.15"	"22.36"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"9.802E-05"	"3.22"	"47.45"
"49172"	"False"	"High"	"[K].MWVQLLIPR.[I]"	"1xOxidation [M1]"	"0.000583522"	"0.000721313"	"1"	"1"	"13"	"P61290"	"P61290 [138-146]"	""	"0"	"1171.66561"	"257.194"	"4.912"	"0.322626093496445"	"0.906515362333117"	"73.14"	"36.57"	"1.0"	"293.9"	"5.0"	"40.50"	"54.64"	"18.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"5.149E-05"	"2.96"	"53.76"
"49118"	"False"	"High"	"[R].MWGKTENGGGSR.[V]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.000385367"	"0.000721313"	"1"	"2"	"20"	"Q3UVK0"	"Q3UVK0 [45-56]"	"Q3UVK0 1xBiotin [K48]"	"1"	"1521.65731"	"0.058"	"0.684"	"0.00197648535439221"	"0.906515362333117"	"51.39"	"30.72"	"171.2"	"9.9"	"118.8"	"28.08"	"40.83"	"17.85"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.454E-05"	"3.06"	"33.64"
"49117"	"False"	"High"	"[R].MWGKTENGGGSR.[V]"	"1xBiotin [K4]"	"0.000256078"	"0.000721313"	"1"	"2"	"12"	"Q3UVK0"	"Q3UVK0 [45-56]"	"Q3UVK0 1xBiotin [K48]"	"1"	"1505.66239"	"0.129"	"0.842"	"0.925138005747468"	"0.906515362333117"	"43.47"	"30.73"	"145.3"	"18.8"	"135.9"	"18.77"	"50.28"	"25.13"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.343E-05"	"2.89"	"37.30"
"48922"	"False"	"High"	"[K].MVMTVFACLMGK.[G]"	"1xCarbamidomethyl [C8]; 3xOxidation [M1; M3; M10]"	"0.00141438"	"0.000721313"	"1"	"2"	"6"	"Q61233"	"Q61233 [611-622]"	""	"0"	"1435.64521"	"120.372"	"1.203"	"0.477067253044389"	""	"145.04"	"67.37"	"2.6"	"293.2"	"4.2"	"43.73"	"93.88"	"44.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.00012"	"2.42"	"42.71"
"48919"	"False"	"High"	"[K].MVMTVFACLMGK.[G]"	"1xCarbamidomethyl [C8]"	"0.000466921"	"0.000721313"	"1"	"2"	"6"	"Q61233"	"Q61233 [611-622]"	""	"0"	"1387.66047"	"1.133"	"2.084"	"0.949662611758987"	"0.983025330649738"	"84.04"	"68.13"	"81.1"	"84.7"	"134.3"	"41.87"	"218.43"	"55.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"4.16E-05"	"3.30"	"60.34"
"48867"	"False"	"High"	"[-].MVKVTFNSALAQK.[E]"	"1xBiotin [K3]; 1xMet-loss [N-Term]"	"0.000110305"	"0.000721313"	"1"	"1"	"17"	"O89051"	"O89051 [1-13]"	"O89051 1xBiotin [K3]; 1xMet-loss [N-Term]"	"1"	"1531.83011"	"0.050"	"0.737"	"0.000651975010897786"	"0.906515362333117"	"62.95"	"64.16"	"157.1"	"7.5"	"135.4"	"46.06"	"44.63"	"45.34"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.041E-05"	"3.80"	"42.74"
"48852"	"False"	"High"	"[-].MVKISFQPAVAGIK.[A]"	"1xBiotin [K3]; 1xMet-loss [N-Term]"	"0.000587146"	"0.000721313"	"1"	"1"	"17"	"Q91VK4"	"Q91VK4 [1-14]"	"Q91VK4 1xBiotin [K3]; 1xMet-loss [N-Term]"	"1"	"1583.89780"	"0.093"	"0.818"	"0.00133481199078678"	"0.906515362333117"	"142.78"	"68.65"	"153.5"	"9.7"	"136.9"	"53.35"	"147.20"	"57.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.172E-05"	"2.75"	"49.33"
"48285"	"False"	"High"	"[-].MSWLFPLAKSASSSAAGSPAGLTSLQQQK.[Q]"	"1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"1.14341E-05"	"0.000721313"	"1"	"3"	"9"	"Q8CHS8"	"Q8CHS8 [1-29]"	"Q8CHS8 1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"1"	"3086.56155"	"0.354"	"14.169"	"0.925138005747468"	"0.906515362333117"	"107.80"	"119.42"	"19.3"	"6.8"	"273.8"	"92.72"	"51.06"	"52.66"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.182E-06"	"5.52"	"67.62"
"48262"	"False"	"High"	"[K].MSVQPTVSLGGFEITPPVVLR.[L]"	"1xOxidation [M1]"	"1.60743E-05"	"0.000721313"	"1"	"1"	"48"	"Q61937"	"Q61937 [81-101]"	""	"0"	"2243.21042"	"266.775"	"9.553"	"0.925138005747468"	"0.906515362333117"	"89.46"	"84.41"	"0.9"	"288.2"	"10.9"	"70.12"	"50.53"	"42.85"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.637E-06"	"5.01"	"60.09"
"49888"	"False"	"High"	"[K].NFGPKGFGFGQGAGALVHSE.[-]"	"1xBiotin [K5]"	"0.000548485"	"0.000721313"	"1"	"1"	"15"	"P97315"	"P97315 [174-193]"	"P97315 1xBiotin [K178]"	"1"	"2203.03893"	"0.316"	"0.968"	"0.925138005747468"	"0.906515362333117"	"78.30"	"59.40"	"139.1"	"28.3"	"132.5"	"41.57"	"60.07"	"45.66"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.867E-05"	"4.03"	"54.86"
"58790"	"False"	"High"	"[K].SAVTGGKEAVYSGVQSLR.[S]"	"1xBiotin [K7]"	"4.82847E-07"	"0.000721313"	"1"	"2"	"35"	"Q3UPF5-1"	"Q3UPF5-1 [498-515]"	"Q3UPF5-1 1xBiotin [K504]"	"1"	"2035.02770"	"0.014"	"0.728"	"1.37634475749695E-05"	"0.906515362333117"	"47.79"	"52.22"	"178.3"	"2.4"	"119.3"	"39.00"	"28.43"	"25.03"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.65E-08"	"5.66"	"49.51"
"50434"	"False"	"High"	"[R].NLDLDSIIAEVK.[A]"	""	"0.0002625"	"0.000721313"	"1"	"1"	"3"	"Q8VED5"	"Q8VED5 [304-315]"	""	"0"	"1329.72602"	"51.823"	"0.955"	"0.975052343286225"	"0.906515362333117"	"102.00"	"91.72"	"5.7"	"288.5"	"5.8"	"129.56"	"222.84"	"56.13"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.404E-05"	"3.27"	"58.52"
"50490"	"False"	"High"	"[K].NIFSFYLNR.[D]"	""	"0.002335"	"0.000721313"	"1"	"1"	"34"	"P18242"	"P18242 [225-233]"	""	"0"	"1173.60512"	"152.908"	"5.079"	"0.925138005747468"	"0.906515362333117"	"41.59"	"44.30"	"1.7"	"288.1"	"10.2"	"36.90"	"21.73"	"35.41"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001923"	"2.85"	"55.30"
"51930"	"False"	"High"	"[K].NVLITPGKSQIDLR.[K]"	"1xBiotin [K8]"	"0.000213982"	"0.000721313"	"1"	"1"	"34"	"Q8BHE0"	"Q8BHE0 [291-304]"	"Q8BHE0 1xBiotin [K298]"	"1"	"1779.97856"	"0.013"	"0.659"	"1.16364095154626E-05"	"0.906515362333117"	"40.06"	"62.38"	"172.9"	"2.1"	"125.0"	"37.08"	"23.47"	"60.29"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.973E-05"	"3.45"	"48.30"
"51889"	"False"	"High"	"[R].NVGFESDSGGAFKGFK.[G]"	"1xBiotin [K]"	"0.000170163"	"0.000721313"	"1"	"1"	"12"	"Q9JIH2"	"Q9JIH2 [47-62]"	"Q9JIH2 1xBiotin [K]"	"1"	"1872.85851"	"0.315"	"0.824"	"0.925138005747468"	"0.906515362333117"	"85.70"	"108.08"	"134.5"	"42.3"	"123.2"	"66.21"	"23.05"	"78.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.582E-05"	"3.16"	"48.68"
"51847"	"False"	"High"	"[R].NVDANNTENSTTVKNSSLLSGFR.[G]"	"1xBiotin [K14]"	"0.000624652"	"0.000721313"	"1"	"5"	"6"	"A2AAE1-1"	"A2AAE1-1 [4775-4797]"	"A2AAE1-1 1xBiotin [K4788]"	"1"	"2694.27878"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"5.502E-05"	"3.43"	""
"51840"	"False"	"High"	"[R].NVASVCLQIGYPTVASVPHSIINGYK.[R]"	"1xCarbamidomethyl [C6]"	"0.0012041"	"0.000721313"	"1"	"1"	"4"	"P14869"	"P14869 [221-246]"	""	"0"	"2787.44981"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001028"	"4.33"	""
"51829"	"False"	"High"	"[K].NTYPKDEAHVSDEFSK.[S]"	"1xBiotin [K5]"	"0.00118929"	"0.000721313"	"1"	"2"	"13"	"Q99P72-2"	"Q99P72-2 [895-910]"	"Q99P72-2 1xBiotin [K899]"	"1"	"2092.92805"	"4.362"	"0.908"	"0.429496125575191"	"0.906515362333117"	"56.82"	"23.83"	"48.1"	"209.7"	"42.2"	"15.69"	"84.96"	"23.48"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001019"	"2.65"	"37.25"
"51735"	"False"	"High"	"[K].NTKEMFGGFFK.[S]"	"1xBiotin [K3]; 1xOxidation [M5]"	"0.000484596"	"0.000721313"	"1"	"1"	"24"	"Q9D8U8"	"Q9D8U8 [178-188]"	"Q9D8U8 1xBiotin [K180]"	"1"	"1547.70213"	"0.072"	"0.972"	"0.0037019716687059"	"0.906515362333117"	"74.26"	"27.40"	"149.7"	"9.9"	"140.4"	"19.65"	"62.50"	"25.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.305E-05"	"3.51"	"51.17"
"51734"	"False"	"High"	"[K].NTKEMFGGFFK.[S]"	"1xBiotin [K3]"	"0.000851316"	"0.000721313"	"1"	"1"	"8"	"Q9D8U8"	"Q9D8U8 [178-188]"	"Q9D8U8 1xBiotin [K180]"	"1"	"1531.70722"	"0.091"	"0.954"	"0.00521737071470257"	"0.906515362333117"	"39.94"	"26.94"	"145.4"	"14.0"	"140.6"	"15.68"	"34.39"	"35.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"7.403E-05"	"2.99"	"56.76"
"51728"	"False"	"High"	"[R].NTGGKGVNYALAPGSQTSDLSLPDGK.[V]"	"1xBiotin [K5]"	"0.000417673"	"0.000721313"	"1"	"1"	"12"	"P01902"	"P01902 [333-358]"	"P01902 1xBiotin [K337]"	"1"	"2773.34613"	"0.129"	"0.892"	"0.115133099966533"	"0.906515362333117"	"47.56"	"36.16"	"150.9"	"19.2"	"129.9"	"17.66"	"47.87"	"48.93"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.74E-05"	"4.17"	"46.93"
"51726"	"False"	"High"	"[R].NTGGKGGDYALAPGSQSSEMSLR.[D]"	"1xBiotin [K5]"	"0.00186867"	"0.000721313"	"1"	"3"	"5"	"P01896"	"P01896 [146-168]"	"P01896 1xBiotin [K150]"	"1"	"2509.14460"	"0.487"	"2.599"	"0.0619781290196313"	"0.907108336447894"	"79.43"	"114.48"	"47.9"	"30.1"	"222.1"	"95.20"	"41.52"	"45.14"	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001559"	"2.56"	"42.76"
"51652"	"False"	"High"	"[K].NSSYFVEWIPNNVK.[TV]"	""	"0.000293454"	"0.000721313"	"4"	"7"	"9"	"Q7TMM9; Q9D6F9; Q9ERD7; P99024"	"Q7TMM9 [337-350]; Q9D6F9 [337-350]; Q9ERD7 [337-350]; P99024 [337-350]"	""	"0"	"1696.83295"	"54.941"	"1.006"	"0.925138005747468"	"0.906515362333117"	"144.02"	"70.78"	"5.6"	"289.3"	"5.1"	"42.11"	"93.03"	"54.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"2.667E-05"	"2.75"	"53.37"
"51622"	"False"	"High"	"[K].NSQSFFSGLFGGSSK.[I]"	""	"0.000167031"	"0.000721313"	"1"	"1"	"6"	"Q9DB05"	"Q9DB05 [23-37]"	""	"0"	"1549.72815"	"108.746"	"1.620"	"0.925138005747468"	"0.923750342545975"	"69.28"	"71.60"	"2.7"	"292.1"	"5.2"	"56.11"	"21.66"	"44.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.555E-05"	"4.14"	"55.48"
"51426"	"False"	"High"	"[R].NRPPLAAGANSKGPPDFSSDEEREPTPVLGSGASVGR.[G]"	"1xBiotin [K12]"	"3.33814E-05"	"0.000721313"	"1"	"6"	"10"	"Q61029"	"Q61029 [49-85]"	"Q61029 1xBiotin [K60]"	"2"	"3945.91480"	"0.123"	"0.809"	"0.00681210482850374"	"0.906515362333117"	"49.04"	"58.82"	"158.0"	"20.1"	"122.0"	"37.81"	"35.75"	"53.48"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.302E-06"	"4.23"	"42.95"
"50465"	"False"	"High"	"[K].NLEIIVTNGYKGSFVQDIQSDIHTDSSR.[S]"	"1xBiotin [K11]"	"3.35888E-05"	"0.000721313"	"1"	"3"	"5"	"Q5XG73"	"Q5XG73 [221-248]"	"Q5XG73 1xBiotin [K231]"	"1"	"3362.63214"	"0.873"	"2.919"	""	"0.906515362333117"	"47.75"	"107.01"	"73.8"	"64.4"	"161.8"	"37.57"	"48.21"	"80.50"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.327E-06"	"5.64"	"60.86"
"51335"	"False"	"High"	"[K].NQNKLLAEMDSQFDSTTGFLGK.[T]"	"1xBiotin [K4]; 1xOxidation [M9]"	"0.000207457"	"0.000721313"	"1"	"1"	"3"	"O35623"	"O35623 [59-80]"	"O35623 1xBiotin [K62]"	"1"	"2686.24873"	"1.249"	"1.981"	"0.925138005747468"	"0.9973859371426"	"51.60"	"51.43"	"68.0"	"93.5"	"138.5"	"33.69"	"39.29"	"44.09"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.913E-05"	"4.87"	"52.66"
"51188"	"False"	"High"	"[R].NPPKLVTPHDR.[M]"	"1xBiotin [K4]"	"0.00215451"	"0.000721313"	"1"	"3"	"6"	"P98083-1"	"P98083-1 [318-328]"	"P98083-1 1xBiotin [K321]"	"1"	"1499.77874"	"0.206"	"0.693"	"0.925138005747468"	"0.906515362333117"	"62.54"	"35.82"	"158.0"	"36.5"	"105.5"	"57.71"	"36.97"	"30.93"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001786"	"2.56"	"31.87"
"51137"	"False"	"High"	"[R].NPGNLYDKAGK.[V]"	"1xBiotin [K8]"	"0.00026088"	"0.000721313"	"1"	"1"	"10"	"Q3TDQ1"	"Q3TDQ1 [503-513]"	"Q3TDQ1 1xBiotin [K510]"	"1"	"1402.67836"	"0.096"	"0.759"	"0.0102082121965788"	"0.906515362333117"	"65.55"	"36.24"	"156.8"	"16.4"	"126.8"	"38.65"	"52.03"	"22.18"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.381E-05"	"3.77"	"36.09"
"51033"	"False"	"High"	"[R].NNLQFGKTLGAGAFGK.[V]"	"1xBiotin [K7]"	"6.55648E-05"	"0.000721313"	"1"	"1"	"32"	"P09581"	"P09581 [578-593]"	"P09581 1xBiotin [K584]"	"1"	"1848.94251"	"0.027"	"0.661"	"5.18589010487259E-05"	"0.906515362333117"	"56.95"	"36.83"	"178.3"	"5.4"	"116.3"	"38.24"	"41.56"	"19.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.34E-06"	"4.96"	"50.66"
"51023"	"False"	"High"	"[K].NNLDPDLPYKFLK.[A]"	"1xBiotin [K]"	"0.00019743"	"0.000721313"	"1"	"1"	"31"	"Q9CXR1"	"Q9CXR1 [322-334]"	"Q9CXR1 1xBiotin [K]"	"1"	"1802.91457"	"0.048"	"0.863"	"0.000613896156679201"	"0.906515362333117"	"58.30"	"49.39"	"154.6"	"8.0"	"137.4"	"33.41"	"49.02"	"30.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.829E-05"	"3.59"	"56.98"
"50968"	"False"	"High"	"[K].NMTKTESAQLFR.[M]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.0017242"	"0.000721313"	"1"	"1"	"5"	"Q8BZ00"	"Q8BZ00 [515-526]"	"Q8BZ00 1xBiotin [K518]"	"1"	"1667.78799"	"0.436"	"0.766"	"0.929016530787821"	"0.906515362333117"	"66.64"	"67.14"	"136.0"	"65.1"	"98.9"	"49.47"	"40.02"	"32.31"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001442"	"3.00"	"40.35"
"50887"	"False"	"High"	"[K].NMAEQIIQEIYSQVQSK.[K]"	"1xOxidation [M2]"	"0.00109055"	"0.000721313"	"1"	"1"	"7"	"P40142"	"P40142 [265-281]"	""	"0"	"2024.99573"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"9.359E-05"	"3.28"	""
"50886"	"False"	"High"	"[K].NMAEQIIQEIYSQVQSK.[K]"	""	"0.000475676"	"0.000721313"	"1"	"1"	"6"	"P40142"	"P40142 [265-281]"	""	"0"	"2009.00082"	"0.792"	"1.479"	""	"0.906777072223237"	"35.47"	"91.20"	"96.4"	"73.4"	"130.1"	"35.23"	"14.06"	"66.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.243E-05"	"3.54"	"67.38"
"50873"	"False"	"High"	"[RK].NLYFLYLIELR.[A]"	""	"0.000620796"	"0.000721313"	"1"	"2"	"11"	"Q8R180"	"Q8R180 [299-309]"	""	"0"	"1456.81986"	"61.448"	"2.747"	"0.925138005747468"	"0.916215054610739"	"77.80"	"43.63"	"4.6"	"284.5"	"10.8"	"24.09"	"73.27"	"35.40"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.481E-05"	"2.67"	"66.73"
"50716"	"False"	"High"	"[R].NLPTKIPLPTTLASGSK.[S]"	"1xBiotin [K5]"	"0.00101246"	"0.000721313"	"1"	"1"	"19"	"O70472"	"O70472 [1497-1513]"	"O70472 1xBiotin [K1501]"	"1"	"1964.08851"	"0.049"	"0.684"	"0.00015805945803211"	"0.906515362333117"	"61.94"	"83.29"	"176.6"	"8.6"	"114.8"	"62.84"	"20.68"	"70.41"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.716E-05"	"2.60"	"53.49"
"50526"	"False"	"High"	"[K].NIHKALVAEHLR.[G]"	"1xBiotin [K4]"	"0.000632435"	"0.000721313"	"1"	"2"	"11"	"Q920B0"	"Q920B0 [890-901]"	"Q920B0 1xBiotin [K893]"	"1"	"1626.88969"	"0.031"	"0.779"	"6.58331229130953E-05"	"0.906515362333117"	"42.31"	"34.90"	"162.2"	"6.2"	"131.5"	"26.78"	"36.12"	"31.01"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.578E-05"	"2.38"	"36.61"
"50523"	"False"	"High"	"[K].NLGVSQKLVSPSR.[S]"	"1xBiotin [K7]"	"0.0020378"	"0.000721313"	"1"	"1"	"2"	"Q9DBS9"	"Q9DBS9 [6-18]"	"Q9DBS9 1xBiotin [K12]"	"1"	"1610.86829"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001694"	"3.22"	""
"50501"	"False"	"High"	"[K].NIGKVLLVPGPEK.[E]"	"1xBiotin [K4]"	"0.000640316"	"0.000721313"	"1"	"1"	"13"	"Q62465"	"Q62465 [392-404]"	"Q62465 1xBiotin [K395]"	"1"	"1589.90836"	"0.127"	"0.892"	"0.0253060495250863"	"0.906515362333117"	"38.26"	"30.05"	"145.4"	"20.1"	"134.5"	"23.94"	"32.56"	"21.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.621E-05"	"3.70"	"50.18"
"51334"	"False"	"High"	"[K].NQNKLLAEMDSQFDSTTGFLGK.[T]"	"1xBiotin [K4]"	"7.54157E-07"	"0.000721313"	"1"	"1"	"10"	"O35623"	"O35623 [59-80]"	"O35623 1xBiotin [K62]"	"1"	"2670.25381"	"0.762"	"7.108"	"0.925138005747468"	"0.906515362333117"	"62.34"	"67.82"	"35.1"	"29.0"	"235.9"	"49.03"	"36.22"	"53.29"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.65E-08"	"5.87"	"61.95"
"58791"	"False"	"High"	"[K].SAVTTVVNPKYEGK.[-]"	"1xBiotin [K10]"	"0.000378274"	"0.000721313"	"1"	"1"	"10"	"P09055"	"P09055 [785-798]"	"P09055 1xBiotin [K794]"	"1"	"1718.87818"	"0.157"	"0.687"	"0.380827439155979"	"0.906515362333117"	"62.35"	"67.24"	"164.0"	"26.2"	"109.8"	"46.94"	"39.50"	"61.75"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"3.401E-05"	"3.55"	"39.03"
"59282"	"False"	"High"	"[K].SEITLVTPKPEKLAPSR.[Q]"	"1xBiotin [K12]"	"0.000300814"	"0.000721313"	"1"	"2"	"10"	"Q9QXK3"	"Q9QXK3 [591-607]"	"Q9QXK3 1xBiotin [K602]"	"1"	"2092.14709"	"0.179"	"0.804"	"0.925138005747468"	"0.906515362333117"	"61.27"	"32.09"	"143.5"	"27.0"	"129.5"	"33.83"	"51.40"	"22.34"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.734E-05"	"3.07"	"43.80"
"59372"	"False"	"High"	"[K].SEVLGTQSKAFYK.[T]"	"1xBiotin [K9]"	"0.000409985"	"0.000721313"	"1"	"1"	"9"	"Q9CQW1"	"Q9CQW1 [174-186]"	"Q9CQW1 1xBiotin [K182]"	"1"	"1683.84107"	"0.445"	"1.616"	"0.925138005747468"	"0.995674964380212"	"77.07"	"85.16"	"106.8"	"45.5"	"147.7"	"60.90"	"45.75"	"63.05"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"3.668E-05"	"3.21"	"42.55"
"62688"	"False"	"High"	"[K].STVGTTKPPAESVYTSLQR.[R]"	"1xBiotin [K7]"	"0.000210043"	"0.000721313"	"1"	"3"	"15"	"Q8R4V1"	"Q8R4V1 [202-220]"	"Q8R4V1 1xBiotin [K208]"	"0"	"2248.12781"	"0.104"	"0.797"	"0.925138005747468"	"0.906515362333117"	"36.46"	"32.15"	"158.0"	"17.2"	"124.7"	"12.86"	"55.82"	"39.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.933E-05"	"3.87"	"44.64"
"62669"	"False"	"High"	"[R].STTKVGNIEIK.[D]"	"1xBiotin [K4]"	"0.00167166"	"0.000721313"	"1"	"1"	"11"	"P61161"	"P61161 [43-53]"	"P61161 1xBiotin [K46]"	"1"	"1415.75628"	"0.097"	"0.824"	"0.00604738589668529"	"0.906515362333117"	"76.89"	"57.76"	"145.5"	"15.5"	"139.0"	"49.40"	"55.62"	"40.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001407"	"3.37"	"40.41"
"62523"	"False"	"High"	"[K].STCKNFLDTYSPSDK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.000336285"	"0.000721313"	"1"	"2"	"8"	"Q3U3D7-1"	"Q3U3D7-1 [930-944]"	"Q3U3D7-1 1xBiotin [K933]"	"1"	"1988.87284"	"0.266"	"0.672"	"0.925138005747468"	"0.906515362333117"	"49.13"	"44.44"	"145.9"	"42.1"	"112.0"	"53.14"	"41.50"	"29.75"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.046E-05"	"3.40"	"45.71"
"62482"	"False"	"High"	"[R].SSVSKVPLLLPNVSALESQIEMGNIVKPK.[V]"	"1xBiotin [K5]; 1xOxidation [M22]"	"3.7783E-05"	"0.000721313"	"1"	"2"	"21"	"Q99P72-2"	"Q99P72-2 [913-941]"	"Q99P72-2 1xBiotin [K917]"	"1"	"3319.80040"	"0.884"	"18.305"	""	"0.906515362333117"	"74.77"	"71.43"	"14.2"	"12.1"	"273.7"	"54.63"	"34.26"	"23.36"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.716E-06"	"5.29"	"63.69"
"62481"	"False"	"High"	"[R].SSVSKVPLLLPNVSALESQIEMGNIVKPK.[V]"	"1xBiotin [K5]"	"0.000349015"	"0.000721313"	"1"	"2"	"13"	"Q99P72-2"	"Q99P72-2 [913-941]"	"Q99P72-2 1xBiotin [K917]"	"1"	"3303.80548"	"0.853"	"26.975"	""	"0.625665755000974"	"44.21"	"65.50"	"12.6"	"10.2"	"277.3"	"31.86"	"40.13"	"47.89"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.144E-05"	"3.82"	"64.36"
"62392"	"False"	"High"	"[R].SSSLNSKPSSLR.[R]"	"1xBiotin [K7]"	"0.000108947"	"0.000721313"	"1"	"1"	"32"	"Q60664"	"Q60664 [345-356]"	"Q60664 1xBiotin [K351]"	"0"	"1488.74750"	"0.022"	"0.971"	"3.61097378948738E-05"	"0.911771194994466"	"525.84"	"28.32"	"145.0"	"3.4"	"151.6"	"17.27"	"119.61"	"20.70"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.029E-05"	"3.08"	"35.17"
"62322"	"False"	"High"	"[K].SSPTGFGIKSAVTGGK.[E]"	"1xBiotin [K9]"	"9.79405E-06"	"0.000721313"	"1"	"2"	"23"	"Q3UPF5-1"	"Q3UPF5-1 [489-504]"	"Q3UPF5-1 1xBiotin [K497]"	"1"	"1719.87343"	"0.032"	"0.781"	"0.000141510306527739"	"0.906515362333117"	"35.00"	"37.67"	"169.7"	"4.8"	"125.5"	"23.58"	"32.01"	"25.31"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.017E-06"	"4.24"	"46.65"
"62291"	"False"	"High"	"[K].SSNMKHLSPAPQLGPSSDSHTSYYSESVVR.[E]"	"1xBiotin [K5]; 1xOxidation [M4]"	"0.000158957"	"0.000721313"	"1"	"3"	"9"	"Q8BJS4"	"Q8BJS4 [48-77]"	"Q8BJS4 1xBiotin [K52]"	"1"	"3490.60019"	"0.171"	"0.686"	"0.925138005747468"	"0.906515362333117"	"54.28"	"108.77"	"206.5"	"31.1"	"62.4"	"47.19"	"38.27"	"87.57"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.484E-05"	"4.28"	"39.66"
"62290"	"False"	"High"	"[K].SSNMKHLSPAPQLGPSSDSHTSYYSESVVR.[E]"	"1xBiotin [K5]"	"1.27825E-05"	"0.000721313"	"1"	"3"	"6"	"Q8BJS4"	"Q8BJS4 [48-77]"	"Q8BJS4 1xBiotin [K52]"	"1"	"3474.60528"	"0.813"	"1.660"	"0.127295386907666"	"0.988361298004968"	"52.06"	"78.10"	"88.8"	"70.8"	"140.4"	"109.85"	"27.69"	"68.84"	""	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"1.312E-06"	"4.82"	"41.90"
"62257"	"False"	"High"	"[R].SSITPGTVLIILTGR.[H]"	""	"0.000162944"	"0.000721313"	"1"	"1"	"49"	"P47911"	"P47911 [150-164]"	""	"0"	"1527.91047"	"148.022"	"5.250"	"0.925138005747468"	"0.906515362333117"	"72.26"	"79.42"	"2.1"	"285.8"	"12.0"	"69.95"	"43.90"	"47.87"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.515E-05"	"3.08"	"63.51"
"62252"	"False"	"High"	"[R].SSISHSVLSEMQMIEQETPLSAKSSR.[S]"	"1xBiotin [K23]; 1xOxidation [M]"	"3.59124E-06"	"0.000721313"	"1"	"2"	"5"	"Q99K28"	"Q99K28 [313-338]"	"Q99K28 1xBiotin [K335]"	"1"	"3104.46970"	"0.782"	"3.788"	""	"0.906515362333117"	"45.27"	"76.06"	"51.2"	"40.6"	"208.2"	"27.43"	"36.70"	"54.07"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"3.896E-07"	"5.65"	"59.70"
"62213"	"False"	"High"	"[K].SSKSSDLTSDLGNVLTSSNAK.[A]"	"1xBiotin [K3]"	"1.80592E-06"	"0.000721313"	"1"	"3"	"21"	"Q5XG73"	"Q5XG73 [156-176]"	"Q5XG73 1xBiotin [K158]"	"1"	"2337.12384"	"0.162"	"0.699"	"0.389745663125246"	"0.906515362333117"	"59.14"	"86.03"	"157.0"	"29.3"	"113.8"	"39.05"	"47.13"	"84.79"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.009E-07"	"5.11"	"52.32"
"62702"	"False"	"High"	"[K].STWVILHHKVYDLTK.[F]"	"1xBiotin [K]"	"4.411E-05"	"0.000721313"	"1"	"1"	"41"	"P56395"	"P56395 [25-39]"	"P56395 1xBiotin [K]"	"1"	"2066.08918"	"0.012"	"2.275"	"1.13151529478306E-05"	"0.906515362333117"	"80.63"	"71.42"	"88.0"	"0.9"	"211.1"	"67.40"	"222.76"	"32.47"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.328E-06"	"3.97"	"50.81"
"62168"	"False"	"High"	"[R].SSGSPYGGGYGSGGGSGGYGSR.[R]"	""	"5.01126E-07"	"0.000721313"	"1"	"2"	"15"	"Q8BG05"	"Q8BG05 [356-377]"	""	"0"	"1910.78997"	"157.414"	"4.582"	"0.925138005747468"	"0.906515362333117"	"55.06"	"71.44"	"2.1"	"291.6"	"6.2"	"47.53"	"40.92"	"62.24"	"MandatoryModificationMissing"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.865E-08"	"5.54"	"25.90"
"62157"	"False"	"High"	"[R].SSGLTAVWVAR.[N]"	""	"0.000900101"	"0.000721313"	"1"	"1"	"7"	"Q8CIE6"	"Q8CIE6 [413-423]"	""	"0"	"1146.62658"	"153.964"	"2.467"	"0.427089858136149"	"0.909223670800027"	"48.44"	"50.19"	"1.7"	"293.9"	"4.4"	"39.37"	"20.23"	"39.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"7.779E-05"	"2.83"	"42.32"
"62129"	"False"	"High"	"[R].SSFFVNGLTLGGQK.[C]"	""	"0.000115192"	"0.000721313"	"1"	"1"	"23"	"P62962"	"P62962 [57-70]"	""	"0"	"1454.76380"	"146.381"	"5.821"	"0.925138005747468"	"0.906515362333117"	"75.81"	"74.52"	"1.8"	"288.8"	"9.3"	"60.05"	"36.35"	"48.54"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.086E-05"	"3.52"	"49.92"
"62043"	"False"	"High"	"[R].SSAAVKSSSLTR.[T]"	"1xBiotin [K6]"	"0.00189194"	"0.000721313"	"1"	"5"	"7"	"A2AAE1-1"	"A2AAE1-1 [2315-2326]"	"A2AAE1-1 1xBiotin [K2320]"	"1"	"1419.72604"	"0.336"	"0.453"	"0.925138005747468"	"0.906515362333117"	"71.53"	"99.39"	"165.9"	"55.7"	"78.4"	"86.65"	"23.69"	"94.46"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.000158"	"3.03"	"32.08"
"61971"	"False"	"High"	"[K].SRPGSVVPANLFQGIKTVNPTFR.[G]"	"1xBiotin [K16]"	"2.94562E-06"	"0.000721313"	"1"	"2"	"7"	"Q8R5K2"	"Q8R5K2 [212-234]"	"Q8R5K2 1xBiotin [K227]"	"1"	"2711.44500"	"0.931"	"3.751"	""	"0.906515362333117"	"55.88"	"91.57"	"51.9"	"45.8"	"202.4"	"39.01"	"24.99"	"65.63"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.212E-07"	"6.22"	"57.71"
"61913"	"False"	"High"	"[K].SRFWYFVSQLKK.[M]"	""	"0.0019274"	"0.000721313"	"1"	"1"	"13"	"P62717"	"P62717 [42-53]"	""	"2"	"1588.86346"	"136.971"	"4.530"	"0.928611703535518"	"0.906515362333117"	"63.18"	"86.61"	"2.8"	"285.1"	"12.1"	"48.02"	"65.00"	"75.50"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001604"	"3.40"	"49.33"
"61865"	"False"	"High"	"[K].SQWNNDNPLFKSATTTVMNPK.[F]"	"1xBiotin [K11]; 1xOxidation [M18]"	"0.00101875"	"0.000721313"	"1"	"1"	"63"	"P11835"	"P11835 [747-767]"	"P11835 1xBiotin [K757]"	"1"	"2635.22793"	"1.051"	"0.816"	"0.061716707855262"	"0.906515362333117"	"79.36"	"39.65"	"91.2"	"136.2"	"72.7"	"32.81"	"54.56"	"14.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.784E-05"	"3.69"	"49.30"
"61864"	"False"	"High"	"[K].SQWNNDNPLFKSATTTVMNPK.[F]"	"1xBiotin [K11]"	"1.17937E-05"	"0.000721313"	"1"	"1"	"41"	"P11835"	"P11835 [747-767]"	"P11835 1xBiotin [K757]"	"1"	"2619.23302"	"0.011"	"1.124"	"9.40268443827552E-06"	"0.937945192250145"	"56.58"	"56.05"	"144.3"	"1.7"	"154.0"	"44.99"	"26.52"	"23.60"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.217E-06"	"4.91"	"53.55"
"61729"	"False"	"High"	"[R].SQLDLFDDVGTFASGPPKYK.[D]"	"1xBiotin [K]"	"7.65439E-05"	"0.000721313"	"1"	"2"	"15"	"Q99K28"	"Q99K28 [339-358]"	"Q99K28 1xBiotin [K]"	"1"	"2411.15877"	"0.421"	"1.545"	"0.925138005747468"	"0.957895505221724"	"22.46"	"31.03"	"98.3"	"41.6"	"160.1"	"18.39"	"12.12"	"41.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.332E-06"	"4.52"	"59.81"
"61700"	"False"	"High"	"[K].SQGLSQLYHNQSQGLLSQLQGQSK.[D]"	""	"0.002335"	"0.000721313"	"1"	"1"	"3"	"Q62448"	"Q62448 [431-454]"	""	"0"	"2629.33287"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001919"	"4.05"	""
"61647"	"False"	"High"	"[K].SPYQEFTDHLVKTHTR.[V]"	"1xBiotin [K12]"	"0.000219348"	"0.000721313"	"1"	"1"	"15"	"P25444"	"P25444 [264-279]"	"P25444 1xBiotin [K275]"	"1"	"2185.04950"	"0.063"	"1.018"	"0.00160523259630558"	"0.906515362333117"	"70.01"	"50.87"	"137.2"	"9.5"	"153.4"	"55.07"	"59.77"	"28.54"	""	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.012E-05"	"3.33"	"44.25"
"61637"	"False"	"High"	"[R].SPVVELSKVPLIQR.[G]"	"1xBiotin [K8]"	"2.25975E-05"	"0.000721313"	"1"	"1"	"25"	"Q99MK8"	"Q99MK8 [670-683]"	"Q99MK8 1xBiotin [K677]"	"1"	"1791.01970"	"0.068"	"1.087"	"0.000404596096466985"	"0.927892136092816"	"38.93"	"28.66"	"144.0"	"9.8"	"146.1"	"37.49"	"27.09"	"17.09"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.279E-06"	"2.81"	"53.78"
"61617"	"False"	"High"	"[R].SPVEKPHNGALFPQQGDFQYR.[N]"	"1xBiotin [K5]"	"0.00118195"	"0.000721313"	"1"	"1"	"3"	"Q8CD26"	"Q8CD26 [363-383]"	"Q8CD26 1xBiotin [K367]"	"0"	"2641.26162"	"0.980"	"1.192"	""	"0.906515362333117"	"45.78"	"52.07"	"90.8"	"100.9"	"108.3"	"36.93"	"33.54"	"53.83"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001008"	"3.61"	"45.77"
"62163"	"False"	"High"	"[R].SSGPYGGGGQYFAKPR.[N]"	""	"0.000115908"	"0.000721313"	"1"	"1"	"13"	"P49312-1"	"P49312-1 [285-300]"	""	"0"	"1628.78158"	"553.631"	"1.607"	"0.84176381074239"	"0.963994276545741"	"79.73"	"96.93"	"0.8"	"298.3"	"0.9"	"49.63"	"96.10"	"149.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.095E-05"	"3.16"	"29.23"
"61545"	"False"	"High"	"[R].SPSKAVAAR.[A]"	"1xBiotin [K4]"	"0.00214122"	"0.000721313"	"1"	"1"	"29"	"Q9CQS8"	"Q9CQS8 [17-25]"	"Q9CQS8 1xBiotin [K20]"	"1"	"1112.58809"	"0.004"	"0.834"	"1.3450226807559E-06"	"0.906515362333117"	"52.26"	"41.73"	"164.2"	"0.8"	"135.0"	"38.17"	"47.26"	"27.24"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001776"	"3.36"	"26.14"
"62716"	"False"	"High"	"[K].SVAGKMAVLANGVMNSLQDR.[Y]"	"1xBiotin [K5]"	"4.21345E-07"	"0.000721313"	"1"	"2"	"7"	"Q99K28"	"Q99K28 [497-516]"	"Q99K28 1xBiotin [K501]"	"1"	"2287.13555"	"1.085"	"1.748"	""	"0.927892136092816"	"44.99"	"82.52"	"87.2"	"97.9"	"114.9"	"42.63"	"24.24"	"136.14"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.956E-08"	"6.63"	"67.70"
"62721"	"False"	"High"	"[K].SVAKTQDPQTAGR.[I]"	"1xBiotin [K4]"	"5.11785E-05"	"0.000721313"	"1"	"2"	"13"	"Q3UPF5-1"	"Q3UPF5-1 [431-443]"	"Q3UPF5-1 1xBiotin [K434]"	"1"	"1584.77987"	"0.207"	"0.743"	"0.925138005747468"	"0.906515362333117"	"37.54"	"31.83"	"152.8"	"35.5"	"111.6"	"27.10"	"25.98"	"20.53"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5E-06"	"3.89"	"26.30"
"63942"	"False"	"High"	"[K].TGGSSKFDWAAR.[F]"	"1xBiotin [K6]"	"0.000478631"	"0.000721313"	"1"	"1"	"4"	"G5E870"	"G5E870 [254-265]"	"G5E870 1xBiotin [K259]"	"1"	"1508.69507"	"0.377"	"0.833"	"0.925138005747468"	"0.906515362333117"	"71.36"	"66.85"	"136.5"	"55.2"	"108.3"	"41.13"	"56.29"	"60.32"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"4.269E-05"	"3.27"	"46.25"
"63866"	"False"	"High"	"[K].TFVSITPAEVGVLVGKDR.[S]"	"1xBiotin [K16]"	"4.04466E-05"	"0.000721313"	"1"	"1"	"28"	"P62962"	"P62962 [39-56]"	"P62962 1xBiotin [K54]"	"1"	"2114.13144"	"0.328"	"4.068"	"0.925138005747468"	"0.906515362333117"	"87.42"	"86.58"	"62.6"	"25.8"	"211.7"	"72.00"	"42.25"	"30.59"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.982E-06"	"4.50"	"61.14"
"63775"	"False"	"High"	"[R].TFFSFPAVVAPFK.[C]"	""	"0.0019274"	"0.000721313"	"1"	"1"	"14"	"Q9CZD3"	"Q9CZD3 [593-605]"	""	"0"	"1457.78275"	"150.969"	"4.512"	"0.815031019872958"	"0.906515362333117"	"45.94"	"60.81"	"2.1"	"286.8"	"11.1"	"45.61"	"23.23"	"32.53"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001609"	"2.91"	"62.04"
"63418"	"False"	"High"	"[K].TCSGLKSTVGTTKPPAESVYTSLQR.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C2]"	"0.000256078"	"0.000721313"	"1"	"3"	"11"	"Q8R4V1"	"Q8R4V1 [196-220]"	"Q8R4V1 1xBiotin [K201]"	"1"	"2894.43865"	"0.144"	"0.528"	"0.166393307382437"	"0.906515362333117"	"61.56"	"47.05"	"181.4"	"27.0"	"91.7"	"61.17"	"31.58"	"29.49"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.339E-05"	"3.67"	"44.14"
"63279"	"False"	"High"	"[R].TANPSKTIDLGAAAHYTGDK.[A]"	"1xBiotin [K6]"	"3.84916E-05"	"0.000721313"	"1"	"2"	"12"	"Q99KN9-1"	"Q99KN9-1 [286-305]"	"Q99KN9-1 1xBiotin [K291]"	"1"	"2257.09176"	"0.113"	"0.970"	"0.00618834630488763"	"0.906515362333117"	"24.26"	"21.16"	"144.5"	"16.2"	"139.4"	"18.43"	"23.95"	"19.86"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.802E-06"	"4.35"	"42.05"
"63199"	"False"	"High"	"[R].TAFPKGGWALAQTENQPK.[F]"	"1xBiotin [K5]"	"0.000878083"	"0.000721313"	"1"	"1"	"32"	"P97465"	"P97465 [117-134]"	"P97465 1xBiotin [K121]"	"1"	"2170.07498"	"0.081"	"0.713"	"0.00398597955031915"	"0.906515362333117"	"48.00"	"36.60"	"166.2"	"15.7"	"118.1"	"34.07"	"34.18"	"22.86"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.609E-05"	"4.05"	"49.74"
"63188"	"False"	"High"	"[R].TAEKTPSLTK.[K]"	"1xBiotin [K4]"	"0.000587146"	"0.000721313"	"1"	"1"	"12"	"Q60989"	"Q60989 [354-363]"	"Q60989 1xBiotin [K357]"	"1"	"1301.67696"	"0.043"	"0.695"	"6.84008745533897E-05"	"0.906515362333117"	"100.39"	"39.47"	"177.1"	"6.3"	"116.6"	"28.14"	"157.18"	"26.89"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.181E-05"	"2.81"	"31.63"
"63152"	"False"	"High"	"[K].TAAKSVWETR.[V]"	"1xBiotin [K4]"	"0.00232059"	"0.000721313"	"1"	"1"	"5"	"Q91WC9"	"Q91WC9 [187-196]"	"Q91WC9 1xBiotin [K190]"	"1"	"1374.68345"	"0.157"	"0.758"	"0.0126274406772723"	"0.906515362333117"	"45.38"	"39.38"	"143.8"	"23.8"	"132.3"	"35.53"	"22.37"	"30.80"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001908"	"3.30"	"39.28"
"63091"	"False"	"High"	"[K].SYIITGGLGGFGLELAR.[W]"	""	"0.0011674"	"0.000721313"	"1"	"1"	"5"	"P19096"	"P19096 [1879-1895]"	""	"0"	"1723.93775"	"21.009"	"0.906"	"0.925138005747468"	"0.906515362333117"	"113.42"	"46.43"	"12.0"	"275.3"	"12.7"	"29.84"	"85.61"	"34.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001001"	"3.01"	"59.54"
"63081"	"False"	"High"	"[K].SYKGGPGSAVSPYPSFNVSSDVAALHK.[A]"	"1xBiotin [K3]"	"0.000149412"	"0.000721313"	"1"	"1"	"7"	"P10107"	"P10107 [27-53]"	"P10107 1xBiotin [K29]"	"1"	"2948.42472"	"1.120"	"1.213"	""	"0.916215054610739"	"42.18"	"60.41"	"88.3"	"94.1"	"117.6"	"19.88"	"35.98"	"97.34"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.392E-05"	"4.50"	"50.27"
"63063"	"False"	"High"	"[R].SYETMLSFGKR.[S]"	"1xBiotin [K10]; 1xOxidation [M5]"	"0.000436176"	"0.000721313"	"1"	"1"	"62"	"Q8K072"	"Q8K072 [114-124]"	"Q8K072 1xBiotin [K123]"	"1"	"1560.71851"	"0.011"	"0.547"	"9.94791829596331E-06"	"0.906515362333117"	"27.25"	"41.47"	"188.6"	"2.3"	"109.0"	"35.44"	"17.18"	"35.70"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.894E-05"	"3.19"	"44.05"
"63062"	"False"	"High"	"[R].SYETMLSFGKR.[S]"	"1xBiotin [K10]"	"0.000207457"	"0.000721313"	"1"	"1"	"25"	"Q8K072"	"Q8K072 [114-124]"	"Q8K072 1xBiotin [K123]"	"1"	"1544.72360"	"0.009"	"0.753"	"7.37334996085447E-06"	"0.906515362333117"	"32.53"	"25.01"	"166.0"	"1.5"	"132.4"	"19.94"	"29.56"	"9.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.911E-05"	"3.68"	"50.63"
"62717"	"False"	"High"	"[K].SVAGKMAVLANGVMNSLQDR.[Y]"	"1xBiotin [K5]; 1xOxidation [M]"	"6.00458E-06"	"0.000721313"	"1"	"2"	"16"	"Q99K28"	"Q99K28 [497-516]"	"Q99K28 1xBiotin [K501]"	"1"	"2303.13047"	"0.524"	"5.182"	"0.925138005747468"	"0.906515362333117"	"63.77"	"47.88"	"44.9"	"24.2"	"230.9"	"40.88"	"52.40"	"14.08"	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.367E-07"	"6.10"	"62.92"
"63059"	"False"	"High"	"[K].SYENQKPPFDAKNPFLAAVTTNR.[K]"	"1xBiotin [K]"	"1.34317E-05"	"0.000721313"	"1"	"1"	"10"	"P37040"	"P37040 [268-290]"	"P37040 1xBiotin [K]"	"1"	"2834.39302"	"0.616"	"1.870"	"0.94340856990521"	"0.96247554139247"	"122.78"	"65.67"	"89.2"	"37.7"	"173.1"	"63.23"	"215.41"	"51.74"	""	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.379E-06"	"4.77"	"55.09"
"63006"	"False"	"High"	"[R].SWAMLFASGGFK.[V]"	"1xOxidation [M4]"	"0.00193936"	"0.000721313"	"1"	"1"	"12"	"Q99KP3"	"Q99KP3 [20-31]"	""	"0"	"1317.62962"	"169.830"	"2.922"	"0.452450488043485"	"0.906515362333117"	"80.24"	"81.22"	"1.3"	"293.9"	"4.9"	"61.55"	"42.47"	"47.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000162"	"2.81"	"55.93"
"62999"	"False"	"High"	"[R].SVYAHFPINVVIQENGSLVEIR.[N]"	""	"7.98371E-06"	"0.000721313"	"1"	"1"	"11"	"P51410"	"P51410 [94-115]"	""	"0"	"2484.32453"	"79.566"	"1.363"	"0.508455572107838"	"0.916215054610739"	"83.93"	"64.67"	"3.5"	"292.9"	"3.6"	"29.65"	"77.09"	"77.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.356E-07"	"5.63"	"57.05"
"62981"	"False"	"High"	"[K].SVVKSADEVLFSGVK.[E]"	"1xBiotin [K4]"	"0.000475676"	"0.000721313"	"1"	"1"	"4"	"Q9D8U8"	"Q9D8U8 [189-203]"	"Q9D8U8 1xBiotin [K192]"	"1"	"1790.93570"	"0.179"	"0.238"	"0.925138005747468"	"0.906515362333117"	"66.93"	"82.87"	"205.2"	"40.9"	"53.8"	"32.23"	"213.28"	"116.35"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"4.229E-05"	"3.19"	"53.01"
"62963"	"False"	"High"	"[K].SVTAFFNWLR.[E]"	""	"0.00154242"	"0.000721313"	"1"	"2"	"23"	"Q6NZJ6"	"Q6NZJ6 [1581-1590]"	""	"0"	"1240.64732"	"160.652"	"4.552"	"0.925138005747468"	"0.906515362333117"	"56.07"	"57.61"	"1.6"	"291.1"	"7.3"	"28.81"	"40.09"	"48.25"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001301"	"2.94"	"61.65"
"62873"	"False"	"High"	"[K].SVLVDFLIGSGLK.[T]"	""	"0.00113182"	"0.000721313"	"1"	"1"	"6"	"Q9JHU9"	"Q9JHU9 [313-325]"	""	"0"	"1347.78823"	"9.639"	"1.706"	"0.995331863866992"	"0.99222742129649"	"186.60"	"94.60"	"32.8"	"216.9"	"50.3"	"52.45"	"145.72"	"80.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"9.725E-05"	"3.15"	"62.86"
"62868"	"False"	"High"	"[K].SVISGGLDALEFIGKK.[T]"	"1xBiotin [K]"	"5.01746E-06"	"0.000721313"	"1"	"2"	"23"	"Q8VE88"	"Q8VE88 [164-179]"	"Q8VE88 1xBiotin [K]"	"1"	"1859.99355"	"0.078"	"1.425"	"0.00587526965505829"	"0.975839779844258"	"57.75"	"61.87"	"116.2"	"10.0"	"173.8"	"37.09"	"50.55"	"44.63"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.371E-07"	"5.33"	"61.55"
"62846"	"False"	"High"	"[K].SVLGFKASEAER.[Q]"	"1xBiotin [K6]"	"0.000116628"	"0.000721313"	"1"	"3"	"21"	"Q3ZK22-1"	"Q3ZK22-1 [588-599]"	"Q3ZK22-1 1xBiotin [K593]"	"1"	"1519.75734"	"0.036"	"0.685"	"9.06719145300864E-05"	"0.906515362333117"	"48.82"	"37.58"	"173.7"	"6.5"	"119.8"	"33.41"	"29.00"	"15.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.102E-05"	"3.50"	"44.28"
"62815"	"False"	"High"	"[K].SVKLSSQLSEEK.[W]"	"1xBiotin [K3]"	"0.000187887"	"0.000721313"	"1"	"1"	"19"	"Q80WJ7"	"Q80WJ7 [289-300]"	"Q80WJ7 1xBiotin [K291]"	"1"	"1560.79378"	"0.015"	"0.906"	"1.6742954059348E-05"	"0.906515362333117"	"54.56"	"39.81"	"150.6"	"2.1"	"147.3"	"21.79"	"47.14"	"30.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.741E-05"	"3.42"	"37.04"
"62803"	"False"	"High"	"[R].SVGWGNIFQLPFK.[H]"	""	"0.00012485"	"0.000721313"	"1"	"2"	"11"	"Q8VCW4"	"Q8VCW4 [321-333]"	""	"0"	"1492.79471"	"65.381"	"2.373"	"0.497595145917375"	"0.936688300042187"	"49.63"	"38.09"	"4.1"	"284.9"	"11.0"	"24.87"	"57.42"	"26.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.171E-05"	"3.31"	"63.73"
"62784"	"False"	"High"	"[K].SVFIIFFQGDQLK.[N]"	""	"0.00149541"	"0.000721313"	"1"	"3"	"3"	"Q9Z1G4"	"Q9Z1G4 [225-237]"	""	"0"	"1541.83624"	"46.492"	"1.050"	"0.925138005747468"	""	"38.23"	"45.68"	"6.9"	"286.7"	"6.4"	"40.16"	"25.43"	"34.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001263"	"2.90"	"61.94"
"62779"	"False"	"High"	"[K].SVFGGFINYFK.[S]"	""	"0.00185714"	"0.000721313"	"1"	"1"	"11"	"Q9ERB0"	"Q9ERB0 [114-124]"	""	"0"	"1278.65174"	"156.706"	"3.863"	"0.423976448584242"	"0.906515362333117"	"55.76"	"64.40"	"2.0"	"291.2"	"6.9"	"41.65"	"33.47"	"56.86"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001553"	"2.90"	"59.97"
"62725"	"False"	"High"	"[R].SVAPKPISGLSNPLFYTR.[D]"	"1xBiotin [K5]"	"1.64774E-05"	"0.000721313"	"1"	"1"	"15"	"Q05910"	"Q05910 [694-711]"	"Q05910 1xBiotin [K698]"	"0"	"2173.14742"	"0.162"	"0.824"	"0.925138005747468"	"0.906515362333117"	"49.34"	"82.32"	"149.0"	"22.6"	"128.3"	"41.88"	"30.50"	"83.88"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.68E-06"	"4.52"	"56.69"
"63024"	"False"	"High"	"[R].SWNSWQGFNPFSSGGPFR.[F]"	""	"2.78937E-05"	"0.000721313"	"1"	"1"	"10"	"Q91YW3"	"Q91YW3 [481-498]"	""	"0"	"2057.92528"	"51.968"	"3.378"	"0.925138005747468"	"0.906515362333117"	"102.31"	"82.38"	"5.5"	"280.0"	"14.5"	"35.37"	"81.76"	"67.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.783E-06"	"4.71"	"61.92"
"64002"	"False"	"High"	"[R].TGLTTLAQAVQAGYEVTVLVR.[D]"	""	"1.10855E-05"	"0.000721313"	"1"	"1"	"10"	"Q923D2"	"Q923D2 [15-35]"	""	"0"	"2190.21286"	"16.923"	"2.472"	"0.780138739760663"	"0.916215054610739"	"138.50"	"65.37"	"14.0"	"251.6"	"34.3"	"64.95"	"98.23"	"25.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.147E-06"	"4.54"	"66.89"
"61457"	"False"	"High"	"[K].SPNGKAGSQGQWGR.[A]"	"1xBiotin [K5]"	"0.000380623"	"0.000721313"	"1"	"1"	"5"	"O88455"	"O88455 [14-27]"	"O88455 1xBiotin [K18]"	"1"	"1655.77070"	"0.349"	"0.896"	"0.925138005747468"	"0.906515362333117"	"78.80"	"72.05"	"135.5"	"52.2"	"112.2"	"62.59"	"59.43"	"59.35"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"3.413E-05"	"3.12"	"31.78"
"61387"	"False"	"High"	"[R].SPGYVPGKVVPLRPAPPPK.[N]"	"1xBiotin [K8]"	"3.07992E-05"	"0.000721313"	"1"	"1"	"25"	"Q5FWI3"	"Q5FWI3 [24-42]"	"Q5FWI3 1xBiotin [K31]"	"1"	"2182.22053"	"0.040"	"0.826"	"7.19021403142048E-05"	"0.906515362333117"	"52.18"	"72.63"	"176.7"	"6.1"	"117.2"	"42.10"	"33.40"	"49.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.067E-06"	"3.71"	"43.01"
"60213"	"False"	"High"	"[R].SKVTAIKSLSIEIGHEVK.[N]"	"1xBiotin [K7]"	"1.40268E-05"	"0.000721313"	"1"	"1"	"17"	"O35623"	"O35623 [41-58]"	"O35623 1xBiotin [K47]"	"2"	"2165.19985"	"0.117"	"1.513"	"0.00742305585595135"	"0.946660454198708"	"56.30"	"63.08"	"114.1"	"12.8"	"173.1"	"48.23"	"39.55"	"63.57"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.438E-06"	"4.98"	"50.20"
"60190"	"False"	"High"	"[R].SKTPTGPDLDTSYK.[G]"	"1xBiotin [K2]"	"0.000981602"	"0.000721313"	"1"	"4"	"15"	"Q6ZWR6-1"	"Q6ZWR6-1 [8361-8374]"	"Q6ZWR6-1 1xBiotin [K8362]"	"1"	"1735.82073"	"0.049"	"0.711"	"0.00144419930430241"	"0.906515362333117"	"53.45"	"42.67"	"171.9"	"9.4"	"118.7"	"24.86"	"48.08"	"28.78"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.464E-05"	"3.15"	"37.38"
"60181"	"False"	"High"	"[R].SKTFPACDGSHNK.[H]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"8.81533E-06"	"0.000721313"	"1"	"1"	"136"	"Q9CQB5"	"Q9CQB5 [104-116]"	"Q9CQB5 1xBiotin [K105]"	"1"	"1674.73629"	"0.002"	"0.855"	"2.31273379447394E-07"	"0.906515362333117"	"73.26"	"37.56"	"154.1"	"0.3"	"145.6"	"33.32"	"63.00"	"24.63"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.2E-07"	"4.66"	"29.84"
"60170"	"False"	"High"	"[R].SKSLSPGLLGYQQPSLLAAPLGLADAHR.[S]"	"1xBiotin [K2]"	"0.000125625"	"0.000721313"	"1"	"2"	"5"	"Q60591-3"	"Q60591-3 [757-784]"	"Q60591-3 1xBiotin [K758]"	"1"	"3086.64555"	"0.709"	"2.976"	""	"0.906515362333117"	"70.23"	"63.77"	"67.1"	"39.4"	"193.5"	"51.00"	"43.47"	"43.49"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0001059"	"1.178E-05"	"5.31"	"60.03"
"60152"	"False"	"High"	"[R].SKRPFYIEPTNIVNVNDVIQR.[V]"	"1xBiotin [K2]"	"0.000158957"	"0.000721313"	"1"	"1"	"1"	"Q8BGD6"	"Q8BGD6 [35-55]"	"Q8BGD6 1xBiotin [K36]"	"1"	"2728.42393"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"1.479E-05"	"4.69"	""
"60136"	"False"	"High"	"[K].SKPQDSDKLNSLSIPSVSKR.[V]"	"1xBiotin [K19]"	"3.33814E-05"	"0.000721313"	"1"	"1"	"21"	"P49070"	"P49070 [63-82]"	"P49070 1xBiotin [K81]"	"2"	"2412.25513"	"0.039"	"0.970"	"9.79751068405119E-05"	"0.910839562184371"	"47.74"	"47.00"	"144.6"	"6.7"	"148.8"	"36.11"	"38.44"	"40.48"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.298E-06"	"4.37"	"41.09"
"60100"	"False"	"High"	"[K].SKLNVLTLK.[K]"	"1xBiotin [K2]"	"0.00105731"	"0.000721313"	"1"	"2"	"12"	"Q3UBG2"	"Q3UBG2 [18-26]"	"Q3UBG2 1xBiotin [K19]"	"1"	"1241.72861"	"0.091"	"0.815"	"0.0041333639999365"	"0.906515362333117"	"48.44"	"26.98"	"153.9"	"15.6"	"130.4"	"27.67"	"44.91"	"19.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.108E-05"	"3.26"	"49.20"
"60074"	"False"	"High"	"[K].SKHLQEQLNELK.[T]"	"1xBiotin [K2]"	"6.76268E-05"	"0.000721313"	"1"	"2"	"19"	"P46662-1"	"P46662-1 [532-543]"	"P46662-1 1xBiotin [K533]"	"1"	"1692.87377"	"0.022"	"0.614"	"3.61097378948738E-05"	"0.906515362333117"	"48.65"	"49.26"	"180.5"	"4.7"	"114.8"	"40.89"	"40.01"	"26.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.533E-06"	"3.89"	"38.68"
"60015"	"False"	"High"	"[K].SKDVNGPEPLNSR.[S]"	"1xBiotin [K2]"	"3.23636E-05"	"0.000721313"	"1"	"1"	"32"	"P61022"	"P61022 [99-111]"	"P61022 1xBiotin [K100]"	"1"	"1638.79043"	"0.011"	"0.794"	"9.24583087648604E-06"	"0.906515362333117"	"83.18"	"43.44"	"168.5"	"1.9"	"129.7"	"31.24"	"235.28"	"29.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.202E-06"	"4.02"	"34.37"
"59977"	"False"	"High"	"[K].SHYADVDPENQNFLLESNLGKK.[K]"	"1xBiotin [K]"	"9.36695E-07"	"0.000721313"	"1"	"1"	"17"	"Q8CFE6"	"Q8CFE6 [39-60]"	"Q8CFE6 1xBiotin [K]"	"1"	"2744.29845"	"0.075"	"0.956"	"0.0011260787405521"	"0.906515362333117"	"41.62"	"32.15"	"151.6"	"11.6"	"136.8"	"18.45"	"44.91"	"17.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.065E-07"	"6.29"	"48.77"
"59901"	"False"	"High"	"[R].SHPSLEPQAKGPCVIAPVR.[A]"	"1xBiotin [K10]; 1xCarbamidomethyl [C13]"	"1.11543E-05"	"0.000721313"	"1"	"1"	"14"	"Q8BH02"	"Q8BH02 [4-22]"	"Q8BH02 1xBiotin [K13]"	"1"	"2269.15800"	"0.057"	"0.567"	"0.00145095643435934"	"0.906515362333117"	"46.50"	"47.90"	"172.0"	"11.4"	"116.6"	"35.72"	"29.48"	"31.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.152E-06"	"4.72"	"41.35"
"59894"	"False"	"High"	"[K].SHNIVQKTALNWR.[L]"	"1xBiotin [K7]"	"0.00027927"	"0.000721313"	"1"	"8"	"15"	"P11881-1"	"P11881-1 [1565-1577]"	"P11881-1 1xBiotin [K1571]"	"1"	"1792.92753"	"0.068"	"0.707"	"0.00244561686509259"	"0.906515362333117"	"49.81"	"35.67"	"166.7"	"11.4"	"121.9"	"29.11"	"43.79"	"27.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.542E-05"	"3.90"	"44.44"
"60214"	"False"	"High"	"[R].SKVTAIKSLSIEIGHEVK.[N]"	"2xBiotin [K2; K7]"	"8.39952E-05"	"0.000721313"	"1"	"1"	"7"	"O35623"	"O35623 [41-58]"	"O35623 2xBiotin [K42; K47]"	"2"	"2391.27745"	"1.079"	"6.894"	""	"0.906515362333117"	"45.93"	"97.77"	"29.9"	"31.1"	"239.0"	"36.68"	"31.28"	"65.70"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.013E-06"	"4.95"	"61.63"
"59869"	"False"	"High"	"[K].SHKPLMLSQLPDNR.[I]"	"1xBiotin [K3]; 1xOxidation [M6]"	"0.000747518"	"0.000721313"	"1"	"1"	"2"	"O35963"	"O35963 [201-214]"	"O35963 1xBiotin [K203]"	"0"	"1877.93605"	"0.166"	"0.909"	"0.925138005747468"	"0.906515362333117"	"52.30"	"53.67"	"139.8"	"23.0"	"137.2"	"38.38"	"38.33"	"45.34"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"6.545E-05"	"3.60"	"40.26"
"59862"	"False"	"High"	"[K].SHKDDSELDFSALCPKISLTVAAK.[E]"	"1xBiotin [K]; 1xCarbamidomethyl [C14]"	"1.73789E-07"	"0.000721313"	"1"	"4"	"56"	"Q8VE91-1"	"Q8VE91-1 [143-166]"	"Q8VE91-1 1xBiotin [K]"	"2"	"2858.40629"	"3.883"	"3.154"	"0.363340288767383"	"0.906515362333117"	"53.53"	"47.52"	"35.5"	"148.2"	"116.4"	"22.84"	"45.12"	"32.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.122E-08"	"5.33"	"55.58"
"59812"	"False"	"High"	"[R].SGVSLAALKK.[AS]"	"1xBiotin [K9]"	"0.00237875"	"0.000721313"	"3"	"4"	"12"	"P43275; P15864; P43277"	"P43275 [57-66]; P15864 [55-64]; P43277 [56-65]"	"P43275 1xBiotin [K65]; P15864 1xBiotin [K63]; P43277 1xBiotin [K64]"	"1"	"1199.68165"	"0.122"	"0.909"	"0.477067253044389"	"0.906515362333117"	"65.90"	"57.31"	"156.2"	"16.8"	"127.0"	"43.17"	"48.96"	"25.96"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000196"	"3.10"	"45.10"
"59705"	"False"	"High"	"[R].SGPFGQIFRPDNFVFGQSGAGNNWAK.[G]"	""	"2.45834E-07"	"0.000721313"	"3"	"5"	"33"	"Q7TMM9; Q9D6F9; P99024"	"Q7TMM9 [78-103]; Q9D6F9 [78-103]; P99024 [78-103]"	""	"0"	"2798.34337"	"354.568"	"23.156"	"0.925138005747468"	"0.625665755000974"	"60.38"	"67.00"	"0.8"	"281.0"	"18.2"	"30.68"	"62.55"	"64.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.961E-08"	"7.87"	"57.93"
"59681"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSR.[R]"	"1xBiotin [K11]; 2xOxidation [M3; M10]"	"0.000632435"	"0.000721313"	"1"	"1"	"23"	"Q99J27"	"Q99J27 [16-39]"	"Q99J27 1xBiotin [K26]"	"1"	"2803.22728"	"0.316"	"2.323"	"0.925138005747468"	"0.919963097800321"	"128.38"	"110.36"	"90.3"	"35.3"	"174.4"	"89.92"	"27.64"	"60.35"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.576E-05"	"3.47"	"46.34"
"59680"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSR.[R]"	"1xBiotin [K11]; 1xOxidation [M]"	"1.4114E-05"	"0.000721313"	"1"	"1"	"33"	"Q99J27"	"Q99J27 [16-39]"	"Q99J27 1xBiotin [K26]"	"1"	"2787.23237"	"0.308"	"2.894"	"0.050614620120261"	"0.906515362333117"	"130.58"	"113.91"	"55.4"	"16.2"	"228.4"	"89.11"	"39.15"	"47.12"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.448E-06"	"4.18"	"50.63"
"59679"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSR.[R]"	"1xBiotin [K11]"	"6.39606E-05"	"0.000721313"	"1"	"1"	"7"	"Q99J27"	"Q99J27 [16-39]"	"Q99J27 1xBiotin [K26]"	"1"	"2771.23745"	"1.313"	"7.277"	"0.999791625166089"	"0.906515362333117"	"65.48"	"71.80"	"35.3"	"46.9"	"217.8"	"118.69"	"34.44"	"65.19"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"6.165E-06"	"5.32"	"54.26"
"59640"	"False"	"High"	"[R].SGKYDLDFK.[S]"	"1xBiotin [K3]"	"0.0015329"	"0.000721313"	"1"	"1"	"12"	"P17182"	"P17182 [254-262]"	"P17182 1xBiotin [K256]"	"1"	"1298.60855"	"0.105"	"0.676"	"0.925138005747468"	"0.906515362333117"	"69.05"	"40.03"	"166.6"	"15.5"	"118.0"	"34.25"	"56.79"	"21.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001296"	"2.81"	"44.88"
"59630"	"False"	"High"	"[K].SGKGDSTLQVSSR.[L]"	"1xBiotin [K3]"	"4.3567E-05"	"0.000721313"	"1"	"1"	"22"	"Q80WJ7"	"Q80WJ7 [261-273]"	"Q80WJ7 1xBiotin [K263]"	"1"	"1547.74823"	"0.016"	"0.739"	"1.88043128447204E-05"	"0.906515362333117"	"40.37"	"26.20"	"162.8"	"2.9"	"134.3"	"18.26"	"34.84"	"21.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.284E-06"	"4.02"	"31.94"
"59569"	"False"	"High"	"[K].SGELWLDAYLHK.[-]"	"1xBiotin [K12]"	"2.75504E-05"	"0.000721313"	"1"	"1"	"20"	"Q9Z0R9"	"Q9Z0R9 [433-444]"	"Q9Z0R9 1xBiotin [K444]"	"0"	"1657.80429"	"0.170"	"1.716"	"0.0116301574496223"	"0.969227082684272"	"123.21"	"23.00"	"106.2"	"18.0"	"175.8"	"19.51"	"144.32"	"13.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.745E-06"	"4.11"	"60.83"
"59566"	"False"	"High"	"[R].SGEGLGVFQQSSKHSLFDSCK.[M]"	"1xBiotin [K]; 1xCarbamidomethyl [C20]"	"7.10617E-05"	"0.000721313"	"1"	"1"	"12"	"Q91W98"	"Q91W98 [281-301]"	"Q91W98 1xBiotin [K]"	"1"	"2524.15952"	"0.094"	"1.092"	"0.00531269254350764"	"0.906515362333117"	"62.83"	"35.88"	"132.0"	"13.2"	"154.9"	"32.79"	"54.35"	"25.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.852E-06"	"4.50"	"49.73"
"59440"	"False"	"High"	"[R].SFLLDLLNATGK.[D]"	""	"0.00124196"	"0.000721313"	"1"	"3"	"11"	"Q62167"	"Q62167 [429-440]"	""	"0"	"1291.72563"	"66.340"	"2.520"	"0.925138005747468"	"0.935866453494337"	"63.85"	"44.51"	"4.4"	"285.3"	"10.3"	"18.55"	"83.26"	"59.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001057"	"2.69"	"62.70"
"59407"	"False"	"High"	"[K].SFFNAQFGSLFR.[T]"	""	"0.00133773"	"0.000721313"	"1"	"1"	"12"	"Q3UHB1"	"Q3UHB1 [468-479]"	""	"0"	"1420.70081"	"153.260"	"2.570"	"0.439658977138175"	"0.916215054610739"	"38.20"	"59.97"	"1.7"	"293.1"	"5.2"	"28.73"	"31.89"	"45.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001138"	"3.56"	"60.16"
"59868"	"False"	"High"	"[K].SHKPLMLSQLPDNR.[I]"	"1xBiotin [K3]"	"0.000382988"	"0.000721313"	"1"	"1"	"10"	"O35963"	"O35963 [201-214]"	"O35963 1xBiotin [K203]"	"0"	"1861.94113"	"0.149"	"1.078"	"0.925138005747468"	"0.906515362333117"	"63.91"	"59.95"	"132.6"	"24.4"	"143.0"	"40.86"	"47.08"	"41.40"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.447E-05"	"3.74"	"43.94"
"61417"	"False"	"High"	"[R].SPLGGPDPAELLLMGSYLGKPGPPEPALR.[Q]"	"1xBiotin [K20]"	"0.000237738"	"0.000721313"	"1"	"1"	"6"	"Q8K3Z9"	"Q8K3Z9 [116-144]"	"Q8K3Z9 1xBiotin [K135]"	"0"	"3155.62679"	"1.041"	"4.859"	""	"0.906515362333117"	"64.15"	"88.82"	"43.4"	"42.6"	"214.0"	"52.59"	"43.90"	"76.60"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.183E-05"	"5.00"	"67.02"
"60256"	"False"	"High"	"[R].SLAQHIPGPGGIEGVKGAASGVVGELAR.[A]"	"1xBiotin [K16]"	"0.000141312"	"0.000721313"	"1"	"2"	"6"	"Q8K400"	"Q8K400 [1077-1104]"	"Q8K400 1xBiotin [K1092]"	"1"	"2853.50397"	"0.996"	"1.867"	""	"0.957287483848178"	"41.91"	"74.20"	"85.7"	"77.7"	"136.5"	"24.56"	"38.55"	"66.64"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.32E-05"	"5.46"	"58.43"
"60423"	"False"	"High"	"[K].SLKDEDVLQK.[L]"	"1xBiotin [K3]"	"0.000422878"	"0.000721313"	"1"	"1"	"16"	"Q9CY27"	"Q9CY27 [58-67]"	"Q9CY27 1xBiotin [K60]"	"1"	"1400.70899"	"0.041"	"0.684"	"0.000115159852214823"	"0.906515362333117"	"83.97"	"41.62"	"174.9"	"7.2"	"118.0"	"12.91"	"144.39"	"47.29"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.797E-05"	"3.36"	"39.99"
"61345"	"False"	"High"	"[R].SPFLQKQLTQPETSYGR.[E]"	"1xBiotin [K6]"	"6.71268E-06"	"0.000721313"	"1"	"3"	"23"	"Q62418"	"Q62418 [291-307]"	"Q62418 1xBiotin [K296]"	"1"	"2206.09611"	"0.131"	"0.886"	"0.00851731170301682"	"0.906515362333117"	"34.70"	"29.95"	"152.5"	"19.6"	"127.9"	"16.40"	"33.27"	"32.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.076E-07"	"4.90"	"47.40"
"61342"	"False"	"High"	"[R].SPFGNLNWFTKVLR.[V]"	"1xBiotin [K11]"	"0.000156031"	"0.000721313"	"1"	"1"	"6"	"Q6P9J9"	"Q6P9J9 [157-170]"	"Q6P9J9 1xBiotin [K167]"	"1"	"1904.98398"	"0.908"	"2.201"	""	"0.916215054610739"	"43.49"	"37.62"	"72.9"	"65.1"	"162.0"	"33.34"	"41.13"	"25.40"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.454E-05"	"3.22"	"66.26"
"61341"	"False"	"High"	"[R].SPFGNLNWFTK.[V]"	""	"0.000747518"	"0.000721313"	"1"	"1"	"6"	"Q6P9J9"	"Q6P9J9 [157-167]"	""	"0"	"1310.65280"	"99.850"	"2.521"	"0.925138005747468"	"0.919063063983313"	"79.07"	"78.67"	"3.0"	"289.5"	"7.5"	"70.32"	"81.88"	"112.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"6.515E-05"	"3.43"	"55.71"
"61241"	"False"	"High"	"[K].SNYNFEKPFLWLAR.[K]"	""	"0.000121043"	"0.000721313"	"1"	"1"	"27"	"P62827"	"P62827 [153-166]"	""	"0"	"1784.91187"	"410.175"	"13.936"	"0.806774508075562"	"0.906515362333117"	"45.65"	"48.23"	"0.7"	"289.3"	"10.1"	"30.03"	"34.67"	"34.37"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.142E-05"	"4.17"	"55.92"
"61227"	"False"	"High"	"[K].SNVKIQSTPVK.[Q]"	"1xBiotin [K4]"	"0.00138835"	"0.000721313"	"1"	"1"	"10"	"P62821"	"P62821 [188-198]"	"P62821 1xBiotin [K191]"	"1"	"1426.77226"	"0.191"	"0.754"	"0.0139876829310265"	"0.906515362333117"	"61.27"	"75.78"	"146.3"	"28.1"	"125.5"	"52.00"	"35.26"	"64.10"	""	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001176"	"2.88"	"32.57"
"61154"	"False"	"High"	"[K].SNLLILDFGTFQLNSK.[D]"	""	"0.00017122"	"0.000721313"	"1"	"3"	"10"	"Q8BX70-1"	"Q8BX70-1 [710-725]"	""	"0"	"1809.97453"	"8.831"	"1.486"	"0.925138005747468"	"0.906515362333117"	"201.80"	"65.76"	"23.8"	"239.0"	"37.2"	"41.75"	"103.56"	"50.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.586E-05"	"3.69"	"63.31"
"61130"	"False"	"High"	"[K].SNHHKDSAVQSLR.[L]"	"1xBiotin [K5]"	"0.000756833"	"0.000721313"	"1"	"1"	"5"	"Q3UUQ7-1"	"Q3UUQ7-1 [791-803]"	"Q3UUQ7-1 1xBiotin [K795]"	"1"	"1704.82346"	"0.499"	"0.524"	"0.925138005747468"	"0.906515362333117"	"34.47"	"47.90"	"146.6"	"73.9"	"79.4"	"27.34"	"22.97"	"37.26"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"6.616E-05"	"3.64"	"26.69"
"60924"	"False"	"High"	"[K].SLYYASFLEALVR.[D]"	""	"0.0020378"	"0.000721313"	"1"	"2"	"5"	"Q66JS6"	"Q66JS6 [178-190]"	""	"0"	"1531.81551"	"1.207"	"1.002"	"0.925138005747468"	"0.906515362333117"	"100.79"	"83.20"	"85.2"	"130.9"	"83.9"	"52.30"	"211.44"	"62.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"0.0001695"	"2.37"	"66.00"
"60922"	"False"	"High"	"[R].SLYSSSPGGAYVTR.[S]"	""	"0.000208746"	"0.000721313"	"1"	"1"	"16"	"P20152"	"P20152 [51-64]"	""	"0"	"1444.70668"	"421.751"	"10.480"	"0.791214544114352"	"0.906515362333117"	"61.44"	"70.30"	"0.7"	"292.6"	"6.7"	"51.81"	"43.94"	"85.59"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.929E-05"	"3.48"	"32.75"
"60903"	"False"	"High"	"[K].SLVSKGTLVQTK.[G]"	"1xBiotin [K5]"	"0.000122551"	"0.000721313"	"2"	"3"	"12"	"P43276; P43277"	"P43276 [86-97]; P43277 [87-98]"	"P43276 1xBiotin [K90]; P43277 1xBiotin [K91]"	"1"	"1486.82978"	"0.068"	"0.846"	"0.00344785569694831"	"0.906515362333117"	"59.25"	"50.55"	"153.0"	"11.9"	"135.1"	"41.72"	"43.06"	"38.18"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.155E-05"	"3.40"	"42.62"
"60860"	"False"	"High"	"[K].SLVALALIFAIQK.[C]"	""	"0.000217994"	"0.000721313"	"1"	"1"	"1"	"Q9CW03"	"Q9CW03 [1121-1133]"	""	"0"	"1386.87190"	"1.437"	"1.102"	"0.97035293201683"	""	"91.78"	"64.44"	"76.6"	"128.6"	"94.8"	"45.29"	"233.19"	"48.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.008E-05"	"3.77"	"67.98"
"60837"	"False"	"High"	"[R].SITAKQAPETDKK.[N]"	"1xBiotin [K5]"	"0.000316092"	"0.000721313"	"1"	"1"	"12"	"Q80WJ7"	"Q80WJ7 [145-157]"	"Q80WJ7 1xBiotin [K149]"	"2"	"1642.84688"	"0.048"	"0.775"	"0.00141417339705607"	"0.906515362333117"	"47.71"	"14.30"	"165.3"	"8.2"	"126.5"	"13.74"	"38.79"	"20.47"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.856E-05"	"4.10"	"26.93"
"60298"	"False"	"High"	"[R].SLDLDSIIAEVK.[A]"	""	"0.000458327"	"0.000721313"	"1"	"4"	"9"	"Q922U2"	"Q922U2 [326-337]"	""	"0"	"1302.71512"	"145.667"	"0.797"	"0.925138005747468"	"0.906515362333117"	"103.43"	"80.71"	"1.6"	"295.9"	"2.4"	"138.55"	"197.83"	"38.25"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"4.097E-05"	"2.69"	"58.58"
"60800"	"False"	"High"	"[K].SLSIEIGHEVKNQNK.[L]"	"1xBiotin [K]"	"0.000115908"	"0.000721313"	"1"	"1"	"20"	"O35623"	"O35623 [48-62]"	"O35623 1xBiotin [K]"	"1"	"1921.98002"	"0.069"	"1.261"	"0.00035182416864534"	"0.978732356642279"	"31.37"	"36.56"	"127.3"	"9.0"	"163.7"	"14.85"	"49.26"	"31.82"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.096E-05"	"3.74"	"40.28"
"60697"	"False"	"High"	"[K].SLQAKFPSDLK.[V]"	"1xBiotin [K5]"	"0.00176742"	"0.000721313"	"1"	"1"	"22"	"Q8BHF7"	"Q8BHF7 [145-155]"	"Q8BHF7 1xBiotin [K149]"	"1"	"1459.76136"	"0.140"	"1.010"	"0.0096876730740497"	"0.906515362333117"	"44.18"	"62.43"	"153.3"	"21.0"	"125.7"	"28.27"	"40.73"	"67.91"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001478"	"2.72"	"46.82"
"60651"	"False"	"High"	"[R].SIPAYLAETLYYAMK.[G]"	"1xOxidation [M14]"	"0.000380623"	"0.000721313"	"1"	"1"	"24"	"P48036"	"P48036 [244-258]"	""	"0"	"1749.87679"	"154.749"	"5.406"	"0.925138005747468"	"0.906515362333117"	"102.47"	"43.83"	"1.9"	"287.7"	"10.5"	"29.03"	"71.97"	"35.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.428E-05"	"3.27"	"59.05"
"60650"	"False"	"High"	"[R].SIPAYLAETLYYAMK.[G]"	""	"8.04317E-05"	"0.000721313"	"1"	"1"	"31"	"P48036"	"P48036 [244-258]"	""	"0"	"1733.88187"	"50.284"	"12.840"	"0.665420827867785"	"0.906515362333117"	"146.92"	"55.02"	"4.5"	"238.4"	"57.0"	"34.02"	"94.47"	"42.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.704E-06"	"3.88"	"65.66"
"60645"	"False"	"High"	"[K].SLNYWSNLLGMK.[I]"	"1xOxidation [M11]"	"0.000535067"	"0.000721313"	"1"	"3"	"13"	"Q9CPV4-1"	"Q9CPV4-1 [151-162]"	""	"0"	"1441.71441"	"387.380"	"6.271"	"0.925138005747468"	"0.906515362333117"	"63.70"	"65.19"	"0.7"	"295.0"	"4.2"	"42.43"	"52.00"	"53.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"4.734E-05"	"3.32"	"53.69"
"60644"	"False"	"High"	"[K].SLNYWSNLLGMK.[I]"	""	"0.000957591"	"0.000721313"	"1"	"3"	"9"	"Q9CPV4-1"	"Q9CPV4-1 [151-162]"	""	"0"	"1425.71950"	"38.918"	"3.852"	"0.925138005747468"	"0.906515362333117"	"141.80"	"101.83"	"6.7"	"259.4"	"33.9"	"53.66"	"111.51"	"63.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.269E-05"	"3.37"	"58.69"
"60615"	"False"	"High"	"[K].SINNFEVKTIHGSK.[S]"	"1xBiotin [K]"	"0.00211488"	"0.000721313"	"1"	"1"	"10"	"P70677"	"P70677 [12-25]"	"P70677 1xBiotin [K]"	"1"	"1799.91088"	"0.186"	"0.894"	"0.925138005747468"	"0.906515362333117"	"25.82"	"51.26"	"145.6"	"29.8"	"124.6"	"21.93"	"18.09"	"37.50"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001757"	"3.21"	"39.67"
"60605"	"False"	"High"	"[R].SLNIAASAAVQAATKSQGALAGR.[L]"	"1xBiotin [K15]"	"1.40095E-06"	"0.000721313"	"1"	"1"	"13"	"Q8K072"	"Q8K072 [125-147]"	"Q8K072 1xBiotin [K139]"	"1"	"2382.25580"	"0.059"	"0.879"	"0.0028103014004041"	"0.906515362333117"	"43.51"	"39.51"	"147.7"	"9.3"	"143.1"	"56.27"	"42.33"	"41.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.568E-07"	"6.18"	"54.32"
"60553"	"False"	"High"	"[K].SLLVSGWWGFVR.[H]"	""	"0.000689706"	"0.000721313"	"1"	"1"	"7"	"Q3U9G9"	"Q3U9G9 [544-555]"	""	"0"	"1406.75793"	"262.192"	"5.584"	"0.925138005747468"	"0.906515362333117"	"58.87"	"60.70"	"1.0"	"294.0"	"5.0"	"45.26"	"17.61"	"53.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"6.047E-05"	"3.10"	"63.28"
"60542"	"False"	"High"	"[K].SLLSVVKSATLETKPESK.[Y]"	"1xBiotin [K7]"	"1.86501E-05"	"0.000721313"	"1"	"1"	"29"	"P15261"	"P15261 [293-310]"	"P15261 1xBiotin [K299]"	"1"	"2143.16788"	"0.037"	"1.077"	"9.28655666722657E-05"	"0.927892136092816"	"71.89"	"43.21"	"143.7"	"5.2"	"151.1"	"25.41"	"144.90"	"30.30"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.889E-06"	"4.75"	"57.18"
"60504"	"False"	"High"	"[K].SLLLLAYLIR.[N]"	""	"0.00109732"	"0.000721313"	"1"	"2"	"14"	"Q99KN9-1"	"Q99KN9-1 [90-99]"	""	"0"	"1174.75581"	"163.588"	"4.991"	"0.434853540501642"	"0.906515362333117"	"75.33"	"63.99"	"1.6"	"290.7"	"7.7"	"114.56"	"83.14"	"37.15"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.443E-05"	"2.61"	"66.93"
"60453"	"False"	"High"	"[R].SLKTNTLAAQSVIK.[K]"	"1xBiotin [K3]"	"3.23636E-05"	"0.000721313"	"1"	"2"	"48"	"Q9CQ56"	"Q9CQ56 [193-206]"	"Q9CQ56 1xBiotin [K195]"	"1"	"1699.94112"	"0.003"	"0.843"	"4.04783413898713E-07"	"0.906515362333117"	"28.74"	"18.82"	"162.5"	"0.5"	"137.0"	"22.78"	"24.81"	"9.99"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.216E-06"	"4.17"	"45.19"
"60429"	"False"	"High"	"[K].SLKELQEMDKDDESLTK.[Y]"	"1xBiotin [K3]"	"0.00155199"	"0.000721313"	"1"	"1"	"11"	"Q61599"	"Q61599 [30-46]"	"Q61599 1xBiotin [K32]"	"2"	"2235.05192"	"0.181"	"0.740"	"0.925138005747468"	"0.906515362333117"	"74.01"	"105.54"	"158.1"	"38.2"	"103.7"	"64.22"	"45.85"	"82.63"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001308"	"2.98"	"42.87"
"60710"	"False"	"High"	"[R].SIQFVDWCPTGFK.[V]"	"1xCarbamidomethyl [C8]"	"0.00112483"	"0.000721313"	"1"	"2"	"10"	"P05213"	"P05213 [340-352]"	""	"0"	"1584.75153"	"83.470"	"0.887"	"0.857409145698756"	"0.906515362333117"	"41.37"	"65.72"	"3.6"	"293.3"	"3.0"	"44.05"	"22.82"	"51.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"9.669E-05"	"2.95"	"54.18"
"22617"	"False"	"High"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 3xOxidation [M10; M12; M20]"	"0.000528481"	"0.000721313"	"1"	"1"	"26"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"1"	"3009.42222"	"0.227"	"1.489"	"0.0157149995659892"	"0.94138557736885"	"139.47"	"85.45"	"97.0"	"16.7"	"186.3"	"77.01"	"145.51"	"45.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.679E-05"	"4.96"	"49.94"
"35586"	"False"	"High"	"[R].LISQIVSSITASLR.[F]"	""	"4.17187E-05"	"0.000721313"	"1"	"4"	"41"	"P05213"	"P05213 [230-243]"	""	"0"	"1487.87917"	"233.359"	"15.988"	"0.925138005747468"	"0.69921766089904"	"34.77"	"60.74"	"1.2"	"280.1"	"18.8"	"20.67"	"38.75"	"76.66"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.091E-06"	"3.30"	"63.51"
"2379"	"False"	"High"	"[R].ALITFAGMIPYR.[T]"	""	"0.00095168"	"0.000721313"	"1"	"2"	"9"	"Q8BJ71-1"	"Q8BJ71-1 [791-802]"	""	"0"	"1352.73950"	"55.365"	"2.545"	"0.925138005747468"	"0.916215054610739"	"90.10"	"107.93"	"6.4"	"279.2"	"14.4"	"42.18"	"74.85"	"77.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.238E-05"	"3.34"	"57.50"
"10284"	"False"	"High"	"[K].EAEAAKAAALLTK.[Q]"	"1xBiotin [K6]"	"0.000210043"	"0.000721313"	"1"	"1"	"8"	"Q8VCH8"	"Q8VCH8 [287-299]"	"Q8VCH8 1xBiotin [K292]"	"1"	"1512.80904"	"0.254"	"0.840"	"0.925138005747468"	"0.906515362333117"	"40.34"	"32.26"	"151.3"	"38.4"	"110.3"	"19.78"	"39.98"	"25.79"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.935E-05"	"3.71"	"47.31"
"20785"	"False"	"High"	"[R].GGNVGINSFGFGGSNVHVILQPNTR.[Q]"	""	"0.000916976"	"0.000721313"	"1"	"1"	"4"	"P19096"	"P19096 [385-409]"	""	"0"	"2541.29569"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"7.95E-05"	"3.36"	""
"14082"	"False"	"High"	"[K].ELTIGSKLQDAEIAR.[L]"	"1xBiotin [K7]"	"5.54692E-05"	"0.000721313"	"1"	"1"	"9"	"P14069"	"P14069 [41-55]"	"P14069 1xBiotin [K47]"	"1"	"1869.97387"	"0.816"	"0.522"	"0.962122454074805"	"0.906515362333117"	"88.91"	"78.26"	"128.3"	"104.7"	"67.0"	"66.58"	"25.80"	"42.58"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"5.381E-06"	"4.53"	"53.45"
"10205"	"False"	"High"	"[R].EAAHPPDVSISKTALYSR.[I]"	"1xBiotin [K12]"	"5.11785E-05"	"0.000721313"	"1"	"4"	"29"	"Q9JJG0-1"	"Q9JJG0-1 [913-930]"	"Q9JJG0-1 1xBiotin [K924]"	"1"	"2168.08046"	"0.053"	"0.711"	"0.000306228763070025"	"0.906515362333117"	"55.57"	"47.25"	"170.4"	"9.4"	"120.2"	"46.70"	"37.26"	"14.53"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.978E-06"	"4.73"	"44.34"
"14128"	"False"	"High"	"[K].ELVLKSAVEAER.[L]"	"1xBiotin [K5]"	"0.00014219"	"0.000721313"	"1"	"1"	"31"	"Q91YQ5"	"Q91YQ5 [561-572]"	"Q91YQ5 1xBiotin [K565]"	"1"	"1569.83050"	"0.166"	"0.810"	"0.0026476050004963"	"0.906515362333117"	"346.83"	"21.25"	"156.2"	"25.1"	"118.6"	"16.72"	"111.57"	"18.03"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.332E-05"	"3.47"	"47.92"
"20861"	"False"	"High"	"[K].GGSKQQSEEDLLLQDFSR.[N]"	"1xBiotin [K4]"	"2.78593E-06"	"0.000721313"	"1"	"2"	"26"	"Q9DCF9-1"	"Q9DCF9-1 [5-22]"	"Q9DCF9-1 1xBiotin [K8]"	"1"	"2263.06594"	"0.073"	"0.974"	"0.0047739375841271"	"0.910227350242735"	"38.75"	"54.49"	"146.2"	"11.5"	"142.3"	"36.34"	"22.62"	"57.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.04E-07"	"5.30"	"55.27"
"10077"	"False"	"High"	"[R].DYAKGFGGQYGIQK.[D]"	"1xBiotin [K4]"	"1.05496E-05"	"0.000721313"	"1"	"1"	"32"	"P49710"	"P49710 [189-202]"	"P49710 1xBiotin [K192]"	"1"	"1757.83157"	"0.016"	"0.719"	"1.97313108571211E-05"	"0.906515362333117"	"45.80"	"31.38"	"167.7"	"2.9"	"129.4"	"23.94"	"36.77"	"20.32"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.095E-06"	"4.50"	"43.41"
"10032"	"False"	"High"	"[K].DVYVQLYLQHLTAR.[N]"	""	"0.000125625"	"0.000721313"	"1"	"6"	"9"	"Q61029"	"Q61029 [35-48]"	""	"0"	"1718.92243"	"84.505"	"2.099"	"0.761043863563627"	"0.999887580639419"	"93.67"	"53.62"	"3.9"	"288.4"	"7.6"	"39.09"	"76.30"	"47.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.181E-05"	"2.96"	"53.32"
"16935"	"False"	"High"	"[R].FAQDKSVVNK.[M]"	"1xBiotin [K5]"	"0.00148618"	"0.000721313"	"1"	"2"	"5"	"P97411-1"	"P97411-1 [15-24]"	"P97411-1 1xBiotin [K19]"	"1"	"1361.68820"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001255"	"3.16"	""
"19054"	"False"	"High"	"[R].FWQDLMNIAGTTLSSK.[L]"	""	"2.23193E-05"	"0.000721313"	"1"	"1"	"6"	"P80314"	"P80314 [155-170]"	""	"0"	"1811.89965"	"0.578"	"2.224"	"0.925138005747468"	"0.969054191468458"	"80.19"	"70.92"	"89.0"	"39.3"	"171.7"	"34.36"	"215.97"	"52.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.241E-06"	"3.54"	"60.81"
"19703"	"False"	"High"	"[K].GCYAHVLGSKSFQTSDWPQKA.[-]"	"1xBiotin [K10]; 1xCarbamidomethyl [C2]"	"0.000330095"	"0.000721313"	"1"	"1"	"2"	"P06339"	"P06339 [337-357]"	"P06339 1xBiotin [K346]"	"2"	"2593.19624"	"0.086"	"1.843"	"0.000468149126975209"	"0.910227350242735"	"130.59"	"74.42"	"110.4"	"7.8"	"181.8"	"84.69"	"49.52"	"41.63"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"2.982E-05"	"5.52"	"46.93"
"20889"	"False"	"High"	"[K].GGVASGFKHVVPNEVVVQR.[L]"	"1xBiotin [K8]"	"6.9323E-05"	"0.000721313"	"1"	"2"	"8"	"P13020-1"	"P13020-1 [168-186]"	"P13020-1 1xBiotin [K175]"	"1"	"2205.15972"	"0.107"	"0.900"	"0.00861476877388194"	"0.906515362333117"	"54.11"	"38.94"	"148.5"	"17.8"	"133.6"	"30.33"	"46.17"	"18.87"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.689E-06"	"4.60"	"45.17"
"20939"	"False"	"High"	"[R].GHFGLFPANYVK.[L]"	""	"0.000371311"	"0.000721313"	"1"	"1"	"31"	"P49710"	"P49710 [473-484]"	""	"0"	"1349.70008"	"194.107"	"4.989"	"0.925138005747468"	"0.906515362333117"	"60.18"	"67.32"	"1.3"	"292.0"	"6.6"	"51.37"	"24.75"	"14.83"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.342E-05"	"3.72"	"43.89"
"20981"	"False"	"High"	"[K].GHNGWVTQIATTPQFPDMILSASR.[D]"	""	"0.00105078"	"0.000721313"	"1"	"1"	"3"	"P68040"	"P68040 [13-36]"	""	"0"	"2627.30348"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"9.039E-05"	"3.94"	""
"3065"	"False"	"High"	"[R].ANVLNKVEYAQQR.[W]"	"1xBiotin [K6]"	"2.08495E-05"	"0.000721313"	"1"	"1"	"38"	"Q9JJR8"	"Q9JJR8 [167-179]"	"Q9JJR8 1xBiotin [K172]"	"1"	"1758.89556"	"0.082"	"0.862"	"0.000592155916723551"	"0.906515362333117"	"319.93"	"35.57"	"140.7"	"14.8"	"144.4"	"28.54"	"121.04"	"37.51"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.099E-06"	"4.89"	"46.07"
"19702"	"False"	"High"	"[K].GCYAHVLGSKSFQTSDWPQK.[A]"	"1xBiotin [K10]; 1xCarbamidomethyl [C2]"	"6.2319E-06"	"0.000721313"	"1"	"1"	"22"	"P06339"	"P06339 [337-356]"	"P06339 1xBiotin [K346]"	"1"	"2522.15912"	"0.068"	"1.497"	"0.00349955824316297"	"0.958214957610858"	"52.78"	"37.99"	"119.3"	"7.5"	"173.2"	"19.06"	"43.70"	"34.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.598E-07"	"5.90"	"46.19"
"20995"	"False"	"High"	"[K].GHQNGSVAAVNGHTNSFPSLENSVKPR.[K]"	"1xBiotin [K25]"	"0.000178805"	"0.000721313"	"1"	"1"	"18"	"Q8BHI7"	"Q8BHI7 [268-294]"	"Q8BHI7 1xBiotin [K292]"	"0"	"3030.45987"	"0.090"	"0.802"	"0.00496788546085694"	"0.906515362333117"	"62.33"	"64.01"	"143.9"	"15.4"	"140.7"	"47.11"	"38.47"	"32.02"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.658E-05"	"4.69"	"40.63"
"731"	"False"	"High"	"[K].AEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K]; 1xOxidation [M4]"	"0.000173354"	"0.000721313"	"1"	"1"	"11"	"P09581"	"P09581 [677-704]"	"P09581 1xBiotin [K]"	"1"	"3202.46672"	"0.292"	"0.931"	"0.056350800721384"	"0.906515362333117"	"144.97"	"69.54"	"144.4"	"34.1"	"121.5"	"59.77"	"149.52"	"28.92"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.608E-05"	"4.56"	"44.60"
"17485"	"False"	"High"	"[K].FGSYLGYSVGAGHFR.[S]"	""	"1.79698E-05"	"0.000721313"	"1"	"1"	"32"	"Q00651"	"Q00651 [254-268]"	""	"0"	"1617.78085"	"129.722"	"3.222"	"0.925138005747468"	"0.906515362333117"	"28.60"	"34.63"	"2.3"	"290.6"	"7.2"	"26.47"	"16.98"	"24.66"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.826E-06"	"4.31"	"42.43"
"21042"	"False"	"High"	"[K].GHYTEGAELVDSVLDVVR.[K]"	""	"2.19085E-05"	"0.000721313"	"3"	"6"	"14"	"Q7TMM9; Q9ERD7; P99024"	"Q7TMM9 [104-121]; Q9ERD7 [104-121]; P99024 [104-121]"	""	"0"	"1958.98180"	"191.953"	"12.611"	"0.26295182989306"	"0.906515362333117"	"77.80"	"59.10"	"1.4"	"281.4"	"17.3"	"53.73"	"50.39"	"25.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.21E-06"	"5.40"	"59.24"
"4503"	"False"	"High"	"[K].AVPLNASKQDGPLPKPHSVSLNDTETR.[K]"	"1xBiotin [K]"	"0.000911316"	"0.000721313"	"1"	"1"	"15"	"Q9WV55"	"Q9WV55 [147-173]"	"Q9WV55 1xBiotin [K]"	"1"	"3097.57351"	"0.051"	"0.862"	"0.00365313584763886"	"0.906515362333117"	"58.73"	"65.76"	"172.3"	"7.7"	"120.0"	"37.31"	"56.38"	"31.40"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.914E-05"	"3.49"	"39.87"
"21054"	"False"	"High"	"[K].GKALEVAEYLTPVLK.[E]"	"1xBiotin [K2]"	"6.59721E-05"	"0.000721313"	"1"	"1"	"19"	"Q9CPX6"	"Q9CPX6 [10-24]"	"Q9CPX6 1xBiotin [K11]"	"1"	"1857.01903"	"0.266"	"1.525"	"0.925138005747468"	"0.937945192250145"	"44.78"	"39.14"	"108.8"	"32.3"	"158.9"	"31.18"	"36.93"	"29.30"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.366E-06"	"4.20"	"61.21"
"3516"	"False"	"High"	"[R].AQSQKTADPSNPGR.[H]"	"1xBiotin [K5]"	"7.70194E-05"	"0.000721313"	"1"	"1"	"30"	"Q8K1N4-1"	"Q8K1N4-1 [456-469]"	"Q8K1N4-1 1xBiotin [K460]"	"1"	"1682.79149"	"10.393"	"0.758"	"0.669134387545285"	"0.906515362333117"	"52.96"	"57.25"	"25.9"	"257.3"	"16.8"	"32.77"	"48.73"	"45.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.373E-06"	"3.88"	"24.27"
"10527"	"False"	"High"	"[K].EAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K16]"	"1.65593E-06"	"0.000721313"	"1"	"1"	"24"	"Q61009"	"Q61009 [485-508]"	"Q61009 1xBiotin [K500]"	"1"	"2748.35828"	"0.052"	"1.252"	"0.000357069876676643"	"0.975839779844258"	"28.31"	"28.34"	"134.0"	"6.6"	"159.4"	"12.84"	"224.82"	"22.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.846E-07"	"5.86"	"54.76"
"17415"	"False"	"High"	"[K].FGLALAVAGGVVNSALYNVDAGHR.[A]"	""	"3.0195E-06"	"0.000721313"	"1"	"1"	"12"	"P67778"	"P67778 [12-35]"	""	"0"	"2371.25170"	"7.175"	"5.503"	"0.925138005747468"	"0.906515362333117"	"396.07"	"101.03"	"16.3"	"168.8"	"114.9"	"43.78"	"113.19"	"72.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.285E-07"	"6.70"	"62.26"
"4262"	"False"	"High"	"[R].ATSTEPSNSASSSKSEK.[R]"	"1xBiotin [K]"	"0.0019155"	"0.000721313"	"1"	"1"	"8"	"Q8VCH8"	"Q8VCH8 [444-460]"	"Q8VCH8 1xBiotin [K]"	"1"	"1923.86003"	"0.342"	"0.850"	"0.879255455794791"	"0.906515362333117"	"75.00"	"56.79"	"134.4"	"50.2"	"115.4"	"56.34"	"56.66"	"35.29"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001596"	"3.06"	"21.74"
"1053"	"False"	"High"	"[R].AFEGQAHSGKGPAGVELNSMQPVK.[E]"	"1xBiotin [K10]; 1xOxidation [M20]"	"3.17287E-06"	"0.000721313"	"1"	"1"	"7"	"P32037"	"P32037 [464-487]"	"P32037 1xBiotin [K473]"	"1"	"2681.28103"	"1.148"	"2.238"	"0.134816944798256"	"0.935866453494337"	"120.08"	"122.97"	"68.6"	"77.8"	"153.6"	"126.07"	"39.26"	"108.52"	""	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.453E-07"	"7.15"	"37.01"
"10577"	"False"	"High"	"[K].EANNFLWPFK.[L]"	""	"0.00202522"	"0.000721313"	"1"	"1"	"17"	"P14148"	"P14148 [225-234]"	""	"0"	"1265.63133"	"164.382"	"3.786"	"0.925138005747468"	"0.906515362333117"	"81.83"	"63.66"	"1.4"	"292.8"	"5.8"	"57.47"	"49.66"	"38.95"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001678"	"2.68"	"57.35"
"20578"	"False"	"High"	"[R].GGAESHTFK.[-]"	"1xBiotin [K9]"	"0.00220851"	"0.000721313"	"1"	"1"	"15"	"P63254"	"P63254 [69-77]"	"P63254 1xBiotin [K77]"	"0"	"1159.52007"	"0.065"	"0.885"	"0.000613896156679201"	"0.906515362333117"	"36.33"	"32.23"	"151.3"	"10.1"	"138.5"	"26.02"	"26.37"	"17.88"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001827"	"3.23"	"32.29"
"17422"	"False"	"High"	"[K].FGIGDGNLQYYLYNWK.[C]"	""	"4.93117E-05"	"0.000721313"	"1"	"1"	"9"	"O70310"	"O70310 [467-482]"	""	"0"	"1950.93847"	"39.662"	"1.472"	"0.925138005747468"	"0.906777072223237"	"86.16"	"55.79"	"7.0"	"284.3"	"8.7"	"24.15"	"79.65"	"54.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.816E-06"	"4.36"	"60.80"
"1052"	"False"	"High"	"[R].AFEGQAHSGKGPAGVELNSMQPVK.[E]"	"1xBiotin [K10]"	"6.41995E-07"	"0.000721313"	"1"	"1"	"9"	"P32037"	"P32037 [464-487]"	"P32037 1xBiotin [K473]"	"1"	"2665.28612"	"0.240"	"0.437"	"0.925138005747468"	"0.906515362333117"	"47.52"	"94.31"	"166.9"	"40.1"	"93.1"	"79.68"	"29.38"	"77.06"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.447E-08"	"6.47"	"41.36"
"19040"	"False"	"High"	"[R].FWFAHNVLFNVSNR.[F]"	""	"0.000324019"	"0.000721313"	"1"	"1"	"1"	"P70398"	"P70398 [2086-2099]"	""	"0"	"1750.88123"	"9.409"	"1.188"	"0.998769547666767"	""	"229.72"	"43.16"	"33.7"	"223.1"	"43.2"	"43.54"	"107.02"	"39.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.934E-05"	"3.98"	"55.13"
"19954"	"False"	"High"	"[K].GDVVIVLTGWRPGSGFTNTMR.[V]"	""	"0.00124967"	"0.000721313"	"1"	"2"	"12"	"P52480"	"P52480 [506-526]"	""	"0"	"2263.16520"	"233.308"	"18.217"	"0.925138005747468"	"0.625665755000974"	"98.69"	"99.10"	"1.3"	"277.1"	"21.6"	"91.61"	"65.15"	"34.28"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001069"	"3.69"	"55.11"
"1644"	"False"	"High"	"[K].AHLSAPVPNTKSPTAPR.[F]"	"1xBiotin [K11]"	"7.56017E-05"	"0.000721313"	"1"	"1"	"11"	"P70261"	"P70261 [586-602]"	"P70261 1xBiotin [K596]"	"1"	"1970.02764"	"0.522"	"1.025"	"0.0219471013011282"	"0.906515362333117"	"74.49"	"108.85"	"98.4"	"58.2"	"143.4"	"149.63"	"52.78"	"78.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.257E-06"	"4.58"	"34.33"
"2724"	"False"	"High"	"[K].ALYEALDLQSAFFK.[Y]"	""	"0.000487606"	"0.000721313"	"1"	"1"	"7"	"Q920E5"	"Q920E5 [303-316]"	""	"0"	"1615.83664"	"21.010"	"1.477"	"0.925138005747468"	"0.906515362333117"	"78.25"	"14.26"	"13.4"	"267.0"	"19.6"	"18.68"	"82.00"	"24.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"4.343E-05"	"3.47"	"59.87"
"19950"	"False"	"High"	"[R].GDVQNKPSGLWGMLK.[S]"	"1xBiotin [K6]"	"0.000373618"	"0.000721313"	"1"	"1"	"18"	"Q8BS95"	"Q8BS95 [218-232]"	"Q8BS95 1xBiotin [K223]"	"0"	"1855.91934"	"0.124"	"0.950"	"0.012205990698023"	"0.906515362333117"	"64.93"	"46.45"	"136.0"	"20.6"	"143.4"	"37.84"	"43.94"	"36.09"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.355E-05"	"3.70"	"56.01"
"14008"	"False"	"High"	"[R].ELSKTYIIGELHPDDR.[S]"	"1xBiotin [K4]"	"3.23636E-05"	"0.000721313"	"1"	"1"	"39"	"P56395"	"P56395 [74-89]"	"P56395 1xBiotin [K77]"	"1"	"2112.04302"	"1.799"	"1.348"	"0.138574429561838"	"0.998099211977233"	"59.39"	"60.33"	"74.6"	"127.0"	"98.4"	"44.25"	"59.63"	"54.81"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.217E-06"	"3.93"	"52.56"
"1376"	"False"	"High"	"[R].AGKPVICATQMLESMIK.[K]"	"1xCarbamidomethyl [C7]"	"0.00144089"	"0.000721313"	"1"	"2"	"10"	"P52480"	"P52480 [320-336]"	""	"0"	"1876.96932"	"3.964"	"3.783"	"0.947989303413716"	"0.906515362333117"	"138.27"	"53.20"	"41.7"	"136.5"	"121.8"	"32.45"	"141.93"	"47.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001223"	"3.66"	"56.87"
"4415"	"False"	"High"	"[K].AVKTSSLQVGLPTAAIPHNPR.[V]"	"1xBiotin [K3]"	"5.97485E-05"	"0.000721313"	"1"	"2"	"12"	"Q8BMI4"	"Q8BMI4 [753-773]"	"Q8BMI4 1xBiotin [K755]"	"1"	"2383.29146"	"0.226"	"0.743"	"0.925138005747468"	"0.906515362333117"	"36.48"	"33.42"	"148.9"	"35.5"	"115.5"	"20.14"	"32.36"	"54.60"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"5.793E-06"	"4.01"	"45.96"
"18509"	"False"	"High"	"[R].FQVDFQLGNSLKPR.[A]"	"1xBiotin [K12]"	"9.14906E-06"	"0.000721313"	"1"	"1"	"17"	"Q9JL15"	"Q9JL15 [45-58]"	"Q9JL15 1xBiotin [K56]"	"0"	"1874.95816"	"0.082"	"1.283"	"0.00971664507241101"	"0.916215054610739"	"52.84"	"41.89"	"130.4"	"10.3"	"159.3"	"12.77"	"39.02"	"35.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.543E-07"	"4.49"	"55.53"
"20675"	"False"	"High"	"[R].GGGGNFGPGPGSNFR.[G]"	""	"0.000135317"	"0.000721313"	"1"	"3"	"29"	"O88569"	"O88569 [214-228]"	""	"0"	"1377.62944"	"181.310"	"4.527"	"0.925138005747468"	"0.906515362333117"	"66.58"	"54.06"	"1.8"	"290.8"	"7.3"	"36.30"	"75.90"	"36.41"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.272E-05"	"3.06"	"31.23"
"10542"	"False"	"High"	"[R].EALTKQGYQLIGSHSGVK.[L]"	"1xBiotin [K5]"	"9.03644E-06"	"0.000721313"	"1"	"1"	"18"	"Q8BJM7-1"	"Q8BJM7-1 [351-368]"	"Q8BJM7-1 1xBiotin [K355]"	"1"	"2142.10120"	"0.022"	"0.923"	"3.61097378948738E-05"	"0.906515362333117"	"49.85"	"28.14"	"154.1"	"3.7"	"142.2"	"28.74"	"44.18"	"18.55"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.445E-07"	"4.75"	"42.63"
"20702"	"False"	"High"	"[K].GGHGAASPSDKGAHPSGGADDVAK.[K]"	"1xBiotin [K11]"	"0.000175514"	"0.000721313"	"1"	"1"	"26"	"Q8BMK4"	"Q8BMK4 [11-34]"	"Q8BMK4 1xBiotin [K21]"	"1"	"2372.06840"	"0.307"	"0.950"	"0.00720716652092326"	"0.906777072223237"	"542.63"	"41.37"	"131.8"	"42.9"	"125.3"	"24.49"	"116.41"	"39.54"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.625E-05"	"4.59"	"23.15"
"10528"	"False"	"High"	"[K].EAIQAYSESLMSPAAKGTVLQEAK.[L]"	"1xBiotin [K16]; 1xOxidation [M11]"	"1.07475E-05"	"0.000721313"	"1"	"1"	"22"	"Q61009"	"Q61009 [485-508]"	"Q61009 1xBiotin [K500]"	"1"	"2764.35319"	"0.465"	"0.929"	"0.0226919843385691"	"0.906515362333117"	"342.83"	"37.87"	"122.7"	"57.9"	"119.4"	"33.30"	"114.22"	"22.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.112E-06"	"4.59"	"49.59"
"17469"	"False"	"High"	"[K].FGQGFGKTNIYTQK.[Q]"	"1xBiotin [K7]"	"4.22386E-05"	"0.000721313"	"1"	"2"	"14"	"Q8VDP2"	"Q8VDP2 [122-135]"	"Q8VDP2 1xBiotin [K128]"	"1"	"1814.88942"	"0.084"	"0.714"	"0.00338043135353608"	"0.906515362333117"	"63.56"	"40.21"	"160.4"	"15.5"	"124.1"	"29.41"	"47.89"	"32.25"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.136E-06"	"4.34"	"44.70"
"17489"	"False"	"High"	"[K].FGTLLSGSWDTTAK.[V]"	""	"7.56017E-05"	"0.000721313"	"1"	"1"	"14"	"P27612"	"P27612 [123-136]"	""	"0"	"1483.74273"	"126.306"	"2.576"	"0.933451859704016"	"0.906515362333117"	"51.78"	"31.46"	"2.0"	"292.4"	"5.6"	"25.40"	"35.75"	"18.04"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.268E-06"	"3.48"	"47.96"
"730"	"False"	"High"	"[K].AEAMLGPSLSPGQDSEGDSSYKNIHLEK.[K]"	"1xBiotin [K]"	"0.000195"	"0.000721313"	"1"	"1"	"6"	"P09581"	"P09581 [677-704]"	"P09581 1xBiotin [K]"	"1"	"3186.47180"	"0.942"	"1.329"	"0.998339301563982"	"0.919235111389825"	"73.36"	"99.61"	"88.4"	"94.0"	"117.5"	"86.89"	"31.94"	"86.75"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.806E-05"	"4.21"	"46.96"
"3491"	"False"	"High"	"[R].AQQMTGTKSQGPTKPPPPR.[K]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.000733761"	"0.000721313"	"1"	"1"	"11"	"O88839-3"	"O88839-3 [753-771]"	"O88839-3 1xBiotin [K760]"	"1"	"2249.11653"	"0.170"	"0.702"	"0.925138005747468"	"0.906515362333117"	"66.13"	"67.87"	"163.1"	"28.1"	"108.9"	"48.53"	"39.26"	"69.20"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"6.406E-05"	"3.64"	"23.18"
"2715"	"False"	"High"	"[K].AIWNVINWENVTER.[Y]"	""	"0.00180054"	"0.000721313"	"1"	"1"	"2"	"P09671"	"P09671 [203-216]"	""	"0"	"1743.88129"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.000151"	"3.45"	""
"17508"	"False"	"High"	"[K].FGYQFTQQGPR.[T]"	""	"0.000835649"	"0.000721313"	"1"	"1"	"6"	"Q9JHJ0"	"Q9JHJ0 [318-328]"	""	"0"	"1328.63821"	"161.791"	"1.844"	"0.392568032137937"	"0.956043974317412"	"73.55"	"82.14"	"1.7"	"295.6"	"2.7"	"56.84"	"51.56"	"107.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"7.25E-05"	"2.88"	"36.92"
"21246"	"False"	"High"	"[R].GKSSQITEDFR.[A]"	"1xBiotin [K2]"	"0.0017242"	"0.000721313"	"1"	"1"	"9"	"Q9Z0R9"	"Q9Z0R9 [104-114]"	"Q9Z0R9 1xBiotin [K105]"	"1"	"1493.70530"	"0.396"	"0.595"	"0.925138005747468"	"0.906515362333117"	"78.43"	"70.89"	"155.0"	"62.9"	"82.1"	"43.39"	"26.02"	"51.73"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001446"	"2.63"	"40.03"
"21247"	"False"	"High"	"[R].GKSSSDMPETITSR.[D]"	"1xBiotin [K2]"	"0.00011168"	"0.000721313"	"2"	"4"	"10"	"Q9D8V0-1; Q9D8V0-4"	"Q9D8V0-1 [60-73]; Q9D8V0-4 [60-73]"	"Q9D8V0-1 1xBiotin [K61]; Q9D8V0-4 1xBiotin [K61]"	"1"	"1721.78330"	"0.272"	"0.818"	"0.925138005747468"	"0.906515362333117"	"58.94"	"111.20"	"181.2"	"44.9"	"73.9"	"60.23"	"20.66"	"70.22"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.054E-05"	"3.34"	"35.89"
"21248"	"False"	"High"	"[R].GKSSSDMPETITSR.[D]"	"1xBiotin [K2]; 1xOxidation [M7]"	"0.0012191"	"0.000721313"	"2"	"4"	"2"	"Q9D8V0-1; Q9D8V0-4"	"Q9D8V0-1 [60-73]; Q9D8V0-4 [60-73]"	"Q9D8V0-1 1xBiotin [K61]; Q9D8V0-4 1xBiotin [K61]"	"1"	"1737.77821"	"0.948"	"0.770"	"0.973358748574628"	"0.906515362333117"	"69.11"	"67.94"	"97.0"	"111.2"	"91.7"	"59.90"	"28.75"	"39.40"	"NotUnique"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001043"	"2.82"	"29.52"
"3490"	"False"	"High"	"[R].AQQMTGTKSQGPTKPPPPR.[K]"	"1xBiotin [K8]"	"0.000399954"	"0.000721313"	"1"	"1"	"18"	"O88839-3"	"O88839-3 [753-771]"	"O88839-3 1xBiotin [K760]"	"1"	"2233.12162"	"0.192"	"0.753"	"0.925138005747468"	"0.906515362333117"	"52.79"	"52.36"	"141.6"	"33.0"	"125.4"	"37.45"	"36.29"	"32.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.584E-05"	"3.76"	"26.40"
"18418"	"False"	"High"	"[K].FPSSGLATPQPTALTFAKSSWAR.[Q]"	"1xBiotin [K18]"	"5.14331E-06"	"0.000721313"	"1"	"1"	"33"	"P70295"	"P70295 [360-382]"	"P70295 1xBiotin [K377]"	"1"	"2647.33372"	"0.061"	"1.996"	"0.0016579060893796"	"0.909223670800027"	"53.46"	"51.23"	"91.6"	"6.2"	"202.2"	"42.71"	"35.79"	"34.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.5E-07"	"6.29"	"59.22"
"9762"	"False"	"High"	"[K].DTNKVSLAILQK.[Q]"	"1xBiotin [K4]"	"0.000281005"	"0.000721313"	"1"	"1"	"9"	"Q8R1P5"	"Q8R1P5 [351-362]"	"Q8R1P5 1xBiotin [K354]"	"1"	"1555.85124"	"0.273"	"0.405"	"0.925138005747468"	"0.906515362333117"	"61.59"	"62.65"	"181.5"	"50.1"	"68.4"	"35.56"	"48.64"	"54.50"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"2.553E-05"	"3.45"	"50.39"
"13194"	"False"	"High"	"[R].EKVISFIENSSTPVDR.[H]"	"1xBiotin [K2]"	"0.000170163"	"0.000721313"	"1"	"1"	"11"	"Q8K0F1"	"Q8K0F1 [503-518]"	"Q8K0F1 1xBiotin [K504]"	"1"	"2047.01647"	"0.087"	"0.223"	"0.00389286955825806"	"0.906515362333117"	"98.63"	"133.24"	"244.6"	"20.5"	"34.9"	"84.05"	"48.86"	"121.17"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.585E-05"	"3.98"	"52.96"
"1973"	"False"	"High"	"[K].AIAKGVGIISEGNETVEDIAAR.[L]"	"1xBiotin [K4]"	"2.27378E-05"	"0.000721313"	"1"	"3"	"11"	"Q8VDN2"	"Q8VDN2 [626-647]"	"Q8VDN2 1xBiotin [K629]"	"1"	"2439.25480"	"0.143"	"0.198"	"0.486690115660178"	"0.906515362333117"	"57.76"	"114.64"	"233.2"	"33.4"	"33.4"	"46.55"	"41.58"	"152.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"2.292E-06"	"5.10"	"54.51"
"21287"	"False"	"High"	"[K].GIAFPTSISVNNCVCHFSPLK.[S]"	"2xCarbamidomethyl [C13; C15]"	"0.000364477"	"0.000721313"	"1"	"2"	"9"	"P50580"	"P50580 [73-93]"	""	"0"	"2348.15258"	"52.743"	"2.586"	"0.53012019938047"	"0.935866453494337"	"100.52"	"61.11"	"4.1"	"284.8"	"11.1"	"53.95"	"66.80"	"57.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.286E-05"	"3.78"	"52.24"
"17558"	"False"	"High"	"[R].FHSGNKSPEVLR.[A]"	"1xBiotin [K6]"	"8.4517E-05"	"0.000721313"	"1"	"1"	"33"	"Q99LI2"	"Q99LI2 [427-438]"	"Q99LI2 1xBiotin [K432]"	"1"	"1596.79512"	"0.007"	"0.726"	"3.88278458712235E-06"	"0.906515362333117"	"33.95"	"20.90"	"175.9"	"1.3"	"122.8"	"24.53"	"36.92"	"29.60"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.095E-06"	"3.85"	"34.08"
"19603"	"False"	"High"	"[R].GAWDWSMLWK.[R]"	"1xOxidation [M7]"	"0.00216789"	"0.000721313"	"1"	"3"	"5"	"Q80VA0"	"Q80VA0 [354-363]"	""	"0"	"1295.58776"	"83.874"	"1.781"	"0.557903440355138"	"0.978994246450461"	"33.10"	"37.38"	"3.6"	"289.7"	"6.7"	"16.83"	"30.55"	"47.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001793"	"2.97"	"59.87"
"21317"	"False"	"High"	"[R].GICDYLPSPNKTTPLLSPVK.[A]"	"1xBiotin [K11]; 1xCarbamidomethyl [C3]"	"0.000957591"	"0.000721313"	"1"	"4"	"10"	"Q6P1H6-1"	"Q6P1H6-1 [259-278]"	"Q6P1H6-1 1xBiotin [K269]"	"1"	"2426.24581"	"0.246"	"0.992"	"0.925138005747468"	"0.906515362333117"	"50.68"	"59.10"	"123.0"	"35.9"	"141.1"	"36.99"	"29.43"	"44.68"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.282E-05"	"3.81"	"56.94"
"419"	"False"	"High"	"[R].AAYSNFWCGMTSQGYYK.[R]"	"1xCarbamidomethyl [C8]"	"0.000233362"	"0.000721313"	"1"	"1"	"8"	"Q8K297"	"Q8K297 [191-207]"	""	"0"	"2033.85204"	"8.056"	"3.039"	"0.925138005747468"	"0.906515362333117"	"135.01"	"84.55"	"28.1"	"167.7"	"104.2"	"59.63"	"142.11"	"55.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.138E-05"	"3.83"	"51.28"
"18303"	"False"	"High"	"[K].FNVWDVGGQDKIRPLWR.[H]"	"1xBiotin [K11]"	"0.00100621"	"0.000721313"	"1"	"1"	"5"	"P62331"	"P62331 [59-75]"	"P62331 1xBiotin [K69]"	"1"	"2312.17570"	"1.228"	"1.832"	""	"0.916215054610739"	"62.48"	"95.37"	"75.6"	"116.4"	"108.0"	"48.58"	"32.42"	"114.60"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"8.675E-05"	"2.69"	"58.54"
"18284"	"False"	"High"	"[K].FNSKFITTVGIDFR.[E]"	"1xBiotin [K4]"	"9.92826E-05"	"0.000721313"	"1"	"1"	"18"	"Q9ERI2"	"Q9ERI2 [34-47]"	"Q9ERI2 1xBiotin [K37]"	"1"	"1870.95202"	"4.837"	"1.091"	"0.925138005747468"	"0.906515362333117"	"39.85"	"31.03"	"42.1"	"213.1"	"44.8"	"22.11"	"39.51"	"47.17"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.447E-06"	"3.57"	"59.32"
"14706"	"False"	"High"	"[K].ENPKVVNEINIEDLCLTKAAYCR.[C]"	"1xBiotin [K18]; 2xCarbamidomethyl [C15; C22]"	"0.00117465"	"0.000721313"	"1"	"1"	"1"	"Q9CQB5"	"Q9CQB5 [78-100]"	"Q9CQB5 1xBiotin [K95]"	"2"	"2975.44236"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001006"	"4.51"	""
"21395"	"False"	"High"	"[K].GIFNGFSITLK.[E]"	""	"0.00185714"	"0.000721313"	"1"	"1"	"19"	"Q8VEM8"	"Q8VEM8 [97-107]"	""	"0"	"1196.66739"	"165.678"	"4.216"	"0.925138005747468"	"0.906515362333117"	"49.08"	"54.18"	"1.8"	"289.6"	"8.6"	"31.35"	"57.83"	"50.90"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001548"	"2.81"	"56.03"
"19596"	"False"	"High"	"[R].GAVSNPAFGKTVR.[D]"	"1xBiotin [K10]"	"0.000569246"	"0.000721313"	"1"	"2"	"10"	"Q8K078"	"Q8K078 [360-372]"	"Q8K078 1xBiotin [K369]"	"1"	"1529.78931"	"0.131"	"1.006"	"0.00981529860488958"	"0.906515362333117"	"29.32"	"56.28"	"149.8"	"18.6"	"131.6"	"40.61"	"23.37"	"44.29"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"5.037E-05"	"3.76"	"39.01"
"18414"	"False"	"High"	"[K].FPSPHPSPAKLK.[A]"	"1xBiotin [K10]"	"0.000256078"	"0.000721313"	"1"	"1"	"19"	"Q61070"	"Q61070 [324-335]"	"Q61070 1xBiotin [K333]"	"1"	"1531.80898"	"0.049"	"0.704"	"0.00111387603340804"	"0.906515362333117"	"69.50"	"38.84"	"171.8"	"9.0"	"119.2"	"47.56"	"56.31"	"24.47"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.341E-05"	"3.44"	"36.11"
"14279"	"False"	"High"	"[R].EMFGLYGQTTGKGSVSLK.[E]"	"1xBiotin [K]; 1xOxidation [M2]"	"0.000122551"	"0.000721313"	"1"	"1"	"27"	"Q9CQC9"	"Q9CQC9 [149-166]"	"Q9CQC9 1xBiotin [K]"	"1"	"2145.03549"	"0.046"	"0.671"	"8.08385900623063E-05"	"0.906515362333117"	"54.83"	"39.59"	"177.6"	"9.5"	"112.9"	"29.06"	"50.22"	"11.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.151E-05"	"3.62"	"47.24"
"21235"	"False"	"High"	"[R].GKSCLPVGPSLSR.[L]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"0.000164975"	"0.000721313"	"1"	"3"	"10"	"Q3U3D7-1"	"Q3U3D7-1 [947-959]"	"Q3U3D7-1 1xBiotin [K948]"	"1"	"1583.80324"	"0.102"	"0.690"	"0.00556263292220494"	"0.906515362333117"	"21.63"	"50.19"	"166.6"	"17.0"	"116.3"	"6.59"	"34.69"	"61.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.531E-05"	"3.88"	"41.60"
"9925"	"False"	"High"	"[K].DVLGPSTVVANSDEPQHLTPGKMSQR.[Q]"	"1xBiotin [K22]"	"0.00171356"	"0.000721313"	"1"	"1"	"4"	"B9EJ86"	"B9EJ86 [21-46]"	"B9EJ86 1xBiotin [K42]"	"1"	"2989.45061"	"0.494"	"0.796"	"0.925138005747468"	"0.906515362333117"	"57.55"	"71.93"	"131.3"	"79.3"	"89.4"	"45.28"	"38.63"	"41.51"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001436"	"2.68"	"44.15"
"17490"	"False"	"High"	"[K].FGTSEMSKPFR.[I]"	"1xBiotin [K8]"	"0.00215451"	"0.000721313"	"1"	"1"	"7"	"Q9ERU9"	"Q9ERU9 [1538-1548]"	"Q9ERU9 1xBiotin [K1545]"	"0"	"1512.69738"	"0.262"	"0.879"	"0.925138005747468"	"0.906515362333117"	"40.90"	"31.11"	"142.2"	"34.6"	"123.1"	"35.85"	"35.57"	"40.92"	""	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001789"	"2.83"	"44.72"
"21093"	"False"	"High"	"[K].GKEVDNFVDK.[L]"	"1xBiotin [K2]"	"0.00188027"	"0.000721313"	"1"	"1"	"11"	"Q5XJY5"	"Q5XJY5 [232-241]"	"Q5XJY5 1xBiotin [K233]"	"1"	"1376.65148"	"0.055"	"0.883"	"0.00472417018594241"	"0.906515362333117"	"58.24"	"72.81"	"157.0"	"8.6"	"134.4"	"49.51"	"42.79"	"48.09"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000157"	"3.29"	"39.27"
"21112"	"False"	"High"	"[K].GKGFSVVADTPELQR.[I]"	"1xBiotin [K2]"	"0.000112374"	"0.000721313"	"1"	"1"	"6"	"Q61792"	"Q61792 [95-109]"	"Q61792 1xBiotin [K96]"	"1"	"1829.92144"	"0.057"	"0.808"	"0.00282378710236159"	"0.906515362333117"	"42.92"	"58.06"	"149.5"	"9.2"	"141.2"	"58.66"	"33.95"	"36.12"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"1.064E-05"	"2.52"	"47.04"
"21118"	"False"	"High"	"[K].GKGHTDAEIEAIFTK.[Y]"	"1xBiotin [K2]"	"3.33403E-06"	"0.000721313"	"1"	"2"	"9"	"O35245-1"	"O35245-1 [745-759]"	"O35245-1 1xBiotin [K746]"	"1"	"1842.90546"	"0.174"	"0.785"	"0.925138005747468"	"0.906515362333117"	"63.90"	"36.78"	"153.2"	"27.0"	"119.8"	"28.48"	"51.02"	"15.66"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.627E-07"	"4.34"	"47.79"
"9967"	"False"	"High"	"[R].DVPISEVNKMFFLGAK.[E]"	"1xBiotin [K9]"	"0.000975543"	"0.000721313"	"1"	"1"	"17"	"Q9JHG1"	"Q9JHG1 [113-128]"	"Q9JHG1 1xBiotin [K121]"	"1"	"2021.02347"	"0.221"	"1.087"	"0.925138005747468"	"0.936238272383155"	"72.53"	"70.81"	"129.8"	"29.0"	"141.1"	"66.96"	"49.96"	"40.90"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.436E-05"	"3.95"	"62.76"
"21123"	"False"	"High"	"[K].GKGLSVLLSHAK.[A]"	"1xBiotin [K2]"	"6.9323E-05"	"0.000721313"	"1"	"1"	"48"	"Q99P91"	"Q99P91 [542-553]"	"Q99P91 1xBiotin [K543]"	"1"	"1435.80898"	"0.024"	"1.080"	"4.18594815034289E-05"	"0.927892136092816"	"315.83"	"62.44"	"132.9"	"3.7"	"163.4"	"40.66"	"113.33"	"52.34"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.679E-06"	"2.99"	"45.51"
"16916"	"False"	"High"	"[K].FAISELFAK.[N]"	""	"0.00130501"	"0.000721313"	"1"	"1"	"13"	"P09405"	"P09405 [327-335]"	""	"0"	"1025.56661"	"151.345"	"4.518"	"0.925138005747468"	"0.906515362333117"	"64.08"	"58.92"	"2.0"	"287.5"	"10.5"	"44.07"	"48.58"	"37.48"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001108"	"2.47"	"54.77"
"578"	"False"	"High"	"[R].ADLDQPKFFTFDSLTELTSR.[T]"	"1xBiotin [K7]"	"3.09906E-05"	"0.000721313"	"1"	"1"	"18"	"Q8BH02"	"Q8BH02 [64-83]"	"Q8BH02 1xBiotin [K70]"	"1"	"2557.22792"	"0.706"	"11.651"	"0.974765113989106"	"0.906515362333117"	"118.85"	"86.87"	"22.5"	"17.5"	"259.9"	"67.22"	"175.95"	"37.19"	""	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.082E-06"	"5.14"	"65.21"
"17491"	"False"	"High"	"[K].FGTSEMSKPFR.[I]"	"1xBiotin [K8]; 1xOxidation [M6]"	"0.00212801"	"0.000721313"	"1"	"1"	"12"	"Q9ERU9"	"Q9ERU9 [1538-1548]"	"Q9ERU9 1xBiotin [K1545]"	"0"	"1528.69230"	"0.264"	"0.620"	"0.925138005747468"	"0.906515362333117"	"35.44"	"30.53"	"155.3"	"42.2"	"102.5"	"18.77"	"34.79"	"40.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001762"	"2.84"	"39.41"
"18505"	"False"	"High"	"[K].FQTSKSGSLPLGQK.[V]"	"1xBiotin [K5]"	"0.000164975"	"0.000721313"	"1"	"2"	"12"	"Q6P1H6-1"	"Q6P1H6-1 [682-695]"	"Q6P1H6-1 1xBiotin [K686]"	"1"	"1703.87852"	"0.153"	"1.150"	"0.0121361581746884"	"0.906515362333117"	"106.45"	"85.22"	"131.0"	"18.3"	"150.7"	"101.75"	"40.81"	"53.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"1.531E-05"	"4.17"	"40.96"
"573"	"False"	"High"	"[R].ADKSAVGFDYK.[G]"	"1xBiotin [K3]"	"0.00034686"	"0.000721313"	"1"	"1"	"13"	"P49710"	"P49710 [131-141]"	"P49710 1xBiotin [K133]"	"1"	"1426.66713"	"0.046"	"0.773"	"0.0022831378384146"	"0.906515362333117"	"60.62"	"30.80"	"161.1"	"6.8"	"132.1"	"49.05"	"66.32"	"13.68"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.132E-05"	"3.63"	"40.35"
"16898"	"False"	"High"	"[R].FALGLSGGSLVSMLAR.[D]"	"1xOxidation [M13]"	"0.000306454"	"0.000721313"	"1"	"1"	"12"	"Q9CQ60"	"Q9CQ60 [41-56]"	""	"0"	"1594.86214"	"69.027"	"1.090"	"0.541642902569741"	""	"56.23"	"37.45"	"4.4"	"291.0"	"4.7"	"16.54"	"45.33"	"38.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.784E-05"	"3.24"	"56.12"
"21154"	"False"	"High"	"[K].GKLDVQFSGLAKGDAVR.[D]"	"1xBiotin [K12]"	"0.000766263"	"0.000721313"	"1"	"1"	"3"	"Q8BTM8"	"Q8BTM8 [905-921]"	"Q8BTM8 1xBiotin [K916]"	"2"	"1987.04296"	"0.610"	"0.860"	"0.925138005747468"	"0.906515362333117"	"66.33"	"66.50"	"114.6"	"86.9"	"98.6"	"53.44"	"39.59"	"15.48"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"6.684E-05"	"3.82"	"45.75"
"2723"	"False"	"High"	"[K].ALYDTFSAFGNILSCK.[V]"	"1xCarbamidomethyl [C15]"	"1.27036E-05"	"0.000721313"	"1"	"1"	"12"	"P29341"	"P29341 [114-129]"	""	"0"	"1806.87310"	"101.513"	"4.529"	"0.423502284931059"	"0.906515362333117"	"43.13"	"105.28"	"2.8"	"284.5"	"12.7"	"37.65"	"31.59"	"70.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.308E-06"	"3.92"	"61.21"
"14278"	"False"	"High"	"[R].EMFGLYGQTTGKGSVSLK.[E]"	"1xBiotin [K]"	"1.15766E-05"	"0.000721313"	"1"	"1"	"21"	"Q9CQC9"	"Q9CQC9 [149-166]"	"Q9CQC9 1xBiotin [K]"	"1"	"2129.04057"	"0.062"	"0.917"	"0.00311299564619756"	"0.906515362333117"	"61.08"	"52.49"	"140.2"	"8.3"	"151.5"	"40.51"	"37.83"	"20.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.194E-06"	"4.58"	"51.39"
"4520"	"False"	"High"	"[K].AVQQPDGLAVLGIFLK.[I]"	""	"5.24621E-05"	"0.000721313"	"1"	"1"	"33"	"P00920"	"P00920 [133-148]"	""	"0"	"1668.96832"	"292.046"	"16.607"	"0.925138005747468"	"0.906515362333117"	"84.09"	"80.61"	"0.9"	"286.0"	"13.1"	"67.40"	"43.98"	"33.32"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.093E-06"	"3.56"	"65.41"
"21217"	"False"	"High"	"[R].GKPSCGLGPKPLK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C5]"	"0.000785478"	"0.000721313"	"1"	"1"	"11"	"Q80TN4"	"Q80TN4 [730-742]"	"Q80TN4 1xBiotin [K]"	"0"	"1564.83382"	"0.110"	"0.631"	"0.18537743269702"	"0.906515362333117"	"78.65"	"98.23"	"177.0"	"20.3"	"102.7"	"59.58"	"44.56"	"56.66"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"6.83E-05"	"3.38"	"33.26"
"21218"	"False"	"High"	"[K].GKPSQGLSTEENLSASVTSQPGHQK.[E]"	"1xBiotin [K2]"	"0.00060187"	"0.000721313"	"1"	"1"	"5"	"Q4VBD2"	"Q4VBD2 [484-508]"	"Q4VBD2 1xBiotin [K485]"	"0"	"2793.34720"	"0.889"	"0.909"	"0.925138005747468"	"0.906515362333117"	"85.98"	"98.70"	"89.2"	"96.1"	"114.7"	"108.53"	"46.34"	"84.36"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"5.317E-05"	"3.56"	"38.13"
"18464"	"False"	"High"	"[R].FQHVGTSVFLSVTGEQYGNPIR.[G]"	""	"3.13768E-05"	"0.000721313"	"1"	"1"	"1"	"Q9ESP1"	"Q9ESP1 [162-183]"	""	"0"	"2436.23063"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"3.119E-06"	"5.95"	""
"19686"	"False"	"High"	"[R].GCSCILEKASSGWGNATAGK.[C]"	"1xBiotin [K8]; 2xCarbamidomethyl [C2; C4]"	"0.000353364"	"0.000721313"	"1"	"2"	"6"	"Q8K078"	"Q8K078 [552-571]"	"Q8K078 1xBiotin [K559]"	"1"	"2280.02058"	"0.390"	"0.499"	"0.925138005747468"	"0.906515362333117"	"62.72"	"91.99"	"158.2"	"69.4"	"72.3"	"53.63"	"35.28"	"74.78"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"3.183E-05"	"3.29"	"50.43"
"19670"	"False"	"High"	"[R].GCIVDANLSVLNLVIVK.[K]"	"1xCarbamidomethyl [C2]"	"1.74219E-05"	"0.000721313"	"1"	"1"	"13"	"P62754"	"P62754 [99-115]"	""	"0"	"1827.04083"	"122.928"	"5.576"	"0.45528731500856"	"0.906515362333117"	"58.45"	"49.44"	"2.7"	"281.3"	"16.0"	"40.20"	"49.05"	"38.09"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.771E-06"	"4.76"	"62.64"
"18642"	"False"	"High"	"[K].FSFLFGGEFYSYYK.[C]"	""	"0.00168204"	"0.000721313"	"1"	"1"	"9"	"Q8CGZ0"	"Q8CGZ0 [44-57]"	""	"0"	"1754.81009"	"8.001"	"1.845"	"0.992801922882858"	"0.996866540533731"	"236.60"	"68.02"	"29.9"	"215.7"	"54.5"	"26.73"	"127.46"	"53.37"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001411"	"4.09"	"63.11"
"10652"	"False"	"High"	"[R].EASAQEDAKGVGR.[M]"	"1xBiotin [K9]"	"4.60643E-05"	"0.000721313"	"1"	"2"	"34"	"Q3UVK0"	"Q3UVK0 [32-44]"	"Q3UVK0 1xBiotin [K40]"	"1"	"1543.71693"	"3.854"	"0.951"	"0.360971211023604"	"0.906777072223237"	"77.46"	"65.58"	"42.2"	"221.7"	"36.1"	"51.60"	"44.80"	"34.71"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.501E-06"	"3.72"	"28.45"
"1890"	"False"	"High"	"[K].AKSPSSDSWTCADASTGR.[R]"	"1xBiotin [K2]; 1xCarbamidomethyl [C11]"	"2.82414E-05"	"0.000721313"	"1"	"2"	"19"	"Q9EPJ9"	"Q9EPJ9 [340-357]"	"Q9EPJ9 1xBiotin [K341]"	"1"	"2109.89643"	"0.506"	"0.588"	"0.925138005747468"	"0.906515362333117"	"83.79"	"130.52"	"144.1"	"81.7"	"74.2"	"83.21"	"46.78"	"146.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.818E-06"	"4.16"	"35.95"
"17396"	"False"	"High"	"[K].FGKASWAAAAER.[M]"	"1xBiotin [K3]"	"0.000168068"	"0.000721313"	"1"	"2"	"12"	"Q9QXM1"	"Q9QXM1 [456-467]"	"Q9QXM1 1xBiotin [K458]"	"1"	"1490.72089"	"0.156"	"0.706"	"0.523848278015852"	"0.906515362333117"	"44.91"	"37.67"	"156.4"	"26.1"	"117.5"	"69.61"	"30.32"	"45.27"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.561E-05"	"2.99"	"45.22"
"17191"	"False"	"High"	"[K].FEKSSHHWGADVRPELK.[D]"	"1xBiotin [K3]"	"1.27036E-05"	"0.000721313"	"1"	"1"	"80"	"P13011"	"P13011 [34-50]"	"P13011 1xBiotin [K36]"	"1"	"2249.09203"	"0.004"	"1.342"	"1.05627524059028E-06"	"0.998316466510713"	"146.29"	"34.68"	"127.9"	"0.5"	"171.6"	"27.94"	"150.83"	"26.43"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.309E-06"	"4.47"	"37.28"
"12820"	"False"	"High"	"[K].EKATAASLTIPR.[N]"	"1xBiotin [K2]"	"0.000212661"	"0.000721313"	"1"	"2"	"29"	"Q9R233"	"Q9R233 [448-459]"	"Q9R233 1xBiotin [K449]"	"1"	"1483.79372"	"0.374"	"0.642"	"0.0102026690177391"	"0.906515362333117"	"836.66"	"28.13"	"152.0"	"56.1"	"91.9"	"12.47"	"127.91"	"26.74"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.959E-05"	"3.12"	"41.49"
"20433"	"False"	"High"	"[R].GFGLLGSIFGK.[D]"	""	"0.00202522"	"0.000721313"	"1"	"1"	"11"	"Q6TEK5"	"Q6TEK5 [69-79]"	""	"0"	"1095.61971"	"123.224"	"3.048"	"0.497492915698976"	"0.906515362333117"	"53.62"	"84.26"	"2.7"	"289.0"	"8.3"	"37.29"	"28.38"	"65.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000168"	"2.56"	"61.78"
"18891"	"False"	"High"	"[R].FTPGTFTNQIQAAFR.[E]"	""	"4.4384E-05"	"0.000721313"	"1"	"1"	"41"	"P14206"	"P14206 [103-117]"	""	"0"	"1698.85983"	"299.126"	"12.064"	"0.925138005747468"	"0.906515362333117"	"106.14"	"108.17"	"0.8"	"288.7"	"10.5"	"108.26"	"40.65"	"26.72"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.349E-06"	"3.84"	"54.30"
"18875"	"False"	"High"	"[R].FTLWWSPTINR.[A]"	""	"0.00011168"	"0.000721313"	"1"	"1"	"23"	"Q99PV0"	"Q99PV0 [1534-1544]"	""	"0"	"1420.73720"	"79.430"	"2.720"	"0.999791625166089"	"0.906515362333117"	"38.44"	"60.35"	"3.6"	"287.8"	"8.6"	"26.42"	"24.43"	"47.34"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.056E-05"	"2.92"	"58.59"
"12816"	"False"	"High"	"[R].EKAPSLFSSR.[I]"	"1xBiotin [K2]"	"0.00218135"	"0.000721313"	"1"	"1"	"20"	"Q9R1C6"	"Q9R1C6 [388-397]"	"Q9R1C6 1xBiotin [K389]"	"1"	"1347.67255"	"0.069"	"0.868"	"0.00377588650983478"	"0.906515362333117"	"43.28"	"53.37"	"150.7"	"11.8"	"137.6"	"27.03"	"34.59"	"82.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001802"	"2.66"	"42.05"
"1085"	"False"	"High"	"[R].AFLCLSLIGPYR.[L]"	"1xCarbamidomethyl [C4]"	"0.00198797"	"0.000721313"	"1"	"1"	"7"	"Q6NS46"	"Q6NS46 [1226-1237]"	""	"0"	"1409.76097"	"92.349"	"1.539"	"0.471781850843532"	"0.909223670800027"	"62.09"	"54.33"	"3.7"	"290.8"	"5.5"	"46.39"	"33.23"	"32.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0001059"	"0.0001651"	"2.74"	"58.89"
"20449"	"False"	"High"	"[R].GFKDQIYDIFQK.[L]"	""	"0.000138711"	"0.000721313"	"1"	"1"	"17"	"P60843"	"P60843 [191-202]"	""	"1"	"1501.76856"	"325.448"	"8.309"	"0.925138005747468"	"0.906515362333117"	"43.58"	"57.54"	"0.8"	"291.5"	"7.7"	"39.41"	"46.63"	"52.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.302E-05"	"3.72"	"49.85"
"12789"	"False"	"High"	"[R].EKADAVYTGLNTR.[S]"	"1xBiotin [K2]"	"0.000295277"	"0.000721313"	"1"	"1"	"34"	"P20491"	"P20491 [59-71]"	"P20491 1xBiotin [K60]"	"1"	"1663.81083"	"0.009"	"1.221"	"7.37334996085447E-06"	"0.968188498893578"	"52.04"	"43.95"	"132.4"	"1.3"	"166.3"	"23.25"	"42.79"	"40.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.685E-05"	"3.65"	"40.23"
"4064"	"False"	"High"	"[K].ASVKLVNFQQSENTSANEKEVEAEFLR.[L]"	"1xBiotin [K4]"	"0.00133773"	"0.000721313"	"1"	"1"	"3"	"Q60664"	"Q60664 [174-200]"	"Q60664 1xBiotin [K177]"	"2"	"3293.61068"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001136"	"3.62"	""
"20451"	"False"	"High"	"[K].GFKMEVGQYIFVK.[C]"	"1xBiotin [K3]"	"0.0011602"	"0.000721313"	"1"	"1"	"5"	"Q61093"	"Q61093 [316-328]"	"Q61093 1xBiotin [K318]"	"1"	"1771.89100"	"1.082"	"1.156"	"0.925138005747468"	"0.906515362333117"	"39.84"	"81.76"	"105.1"	"99.3"	"95.5"	"35.69"	"32.27"	"68.78"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"9.956E-05"	"3.46"	"58.66"
"12788"	"False"	"High"	"[R].EKAASFLNADGPK.[D]"	"1xBiotin [K2]"	"0.000256078"	"0.000721313"	"1"	"1"	"21"	"A2AAY5"	"A2AAY5 [836-848]"	"A2AAY5 1xBiotin [K837]"	"1"	"1573.76790"	"0.028"	"0.748"	"5.1926043445364E-05"	"0.906515362333117"	"40.83"	"37.04"	"168.3"	"4.8"	"126.9"	"27.79"	"33.42"	"28.88"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.339E-05"	"3.67"	"42.34"
"18851"	"False"	"High"	"[R].FTHLFWLGDLNYR.[V]"	""	"0.0019155"	"0.000721313"	"1"	"6"	"10"	"Q9ES52-1"	"Q9ES52-1 [582-594]"	""	"0"	"1681.84854"	"57.019"	"2.517"	"0.925138005747468"	"0.925487989474001"	"51.45"	"98.48"	"5.7"	"280.4"	"13.9"	"16.30"	"58.38"	"87.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.0001596"	"3.89"	"57.72"
"17175"	"False"	"High"	"[R].FEGKSCGPLNLSAFGDLTIK.[S]"	"1xBiotin [K4]; 1xCarbamidomethyl [C6]"	"2.58959E-05"	"0.000721313"	"1"	"1"	"7"	"Q78HU3"	"Q78HU3 [224-243]"	"Q78HU3 1xBiotin [K227]"	"1"	"2380.16756"	"0.910"	"2.605"	"0.925138005747468"	"0.919235111389825"	"56.15"	"76.55"	"62.9"	"56.0"	"181.1"	"35.03"	"43.92"	"56.84"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.585E-06"	"4.72"	"61.09"
"12437"	"False"	"High"	"[R].EGMKGQLTEASSATSK.[A]"	"1xBiotin [K4]"	"4.7513E-05"	"0.000721313"	"1"	"3"	"12"	"Q9Z329-1"	"Q9Z329-1 [1861-1876]"	"Q9Z329-1 1xBiotin [K1864]"	"1"	"1850.86227"	"0.181"	"0.873"	"0.925138005747468"	"0.906515362333117"	"36.69"	"21.82"	"142.8"	"24.2"	"133.0"	"15.96"	"39.27"	"12.61"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.654E-06"	"4.00"	"37.61"
"20464"	"False"	"High"	"[R].GFLFGPSLAQELGVGCVLIR.[K]"	"1xCarbamidomethyl [C16]"	"8.88098E-05"	"0.000721313"	"1"	"1"	"7"	"P08030"	"P08030 [68-87]"	""	"0"	"2133.15251"	"0.888"	"1.777"	"0.925138005747468"	"0.998316466510713"	"84.57"	"50.01"	"93.4"	"75.7"	"130.9"	"43.85"	"204.44"	"35.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.464E-06"	"3.75"	"67.02"
"2992"	"False"	"High"	"[K].ANIKDLSHILK.[K]"	"1xBiotin [K4]"	"0.00170299"	"0.000721313"	"1"	"1"	"4"	"Q64324"	"Q64324 [321-331]"	"Q64324 1xBiotin [K324]"	"1"	"1477.81955"	"0.210"	"0.828"	"0.925138005747468"	"0.906515362333117"	"77.12"	"38.78"	"138.2"	"36.8"	"125.0"	"40.14"	"57.31"	"14.95"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001429"	"3.08"	"48.98"
"12162"	"False"	"High"	"[K].EGATKFGSQASQK.[A]"	"1xBiotin [K5]"	"0.0012731"	"0.000721313"	"1"	"2"	"12"	"Q9EPJ9"	"Q9EPJ9 [227-239]"	"Q9EPJ9 1xBiotin [K231]"	"1"	"1564.74242"	"0.139"	"0.766"	"0.103545496390158"	"0.906515362333117"	"32.63"	"18.77"	"157.8"	"23.2"	"119.0"	"16.26"	"30.94"	"19.24"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001086"	"3.12"	"32.32"
"2879"	"False"	"High"	"[K].AMSRPILYSNWLSK.[D]"	"1xOxidation [M2]"	"0.00118929"	"0.000721313"	"1"	"1"	"3"	"Q9JHU4"	"Q9JHU4 [2864-2877]"	""	"0"	"1681.87304"	"84.571"	"1.432"	"0.558644691043429"	"0.906515362333117"	"57.05"	"55.89"	"3.3"	"291.5"	"5.2"	"45.92"	"58.57"	"32.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"0.0001014"	"3.91"	"44.11"
"12161"	"False"	"High"	"[R].EGASKATSQSSIR.[Q]"	"1xBiotin [K5]"	"4.52163E-05"	"0.000721313"	"1"	"1"	"14"	"Q8VBT0"	"Q8VBT0 [253-265]"	"Q8VBT0 1xBiotin [K257]"	"1"	"1547.74823"	"0.023"	"0.867"	"3.76890016561878E-05"	"0.906515362333117"	"83.18"	"29.51"	"158.0"	"3.8"	"138.2"	"26.29"	"65.63"	"12.74"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.438E-06"	"3.41"	"27.42"
"20380"	"False"	"High"	"[K].GFAFVQYVNER.[N]"	""	"0.00105731"	"0.000721313"	"1"	"5"	"7"	"Q9Z204"	"Q9Z204 [51-61]"	""	"0"	"1329.65861"	"96.694"	"2.605"	"0.493475658606494"	"0.935866453494337"	"72.92"	"71.14"	"2.7"	"290.1"	"7.2"	"70.72"	"35.55"	"32.90"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"9.082E-05"	"2.82"	"47.65"
"12888"	"False"	"High"	"[K].EKENQINSFGKNVSGSLK.[N]"	"1xBiotin [K11]"	"0.00117465"	"0.000721313"	"1"	"1"	"1"	"Q9JI11"	"Q9JI11 [403-420]"	"Q9JI11 1xBiotin [K413]"	"2"	"2205.09684"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001004"	"3.22"	""
"17272"	"False"	"High"	"[K].FFLNAKGQK.[E]"	"1xBiotin [K6]"	"0.00165109"	"0.000721313"	"1"	"1"	"24"	"Q9DB25"	"Q9DB25 [45-53]"	"Q9DB25 1xBiotin [K50]"	"1"	"1278.66634"	"0.022"	"0.927"	"3.61097378948738E-05"	"0.906515362333117"	"60.74"	"29.41"	"146.5"	"3.2"	"150.3"	"20.40"	"53.33"	"23.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000139"	"2.93"	"43.90"
"12949"	"False"	"High"	"[R].EKHFNLCLEER.[D]"	"1xBiotin [K2]; 1xCarbamidomethyl [C7]"	"0.000342591"	"0.000721313"	"1"	"1"	"11"	"P58681"	"P58681 [922-932]"	"P58681 1xBiotin [K923]"	"1"	"1700.78832"	"0.106"	"0.944"	"0.00919086960892185"	"0.906515362333117"	"36.29"	"34.91"	"147.9"	"15.7"	"136.4"	"24.79"	"26.27"	"19.98"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.088E-05"	"2.83"	"43.83"
"4003"	"False"	"High"	"[R].ASSHSSQSQGGGSVTKK.[R]"	"1xBiotin [K]"	"0.00103144"	"0.000721313"	"1"	"3"	"13"	"P48678-1"	"P48678-1 [402-418]"	"P48678-1 1xBiotin [K]"	"1"	"1858.87120"	"0.130"	"0.746"	"0.925138005747468"	"0.906515362333117"	"52.64"	"45.83"	"165.4"	"18.2"	"116.4"	"28.92"	"41.50"	"40.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.878E-05"	"2.38"	"18.22"
"20400"	"False"	"High"	"[R].GFENVELGVMGKK.[K]"	"1xBiotin [K]"	"2.8067E-05"	"0.000721313"	"1"	"1"	"17"	"Q8BR63"	"Q8BR63 [33-45]"	"Q8BR63 1xBiotin [K]"	"1"	"1633.80766"	"0.027"	"0.873"	"5.09415307722964E-05"	"0.906515362333117"	"47.61"	"43.95"	"163.1"	"5.1"	"131.7"	"34.36"	"37.39"	"28.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.799E-06"	"4.40"	"49.99"
"20401"	"False"	"High"	"[R].GFENVELGVMGKK.[K]"	"1xBiotin [K]; 1xOxidation [M10]"	"0.000133651"	"0.000721313"	"1"	"1"	"31"	"Q8BR63"	"Q8BR63 [33-45]"	"Q8BR63 1xBiotin [K]"	"1"	"1649.80257"	"0.020"	"0.620"	"3.14739121766013E-05"	"0.906515362333117"	"35.06"	"24.41"	"183.3"	"3.5"	"113.2"	"23.48"	"37.66"	"17.20"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.254E-05"	"4.05"	"44.02"
"17209"	"False"	"High"	"[K].FENAFLSHVISQHQSLLGNIR.[S]"	""	"3.7272E-06"	"0.000721313"	"1"	"1"	"14"	"Q03265"	"Q03265 [507-527]"	""	"0"	"2410.26260"	"54.464"	"9.693"	"0.467621837570913"	"0.906515362333117"	"144.74"	"85.41"	"4.4"	"248.3"	"47.3"	"24.36"	"161.66"	"116.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.018E-07"	"5.16"	"54.93"
"3903"	"False"	"High"	"[R].ASLSKLGDVYVNDAFGTAHR.[A]"	"1xBiotin [K5]"	"0.00150469"	"0.000721313"	"1"	"1"	"2"	"P09411"	"P09411 [152-171]"	"P09411 1xBiotin [K156]"	"1"	"2347.14994"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001273"	"4.28"	""
"1124"	"False"	"High"	"[K].AFNKNNLILEER.[N]"	"1xBiotin [K4]"	"0.000101773"	"0.000721313"	"1"	"1"	"14"	"Q62217"	"Q62217 [1039-1050]"	"Q62217 1xBiotin [K1042]"	"1"	"1686.86320"	"0.047"	"0.709"	"0.00268557976163562"	"0.906515362333117"	"54.88"	"47.01"	"161.9"	"8.8"	"129.3"	"38.99"	"37.68"	"32.39"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.629E-06"	"3.82"	"48.62"
"18951"	"False"	"High"	"[K].FVFFNIPQIQYK.[N]"	""	"0.00148618"	"0.000721313"	"1"	"1"	"9"	"Q9D125"	"Q9D125 [47-58]"	""	"0"	"1543.83076"	"83.480"	"2.223"	"0.925138005747468"	"0.935866453494337"	"54.50"	"86.77"	"3.6"	"288.9"	"7.5"	"54.80"	"37.79"	"60.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001257"	"2.43"	"60.43"
"2945"	"False"	"High"	"[R].ANGCVKNGEVR.[N]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.00151404"	"0.000721313"	"1"	"1"	"8"	"P97363"	"P97363 [16-26]"	"P97363 1xBiotin [K21]"	"1"	"1429.66748"	"0.451"	"0.814"	"0.925138005747468"	"0.906515362333117"	"82.96"	"83.65"	"121.1"	"69.5"	"109.4"	"66.30"	"37.72"	"40.94"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001276"	"3.03"	"26.92"
"17192"	"False"	"High"	"[K].FEKSSHHWGADVRPELKDDLYDPTYQDDEGPPPK.[L]"	"1xBiotin [K]"	"0.000121795"	"0.000721313"	"1"	"1"	"7"	"P13011"	"P13011 [34-67]"	"P13011 1xBiotin [K]"	"2"	"4194.91380"	"0.744"	"11.483"	""	"0.906515362333117"	"58.88"	"99.90"	"23.0"	"19.4"	"257.6"	"28.05"	"46.99"	"73.94"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"1.148E-05"	"4.61"	"43.39"
"17234"	"False"	"High"	"[K].FFADLLDYIK.[A]"	""	"0.00150469"	"0.000721313"	"1"	"1"	"2"	"P00493"	"P00493 [74-83]"	""	"0"	"1244.65615"	"85.315"	"5.093"	"0.925138005747468"	"0.906515362333117"	"67.50"	"78.71"	"2.9"	"278.3"	"18.8"	"59.18"	"40.13"	"41.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"0.000127"	"2.81"	"63.10"
"13063"	"False"	"High"	"[K].EKMVGGIAQIIAAQEEMLR.[K]"	"1xBiotin [K2]"	"0.000158957"	"0.000721313"	"1"	"1"	"5"	"P26039"	"P26039 [2492-2510]"	"P26039 1xBiotin [K2493]"	"1"	"2313.17635"	"1.128"	"1.806"	""	"0.969553290605053"	"59.73"	"60.14"	"76.9"	"91.1"	"132.0"	"49.33"	"35.05"	"43.50"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.479E-05"	"4.41"	"65.51"
"4037"	"False"	"High"	"[K].ASTDKYAVFK.[G]"	"1xBiotin [K5]"	"0.00212801"	"0.000721313"	"1"	"2"	"12"	"Q5SV85"	"Q5SV85 [505-514]"	"Q5SV85 1xBiotin [K509]"	"1"	"1355.66640"	"0.075"	"0.641"	"0.00581484357555921"	"0.906515362333117"	"64.52"	"33.67"	"172.8"	"14.5"	"112.8"	"41.13"	"50.58"	"14.86"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001768"	"2.88"	"43.42"
"4054"	"False"	"High"	"[R].ASTVAVTKEYSFLR.[T]"	"1xBiotin [K8]"	"6.27833E-05"	"0.000721313"	"1"	"2"	"12"	"P55937"	"P55937 [201-214]"	"P55937 1xBiotin [K208]"	"1"	"1797.92038"	"0.112"	"0.636"	"0.925138005747468"	"0.906515362333117"	"39.02"	"48.53"	"159.3"	"17.9"	"122.8"	"25.16"	"34.29"	"52.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.054E-06"	"4.02"	"50.92"
"1736"	"False"	"High"	"[K].AKEIESEEQNLVTK.[G]"	"1xBiotin [K2]"	"1.50157E-05"	"0.000721313"	"1"	"1"	"24"	"Q3U9G9"	"Q3U9G9 [187-200]"	"Q3U9G9 1xBiotin [K188]"	"1"	"1843.91060"	"0.026"	"0.757"	"8.35964709993644E-05"	"0.906515362333117"	"24.75"	"20.07"	"166.9"	"4.3"	"128.8"	"13.12"	"18.20"	"46.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.534E-06"	"3.93"	"40.07"
"18943"	"False"	"High"	"[K].FVDILTNWYVR.[M]"	""	"0.00103144"	"0.000721313"	"1"	"1"	"11"	"Q8BU30"	"Q8BU30 [726-736]"	""	"0"	"1425.75251"	"63.230"	"1.928"	"0.925138005747468"	"0.98754560703028"	"43.82"	"41.34"	"4.0"	"288.5"	"7.5"	"34.31"	"31.61"	"35.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.883E-05"	"2.65"	"59.79"
"20419"	"False"	"High"	"[R].GFGFILFKDSSSVEK.[V]"	"1xBiotin [K8]"	"0.00141438"	"0.000721313"	"1"	"1"	"2"	"Q99020"	"Q99020 [117-131]"	"Q99020 1xBiotin [K124]"	"1"	"1886.93570"	"0.749"	"0.825"	"0.94340856990521"	"0.906515362333117"	"60.92"	"59.20"	"122.7"	"88.0"	"89.2"	"45.51"	"44.79"	"34.71"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001198"	"3.52"	"61.41"
"1742"	"False"	"High"	"[R].AKELTGSNLLLQSPGVLTAAR.[E]"	"1xBiotin [K2]"	"5.75691E-05"	"0.000721313"	"1"	"1"	"14"	"P20934"	"P20934 [191-211]"	"P20934 1xBiotin [K192]"	"1"	"2365.29079"	"0.149"	"1.000"	"0.925138005747468"	"0.906515362333117"	"34.15"	"39.32"	"139.4"	"21.4"	"139.3"	"17.52"	"35.74"	"52.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.592E-06"	"4.85"	"55.61"
"12974"	"False"	"High"	"[R].EKLCFLDKVEPQATISEIK.[T]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"2.21541E-06"	"0.000721313"	"1"	"1"	"26"	"Q9CY27"	"Q9CY27 [15-33]"	"Q9CY27 1xBiotin [K16]"	"2"	"2474.26694"	"0.019"	"1.385"	"2.73340848125914E-05"	"0.988273606811704"	"140.76"	"31.62"	"127.2"	"2.4"	"170.4"	"41.99"	"163.45"	"19.62"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.436E-07"	"5.07"	"53.08"
"12973"	"False"	"High"	"[R].EKLCFLDK.[V]"	"1xBiotin [K2]; 1xCarbamidomethyl [C4]"	"0.00105731"	"0.000721313"	"1"	"1"	"30"	"Q9CY27"	"Q9CY27 [15-22]"	"Q9CY27 1xBiotin [K16]"	"1"	"1278.62209"	"0.022"	"0.856"	"3.61097378948738E-05"	"0.906515362333117"	"290.56"	"28.65"	"159.8"	"3.4"	"136.7"	"21.16"	"109.57"	"16.13"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.074E-05"	"2.98"	"46.53"
"4063"	"False"	"High"	"[K].ASVKLVNFQQSENTSANEK.[E]"	"1xBiotin [K4]"	"2.05928E-05"	"0.000721313"	"1"	"1"	"25"	"Q60664"	"Q60664 [174-192]"	"Q60664 1xBiotin [K177]"	"1"	"2320.12378"	"0.036"	"0.955"	"5.9522133650987E-05"	"0.907108336447894"	"56.68"	"39.73"	"156.0"	"6.0"	"138.0"	"32.55"	"48.60"	"33.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.075E-06"	"4.51"	"43.14"
"20426"	"False"	"High"	"[R].GFGGKYGVER.[D]"	"1xBiotin [K5]"	"0.00211488"	"0.000721313"	"1"	"1"	"10"	"P49710"	"P49710 [119-128]"	"P49710 1xBiotin [K123]"	"1"	"1295.62012"	"0.076"	"0.717"	"0.00106037065772329"	"0.906515362333117"	"24.80"	"31.04"	"166.2"	"12.8"	"121.0"	"41.91"	"10.29"	"31.75"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001754"	"2.86"	"38.74"
"18816"	"False"	"High"	"[R].FTAPTGVSQPVGKVFVEK.[S]"	"1xBiotin [K13]"	"0.000422878"	"0.000721313"	"1"	"3"	"17"	"Q3V0J1-1"	"Q3V0J1-1 [188-205]"	"Q3V0J1-1 1xBiotin [K200]"	"1"	"2117.10997"	"0.305"	"0.693"	"0.925138005747468"	"0.906515362333117"	"57.27"	"72.22"	"152.0"	"50.4"	"97.6"	"41.83"	"36.72"	"57.24"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.779E-05"	"4.31"	"49.29"
"16872"	"False"	"High"	"[K].FAGAKAISSDMFFGR.[E]"	"1xBiotin [K5]; 1xOxidation [M11]"	"1.10855E-05"	"0.000721313"	"1"	"2"	"37"	"Q99K28"	"Q99K28 [424-438]"	"Q99K28 1xBiotin [K428]"	"1"	"1846.86149"	"0.035"	"0.861"	"8.56512242246183E-05"	"0.906515362333117"	"39.24"	"16.66"	"159.9"	"5.5"	"134.6"	"14.55"	"228.69"	"18.31"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.15E-06"	"4.00"	"51.16"
"17098"	"False"	"High"	"[K].FDLGQDVIDFTGHSLALYR.[T]"	""	"5.86487E-05"	"0.000721313"	"1"	"2"	"9"	"Q61598"	"Q61598 [175-193]"	""	"0"	"2167.08184"	"7.169"	"2.010"	"0.925138005747468"	"0.978504945007661"	"309.75"	"85.71"	"36.4"	"196.9"	"66.6"	"31.43"	"111.67"	"66.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.678E-06"	"4.43"	"62.49"
"18806"	"False"	"High"	"[R].FSWNVWPSSR.[L]"	""	"0.000981602"	"0.000721313"	"1"	"2"	"44"	"Q01405"	"Q01405 [19-28]"	""	"0"	"1265.60618"	"66.722"	"2.597"	"0.982626859977453"	"0.906515362333117"	"57.42"	"64.24"	"4.2"	"284.2"	"11.7"	"50.31"	"28.25"	"27.47"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.469E-05"	"2.73"	"51.89"
"2800"	"False"	"High"	"[K].AMGIMNSFVNDIFER.[I]"	""	"1.33488E-05"	"0.000721313"	"2"	"12"	"30"	"Q64525; Q6ZWY9"	"Q64525 [59-73]; Q6ZWY9 [59-73]"	""	"0"	"1743.81929"	"317.389"	"85.470"	"0.925138005747468"	"0.0105334519071409"	"103.99"	"77.72"	"0.7"	"232.5"	"66.8"	"65.50"	"82.28"	"52.18"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.368E-06"	"4.64"	"63.69"
"12029"	"False"	"High"	"[K].EFIESLQLKPGQVVYK.[C]"	"1xBiotin [K9]"	"0.000132006"	"0.000721313"	"1"	"1"	"22"	"Q8R173"	"Q8R173 [113-128]"	"Q8R173 1xBiotin [K121]"	"0"	"2104.11472"	"0.091"	"0.109"	"0.112331869698662"	"0.906515362333117"	"57.67"	"107.80"	"247.2"	"25.8"	"27.0"	"31.15"	"47.73"	"92.46"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.241E-05"	"3.38"	"54.13"
"20000"	"False"	"High"	"[R].GEALSALDSKANNLSSLSK.[K]"	"1xBiotin [K10]"	"5.4314E-07"	"0.000721313"	"1"	"1"	"101"	"O08547"	"O08547 [160-178]"	"O08547 1xBiotin [K169]"	"1"	"2131.06996"	"5.997"	"0.961"	"0.466031980976297"	"0.909223670800027"	"41.68"	"28.37"	"35.6"	"228.9"	"35.5"	"21.68"	"33.14"	"35.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.329E-08"	"5.58"	"53.95"
"17365"	"False"	"High"	"[K].FGFIVIDGSGALFGTLQGNTR.[E]"	""	"3.50769E-05"	"0.000721313"	"1"	"1"	"12"	"Q8BWY3"	"Q8BWY3 [146-166]"	""	"0"	"2170.12913"	"5.834"	"1.349"	"0.97035293201683"	"0.907108336447894"	"212.13"	"45.30"	"42.2"	"203.5"	"54.4"	"35.87"	"143.79"	"26.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.47E-06"	"4.21"	"63.94"
"11950"	"False"	"High"	"[K].EEVQITEVHSQEGSGQFTLPGALCLKGEGK.[G]"	"1xBiotin [K]; 1xCarbamidomethyl [C24]"	"8.39952E-05"	"0.000721313"	"1"	"1"	"7"	"Q9D8T2"	"Q9D8T2 [169-198]"	"Q9D8T2 1xBiotin [K]"	"1"	"3454.66173"	"1.549"	"4.119"	""	"0.906515362333117"	"79.43"	"118.57"	"35.4"	"65.0"	"199.5"	"61.85"	"42.00"	"94.11"	""	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.047E-06"	"5.13"	"53.44"
"17366"	"False"	"High"	"[K].FGFPAFSGISR.[L]"	""	"0.000928401"	"0.000721313"	"1"	"1"	"29"	"Q9CY64"	"Q9CY64 [161-171]"	""	"0"	"1185.60512"	"161.611"	"3.992"	"0.925138005747468"	"0.906515362333117"	"81.83"	"84.61"	"1.7"	"292.4"	"5.9"	"63.80"	"46.89"	"50.13"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.021E-05"	"2.40"	"52.38"
"17376"	"False"	"High"	"[R].FGGGALKNFHCD.[-]"	"1xBiotin [K7]; 1xCarbamidomethyl [C11]"	"6.47578E-05"	"0.000721313"	"1"	"1"	"26"	"Q9D4V7-1"	"Q9D4V7-1 [225-236]"	"Q9D4V7-1 1xBiotin [K231]"	"1"	"1548.67223"	"0.006"	"0.818"	"3.05446790746258E-06"	"0.906515362333117"	"47.35"	"24.87"	"161.1"	"1.1"	"137.8"	"18.28"	"45.25"	"21.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.254E-06"	"4.48"	"43.86"
"1804"	"False"	"High"	"[K].AKLEEDMLCLLYGKNR.[G]"	"1xBiotin [K14]; 1xCarbamidomethyl [C9]; 1xOxidation [M7]"	"0.000969522"	"0.000721313"	"1"	"2"	"9"	"Q3TNL8-1"	"Q3TNL8-1 [259-274]"	"Q3TNL8-1 1xBiotin [K272]"	"2"	"2195.06574"	"0.355"	"1.262"	"0.925138005747468"	"0.957287483848178"	"84.11"	"74.91"	"108.7"	"50.5"	"140.8"	"70.82"	"42.44"	"23.64"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.362E-05"	"3.92"	"47.40"
"20562"	"False"	"High"	"[K].GFYDKDSSGWSSSK.[D]"	"1xBiotin [K5]"	"0.000945806"	"0.000721313"	"1"	"1"	"4"	"Q62167"	"Q62167 [51-64]"	"Q62167 1xBiotin [K55]"	"1"	"1776.75338"	"0.530"	"0.583"	"0.925138005747468"	"0.906515362333117"	"54.83"	"67.59"	"149.9"	"76.6"	"73.5"	"41.76"	"39.32"	"45.19"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"8.169E-05"	"3.25"	"42.96"
"19017"	"False"	"High"	"[R].FVTAIWNLLVTTGR.[E]"	""	"0.000616964"	"0.000721313"	"1"	"1"	"9"	"Q9ERK4"	"Q9ERK4 [293-306]"	""	"0"	"1590.90024"	"2.629"	"3.414"	"0.929914280807057"	"0.906515362333117"	"108.42"	"86.11"	"56.8"	"87.1"	"156.1"	"62.17"	"150.13"	"88.45"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.431E-05"	"2.91"	"64.75"
"17027"	"False"	"High"	"[R].FCIWTESAFR.[K]"	"1xCarbamidomethyl [C2]"	"0.00180054"	"0.000721313"	"1"	"1"	"21"	"Q9D8E6"	"Q9D8E6 [249-258]"	""	"0"	"1316.60922"	"168.890"	"7.182"	"0.925138005747468"	"0.906515362333117"	"99.60"	"93.66"	"1.5"	"288.0"	"10.6"	"76.18"	"38.02"	"59.78"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001506"	"2.44"	"51.98"
"18667"	"False"	"High"	"[R].FSGTYTCMNTFKGR.[T]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]"	"2.58959E-05"	"0.000721313"	"1"	"2"	"12"	"O88876-2"	"O88876-2 [222-235]"	"O88876-2 1xBiotin [K233]"	"1"	"1895.82372"	"0.258"	"0.722"	"0.925138005747468"	"0.906515362333117"	"39.64"	"65.04"	"148.1"	"39.1"	"112.8"	"32.39"	"32.76"	"55.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.591E-06"	"3.76"	"44.70"
"11893"	"False"	"High"	"[K].EESTEASASKR.[L]"	"1xBiotin [K10]"	"0.00101875"	"0.000721313"	"1"	"2"	"10"	"Q9D8V0-1"	"Q9D8V0-1 [362-372]"	"Q9D8V0-1 1xBiotin [K371]"	"1"	"1420.63728"	"0.331"	"0.928"	"0.925138005747468"	"0.914437694911087"	"96.71"	"80.51"	"143.9"	"38.0"	"118.1"	"58.36"	"54.69"	"38.84"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.795E-05"	"3.32"	"22.64"
"17384"	"False"	"High"	"[R].FGGNPGGFGNQGGFGNSR.[G]"	""	"2.98233E-06"	"0.000721313"	"1"	"1"	"12"	"Q921F2"	"Q921F2 [276-293]"	""	"0"	"1726.76806"	"155.126"	"5.009"	"0.434246295660543"	"0.906515362333117"	"56.32"	"48.48"	"1.9"	"288.0"	"10.1"	"35.53"	"124.58"	"36.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.241E-07"	"3.93"	"36.15"
"3013"	"False"	"High"	"[K].ANLTCKLAIDNLEK.[A]"	"1xBiotin [K6]; 1xCarbamidomethyl [C5]"	"3.99488E-05"	"0.000721313"	"1"	"1"	"11"	"Q6QD59"	"Q6QD59 [98-111]"	"Q6QD59 1xBiotin [K103]"	"1"	"1828.92957"	"0.188"	"0.289"	"0.925138005747468"	"0.906515362333117"	"37.38"	"71.61"	"201.1"	"36.8"	"62.1"	"33.17"	"36.00"	"58.50"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.937E-06"	"4.37"	"50.80"
"11674"	"False"	"High"	"[K].EELLNAMVAKLGNR.[E]"	"1xBiotin [K10]"	"0.0002625"	"0.000721313"	"1"	"1"	"13"	"Q9D2V7"	"Q9D2V7 [891-904]"	"Q9D2V7 1xBiotin [K900]"	"1"	"1783.91934"	"0.160"	"1.002"	"0.0128776403420873"	"0.906515362333117"	"92.45"	"83.47"	"141.0"	"25.3"	"133.6"	"74.31"	"193.96"	"26.03"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.4E-05"	"3.77"	"61.86"
"17393"	"False"	"High"	"[K].FGHVDQEKTPSFAFQGGSNTEFK.[S]"	"1xBiotin [K8]"	"9.50706E-05"	"0.000721313"	"1"	"1"	"10"	"Q9ERU9"	"Q9ERU9 [1696-1718]"	"Q9ERU9 1xBiotin [K1703]"	"1"	"2784.27224"	"0.225"	"0.516"	"0.925138005747468"	"0.906515362333117"	"80.32"	"123.63"	"198.1"	"37.0"	"64.9"	"58.44"	"36.47"	"133.88"	""	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.033E-06"	"4.65"	"46.86"
"1658"	"False"	"High"	"[R].AHSFTSKSPSPLLPPPPPK.[R]"	"1xBiotin [K7]"	"0.000233362"	"0.000721313"	"1"	"1"	"7"	"Q06649"	"Q06649 [223-241]"	"Q06649 1xBiotin [K229]"	"1"	"2211.16307"	"0.479"	"0.741"	"0.925138005747468"	"0.906515362333117"	"73.03"	"88.16"	"134.2"	"66.3"	"99.5"	"57.91"	"28.34"	"120.92"	""	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"2.136E-05"	"4.47"	"42.98"
"11319"	"False"	"High"	"[R].EEAAPPTPAPDDLAQLKNLR.[S]"	"1xBiotin [K17]"	"4.01969E-05"	"0.000721313"	"1"	"1"	"12"	"Q80WJ7"	"Q80WJ7 [90-109]"	"Q80WJ7 1xBiotin [K106]"	"1"	"2372.19147"	"0.185"	"0.955"	"0.925138005747468"	"0.916215054610739"	"56.57"	"62.29"	"140.6"	"25.1"	"134.2"	"57.09"	"47.56"	"42.02"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.943E-06"	"5.01"	"54.37"
"18644"	"False"	"High"	"[R].FSFLSKPVDENNQQDGEDDSLVSR.[F]"	"1xBiotin [K6]"	"0.000127191"	"0.000721313"	"1"	"1"	"3"	"Q6PFD9"	"Q6PFD9 [634-657]"	"Q6PFD9 1xBiotin [K639]"	"0"	"2952.33160"	"0.450"	"0.917"	"0.925138005747468"	"0.906515362333117"	"64.96"	"74.64"	"141.5"	"56.1"	"102.4"	"93.26"	"54.36"	"88.63"	""	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.195E-05"	"4.50"	"54.34"
"1829"	"False"	"High"	"[K].AKLVTLLTR.[E]"	"1xBiotin [K2]"	"0.0019155"	"0.000721313"	"1"	"1"	"17"	"Q9QZK7-1"	"Q9QZK7-1 [424-432]"	"Q9QZK7-1 1xBiotin [K425]"	"1"	"1240.74459"	"0.043"	"1.069"	"0.000218033299216399"	"0.924306229746472"	"53.18"	"33.64"	"139.9"	"6.3"	"153.8"	"26.12"	"38.32"	"22.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"0.00016"	"2.88"	"51.53"
"2801"	"False"	"High"	"[K].AMGIMNSFVNDIFER.[I]"	"1xOxidation [M]"	"1.28619E-05"	"0.000721313"	"2"	"12"	"132"	"Q64525; Q6ZWY9"	"Q64525 [59-73]; Q6ZWY9 [59-73]"	""	"0"	"1759.81420"	"529.526"	"53.116"	"0.666161515527971"	"0.0412650142443358"	"92.32"	"78.54"	"0.4"	"279.6"	"20.0"	"81.14"	"51.39"	"52.99"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.321E-06"	"4.54"	"61.14"
"17362"	"False"	"High"	"[K].FGFGFGGTGK.[K]"	""	"0.00214122"	"0.000721313"	"1"	"1"	"12"	"Q91VR5"	"Q91VR5 [163-172]"	""	"0"	"974.47304"	"146.300"	"3.738"	"0.925138005747468"	"0.906515362333117"	"61.20"	"67.38"	"1.8"	"291.6"	"6.6"	"56.50"	"28.60"	"42.64"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001772"	"2.87"	"42.82"
"13441"	"False"	"High"	"[K].EIESEEQNLVTKGPAPLGTFQVTTPQRK.[D]"	"1xBiotin [K12]"	"9.30912E-07"	"0.000721313"	"1"	"1"	"40"	"Q3U9G9"	"Q3U9G9 [189-216]"	"Q3U9G9 1xBiotin [K200]"	"2"	"3323.69402"	"0.010"	"0.938"	"9.24583087648604E-06"	"0.906515362333117"	"102.78"	"19.35"	"160.7"	"1.6"	"137.7"	"14.08"	"152.91"	"13.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.062E-07"	"5.36"	"50.21"
"17075"	"False"	"High"	"[R].FDGALNVDLTEFQTNLVPYPR.[I]"	""	"1.81713E-06"	"0.000721313"	"1"	"6"	"13"	"P05213"	"P05213 [244-264]"	""	"0"	"2409.20850"	"50.800"	"1.137"	"0.724836608499254"	"0.906515362333117"	"146.84"	"60.62"	"6.7"	"286.5"	"6.8"	"29.85"	"112.02"	"76.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.022E-07"	"4.84"	"61.30"
"1745"	"False"	"High"	"[K].AKETADAISK.[E]"	"1xBiotin [K2]"	"0.000636364"	"0.000721313"	"1"	"1"	"11"	"Q60870"	"Q60870 [159-168]"	"Q60870 1xBiotin [K160]"	"1"	"1259.63001"	"0.029"	"0.681"	"5.71877297220621E-05"	"0.906515362333117"	"36.64"	"25.54"	"175.3"	"5.3"	"119.4"	"16.52"	"41.30"	"19.53"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.614E-05"	"3.32"	"28.27"
"20498"	"False"	"High"	"[K].GFPTIYFSPANK.[K]"	""	"0.000496749"	"0.000721313"	"1"	"1"	"41"	"P27773"	"P27773 [449-460]"	""	"0"	"1341.68376"	"159.006"	"3.058"	"0.925138005747468"	"0.907108336447894"	"58.63"	"67.68"	"2.6"	"289.8"	"7.6"	"39.20"	"52.74"	"57.83"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.421E-05"	"2.78"	"48.28"
"20499"	"False"	"High"	"[K].GFPTIYFSPANKK.[L]"	""	"0.0012191"	"0.000721313"	"1"	"1"	"54"	"P27773"	"P27773 [449-461]"	""	"1"	"1469.77873"	"140.727"	"3.395"	"0.925138005747468"	"0.906515362333117"	"61.70"	"49.61"	"1.8"	"292.1"	"6.1"	"53.64"	"32.59"	"72.29"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000104"	"3.16"	"42.82"
"12127"	"False"	"High"	"[K].EGAAGFFKGIGK.[G]"	"1xBiotin [K8]"	"0.00202522"	"0.000721313"	"1"	"3"	"9"	"Q8BX70-1"	"Q8BX70-1 [3541-3552]"	"Q8BX70-1 1xBiotin [K3548]"	"1"	"1407.70893"	"0.512"	"0.349"	"0.925138005747468"	"0.703457933998885"	"20.60"	"46.91"	"161.8"	"82.8"	"55.5"	"29.85"	"10.72"	"38.57"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001683"	"2.70"	"49.62"
"20510"	"False"	"High"	"[R].GFQRPVYLFHK.[A]"	""	"0.001432"	"0.000721313"	"1"	"1"	"13"	"Q8K3A9"	"Q8K3A9 [650-660]"	""	"0"	"1391.75827"	"104.836"	"3.021"	"0.947989303413716"	"0.906515362333117"	"49.28"	"41.57"	"2.7"	"288.9"	"8.4"	"34.47"	"47.99"	"48.59"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001215"	"3.00"	"35.76"
"20363"	"False"	"High"	"[K].GEVSGLTKEFR.[N]"	"1xBiotin [K8]"	"0.00102508"	"0.000721313"	"1"	"1"	"14"	"Q91WE6"	"Q91WE6 [508-518]"	"Q91WE6 1xBiotin [K515]"	"1"	"1448.72023"	"0.054"	"0.741"	"0.00213009585050323"	"0.906515362333117"	"57.87"	"39.26"	"179.4"	"8.9"	"111.8"	"21.48"	"55.43"	"34.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.84E-05"	"3.11"	"43.32"
"2802"	"False"	"High"	"[K].AMGIMNSFVNDIFER.[I]"	"2xOxidation [M2; M5]"	"3.37558E-06"	"0.000721313"	"2"	"12"	"71"	"Q64525; Q6ZWY9"	"Q64525 [59-73]; Q6ZWY9 [59-73]"	""	"0"	"1775.80912"	"896.001"	"23.601"	"0.466460512690071"	"0.309069956903823"	"70.52"	"73.48"	"0.3"	"291.7"	"8.0"	"55.24"	"50.43"	"47.78"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.656E-07"	"5.07"	"54.12"
"18771"	"False"	"High"	"[R].FSSLTETLHPLKGR.[H]"	"1xBiotin [K12]"	"0.000711393"	"0.000721313"	"1"	"1"	"23"	"Q99LE3"	"Q99LE3 [114-127]"	"Q99LE3 1xBiotin [K125]"	"1"	"1811.94726"	"0.037"	"1.110"	"9.90617365463257E-05"	"0.936238272383155"	"34.05"	"26.05"	"137.0"	"5.2"	"157.8"	"8.80"	"37.50"	"24.31"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.222E-05"	"3.81"	"45.54"
"13440"	"False"	"High"	"[K].EIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"1xBiotin [K12]"	"5.4314E-07"	"0.000721313"	"1"	"1"	"129"	"Q3U9G9"	"Q3U9G9 [189-215]"	"Q3U9G9 1xBiotin [K200]"	"1"	"3195.59905"	"1.827"	"1.158"	"0.141444486160446"	"0.948135901442846"	"70.87"	"49.54"	"70.0"	"151.9"	"78.1"	"69.79"	"42.07"	"28.94"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.331E-08"	"5.95"	"53.53"
"1754"	"False"	"High"	"[K].AKFESLAEEK.[R]"	"1xBiotin [K2]"	"0.0011602"	"0.000721313"	"1"	"1"	"12"	"P49710"	"P49710 [240-249]"	"P49710 1xBiotin [K241]"	"1"	"1377.67188"	"0.148"	"0.795"	"0.191321941208505"	"0.906515362333117"	"42.80"	"21.33"	"154.9"	"21.9"	"123.2"	"18.98"	"40.62"	"12.80"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.906E-05"	"3.10"	"40.67"
"18741"	"False"	"High"	"[K].FSPLTANLMNLLAENGR.[L]"	""	"0.00219489"	"0.000721313"	"1"	"1"	"2"	"Q9DB20"	"Q9DB20 [101-117]"	""	"0"	"1860.96364"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001817"	"3.10"	""
"4080"	"False"	"High"	"[R].ASVVSLMTWKPSKSTLLADDLEVK.[L]"	"1xBiotin [K13]"	"0.000170163"	"0.000721313"	"1"	"1"	"6"	"Q8VD58"	"Q8VD58 [268-291]"	"Q8VD58 1xBiotin [K280]"	"1"	"2844.48856"	"1.926"	"4.031"	""	"0.906515362333117"	"73.94"	"69.41"	"36.4"	"99.2"	"164.4"	"68.51"	"37.03"	"44.33"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.579E-05"	"4.18"	"60.83"
"18725"	"False"	"High"	"[K].FSNQYKATIGADFLTK.[E]"	"1xBiotin [K6]"	"0.000825365"	"0.000721313"	"1"	"1"	"14"	"P51150"	"P51150 [33-48]"	"P51150 1xBiotin [K38]"	"1"	"2030.00517"	"0.081"	"1.344"	"0.00472417018594241"	"0.998099211977233"	"46.34"	"39.62"	"127.2"	"11.5"	"161.3"	"33.10"	"23.92"	"44.39"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.189E-05"	"3.33"	"55.38"
"18720"	"False"	"High"	"[K].FSMVQVWPVR.[Q]"	"1xOxidation [M3]"	"0.000583522"	"0.000721313"	"1"	"2"	"8"	"P50516-1"	"P50516-1 [203-212]"	""	"0"	"1264.65069"	"232.246"	"3.124"	"0.339573869323658"	"0.906515362333117"	"61.34"	"36.35"	"1.1"	"295.1"	"3.7"	"34.88"	"41.99"	"18.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"5.144E-05"	"2.89"	"44.39"
"20074"	"False"	"High"	"[K].GEFKDEEETVTTKHIHITQATETTTTR.[H]"	"1xBiotin [K13]"	"0.00185714"	"0.000721313"	"1"	"2"	"1"	"Q99KN9-1"	"Q99KN9-1 [256-282]"	"Q99KN9-1 1xBiotin [K268]"	"2"	"3329.59542"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001059"	"0.0001554"	"4.05"	""
"18698"	"False"	"High"	"[K].FSLKSILSPK.[N]"	"1xBiotin [K4]"	"0.000963538"	"0.000721313"	"1"	"1"	"9"	"Q09143"	"Q09143 [468-477]"	"Q09143 1xBiotin [K471]"	"1"	"1345.75482"	"0.363"	"0.971"	"0.925138005747468"	"0.906515362333117"	"40.77"	"22.09"	"123.5"	"46.8"	"129.7"	"12.30"	"40.43"	"18.20"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.321E-05"	"2.98"	"58.31"
"17323"	"False"	"High"	"[K].FGAILAQGILDAGGHNVTISLQSR.[T]"	""	"0.00166134"	"0.000721313"	"1"	"1"	"1"	"Q3TXS7"	"Q3TXS7 [728-751]"	""	"0"	"2438.31503"	"1.553"	"0.801"	"0.925138005747468"	""	"71.17"	"57.39"	"90.2"	"142.3"	"67.4"	"43.35"	"201.52"	"40.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"0.0001398"	"3.53"	"56.27"
"17325"	"False"	"High"	"[K].FGANAILGVSLAVCK.[A]"	"1xCarbamidomethyl [C14]"	"1.08009E-06"	"0.000721313"	"1"	"3"	"31"	"P17182"	"P17182 [106-120]"	""	"0"	"1519.83011"	"200.572"	"7.982"	"0.925138005747468"	"0.906515362333117"	"96.95"	"95.08"	"1.3"	"287.0"	"11.7"	"105.30"	"42.82"	"41.64"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.227E-07"	"4.91"	"53.57"
"4124"	"False"	"High"	"[R].ATDFIDQALAHKNGR.[V]"	"1xBiotin [K12]"	"4.54972E-05"	"0.000721313"	"1"	"1"	"16"	"Q9D7X3"	"Q9D7X3 [105-119]"	"Q9D7X3 1xBiotin [K116]"	"1"	"1882.92284"	"0.081"	"0.870"	"0.00234027855666908"	"0.906515362333117"	"48.06"	"24.37"	"151.2"	"13.7"	"135.1"	"26.41"	"43.45"	"16.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.466E-06"	"4.42"	"50.39"
"1803"	"False"	"High"	"[K].AKLEEDMLCLLYGKNR.[G]"	"1xBiotin [K14]; 1xCarbamidomethyl [C9]"	"2.37452E-05"	"0.000721313"	"1"	"2"	"13"	"Q3TNL8-1"	"Q3TNL8-1 [259-274]"	"Q3TNL8-1 1xBiotin [K272]"	"2"	"2179.07083"	"0.216"	"5.130"	"0.925138005747468"	"0.906515362333117"	"65.34"	"70.22"	"47.4"	"12.8"	"239.8"	"57.50"	"46.19"	"22.38"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.38E-06"	"5.47"	"58.47"
"3883"	"False"	"High"	"[R].ASILNTWISLK.[Q]"	""	"0.000512369"	"0.000721313"	"1"	"1"	"9"	"Q9DCL9"	"Q9DCL9 [404-414]"	""	"0"	"1245.72015"	"249.832"	"4.006"	"0.925138005747468"	"0.906515362333117"	"65.00"	"43.68"	"1.5"	"292.8"	"5.7"	"38.60"	"62.05"	"49.16"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0001059"	"4.563E-05"	"2.97"	"56.82"
"2073"	"False"	"High"	"[R].ALEESNYELEGK.[I]"	""	"0.000227652"	"0.000721313"	"1"	"3"	"1"	"P02535-1"	"P02535-1 [164-175]"	""	"0"	"1381.64817"	"0.790"	"0.914"	"0.0384467964643998"	"0.906515362333117"	"68.37"	"39.06"	"112.6"	"83.4"	"104.1"	"74.81"	"243.99"	"35.66"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.092E-05"	"3.73"	"30.34"
"16897"	"False"	"High"	"[R].FALGLSGGSLVSMLAR.[D]"	""	"4.4384E-05"	"0.000721313"	"1"	"1"	"9"	"Q9CQ60"	"Q9CQ60 [41-56]"	""	"0"	"1578.86722"	"34.962"	"3.892"	"0.925138005747468"	"0.906515362333117"	"70.76"	"64.75"	"8.5"	"260.9"	"30.6"	"32.98"	"67.97"	"49.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.361E-06"	"4.53"	"61.92"
"9477"	"False"	"High"	"[K].DSLINLKIQK.[E]"	"1xBiotin [K7]"	"0.00119667"	"0.000721313"	"1"	"1"	"20"	"Q9CQB5"	"Q9CQB5 [68-77]"	"Q9CQB5 1xBiotin [K74]"	"1"	"1397.78210"	"0.054"	"1.213"	"0.000138682206399264"	"0.963994276545741"	"33.08"	"34.61"	"134.8"	"7.7"	"157.5"	"35.03"	"34.49"	"24.55"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001022"	"3.33"	"49.12"
"18101"	"False"	"High"	"[K].FIYVAIAQFIETTK.[K]"	""	"0.000300814"	"0.000721313"	"1"	"3"	"5"	"P29351"	"P29351 [507-520]"	""	"0"	"1643.90432"	"1.820"	"1.251"	"0.947989303413716"	"0.906515362333117"	"69.08"	"57.88"	"75.5"	"130.2"	"94.4"	"52.37"	"223.56"	"30.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001059"	"2.725E-05"	"3.42"	"64.02"
"17736"	"False"	"High"	"[R].FLEQQNQVLQTK.[W]"	""	"0.000104325"	"0.000721313"	"3"	"5"	"5"	"Q9R0H5; Q6NXH9; P04104"	"Q9R0H5 [151-162]; Q6NXH9 [151-162]; P04104 [208-219]"	""	"0"	"1475.78527"	"156.775"	"1.239"	"0.428134753822885"	""	"92.07"	"81.12"	"2.0"	"294.9"	"3.0"	"58.93"	"172.54"	"29.19"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"9.887E-06"	"3.76"	"32.93"
"1273"	"False"	"High"	"[K].AGEGLWVILHLYK.[Q]"	""	"0.00173491"	"0.000721313"	"1"	"1"	"7"	"Q8BVF2"	"Q8BVF2 [110-122]"	""	"0"	"1498.84166"	"85.266"	"1.585"	"0.439658977138175"	"0.916215054610739"	"80.02"	"50.00"	"3.9"	"290.5"	"5.6"	"41.88"	"66.13"	"33.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.000145"	"2.67"	"59.99"
"22092"	"False"	"High"	"[K].GNKPWISLPR.[G]"	""	"0.0013544"	"0.000721313"	"1"	"1"	"35"	"P62702"	"P62702 [231-240]"	""	"0"	"1167.66330"	"173.909"	"5.661"	"0.925138005747468"	"0.906515362333117"	"47.67"	"72.22"	"2.0"	"288.1"	"9.9"	"24.11"	"41.35"	"55.89"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.000115"	"2.17"	"38.51"
"126"	"False"	"High"	"[K].AAGKGDVPTK.[R]"	"1xBiotin [K4]"	"0.000632435"	"0.000721313"	"1"	"1"	"20"	"P12970"	"P12970 [122-131]"	"P12970 1xBiotin [K125]"	"1"	"1169.59832"	"0.026"	"0.902"	"7.83176865929348E-05"	"0.906515362333117"	"79.99"	"46.13"	"152.4"	"4.3"	"143.3"	"36.45"	"57.65"	"43.90"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.573E-05"	"3.41"	"26.71"
"7891"	"False"	"High"	"[K].DKDAYSSFGSR.[DGS]"	"1xBiotin [K2]"	"0.00214122"	"0.000721313"	"1"	"3"	"12"	"Q62167"	"Q62167 [65-75]"	"Q62167 1xBiotin [K66]"	"1"	"1458.63180"	"0.118"	"0.750"	"0.47240665661602"	"0.906515362333117"	"48.93"	"44.19"	"167.1"	"17.2"	"115.7"	"22.76"	"34.99"	"29.85"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001778"	"2.62"	"38.13"
"2244"	"False"	"High"	"[R].ALKLPSTGEGTQFYLFEHVDNAQQFK.[Q]"	"1xBiotin [K3]"	"0.00131312"	"0.000721313"	"1"	"1"	"4"	"O70252"	"O70252 [173-198]"	"O70252 1xBiotin [K175]"	"1"	"3194.56155"	"1.117"	"0.998"	""	"0.906515362333117"	"56.57"	"82.64"	"113.9"	"111.5"	"74.7"	"46.00"	"37.76"	"72.98"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.000112"	"3.51"	"57.13"
"7875"	"False"	"High"	"[R].DKAALGYDYK.[G]"	"1xBiotin [K2]"	"0.00095168"	"0.000721313"	"1"	"1"	"13"	"P49710"	"P49710 [169-178]"	"P49710 1xBiotin [K170]"	"1"	"1369.64566"	"0.041"	"0.817"	"5.09415307722964E-05"	"0.906515362333117"	"40.46"	"35.97"	"163.7"	"7.2"	"129.2"	"17.07"	"35.79"	"62.13"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"8.237E-05"	"3.75"	"40.04"
"19186"	"False"	"High"	"[R].FYSSFSGGFKGPQPR.[S]"	"1xBiotin [K10]"	"3.21638E-05"	"0.000721313"	"1"	"1"	"34"	"Q99KC8"	"Q99KC8 [621-635]"	"Q99KC8 1xBiotin [K630]"	"1"	"1887.88466"	"0.035"	"0.822"	"0.000107319241339062"	"0.906515362333117"	"47.89"	"39.41"	"164.7"	"5.7"	"129.6"	"12.95"	"45.59"	"42.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.185E-06"	"4.23"	"46.85"
"7865"	"False"	"High"	"[K].DHTQVVSLKDKLEFAPK.[A]"	"2xBiotin [K9; K11]"	"0.000409985"	"0.000721313"	"1"	"1"	"9"	"Q78RX3"	"Q78RX3 [65-81]"	"Q78RX3 2xBiotin [K73; K75]"	"2"	"2407.21485"	"0.772"	"2.502"	"0.925138005747468"	"0.913702580837398"	"69.48"	"97.74"	"78.3"	"66.3"	"155.5"	"48.89"	"50.14"	"124.83"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.685E-05"	"4.98"	"57.54"
"19187"	"False"	"High"	"[K].FYSSQWYVVNYK.[Y]"	""	"0.00100621"	"0.000721313"	"1"	"4"	"5"	"Q8BZN6-1"	"Q8BZN6-1 [115-126]"	""	"0"	"1583.75291"	"31.386"	"0.748"	"0.925138005747468"	"0.906515362333117"	"54.50"	"67.74"	"11.4"	"280.7"	"8.0"	"38.13"	"40.24"	"53.02"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"8.692E-05"	"2.83"	"46.83"
"16063"	"False"	"High"	"[K].ESYSVYVYKVLK.[Q]"	"1xBiotin [K9]"	"0.00180054"	"0.000721313"	"2"	"9"	"6"	"Q64525; Q6ZWY9"	"Q64525 [36-47]; Q6ZWY9 [36-47]"	"Q64525 1xBiotin [K44]; Q6ZWY9 1xBiotin [K44]"	"1"	"1703.87131"	"0.636"	"0.883"	"0.943612998034058"	"0.906515362333117"	"76.31"	"65.86"	"111.3"	"96.9"	"91.8"	"53.99"	"204.14"	"69.76"	"NotUnique"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001506"	"2.98"	"55.14"
"22138"	"False"	"High"	"[R].GNPTVEVDLYTAKGLFR.[A]"	"1xBiotin [K13]"	"0.00186867"	"0.000721313"	"1"	"2"	"14"	"P17182"	"P17182 [16-32]"	"P17182 1xBiotin [K28]"	"1"	"2106.06884"	"0.314"	"4.427"	"0.925138005747468"	"0.906515362333117"	"40.16"	"40.53"	"46.8"	"17.9"	"235.3"	"36.67"	"38.52"	"24.22"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001561"	"3.67"	"61.37"
"19365"	"False"	"High"	"[K].GAKEHGAVAVER.[V]"	"1xBiotin [K3]"	"0.0019757"	"0.000721313"	"1"	"3"	"4"	"Q9CZ44-1"	"Q9CZ44-1 [125-136]"	"Q9CZ44-1 1xBiotin [K127]"	"1"	"1449.72671"	"0.756"	"1.451"	"0.939160161221265"	"0.957287483848178"	"58.72"	"72.67"	"115.2"	"78.9"	"105.9"	"47.48"	"29.33"	"61.24"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001641"	"3.15"	"25.46"
"7723"	"False"	"High"	"[K].DGSASGTTLLEALDCILPPTRPTDKPLR.[L]"	"1xCarbamidomethyl [C15]"	"6.83856E-06"	"0.000721313"	"1"	"1"	"9"	"P10126"	"P10126 [220-247]"	""	"0"	"2994.55646"	"13.827"	"10.315"	"0.925138005747468"	"0.906515362333117"	"401.87"	"58.77"	"12.0"	"161.5"	"126.5"	"42.38"	"114.68"	"50.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.211E-07"	"4.44"	"61.16"
"7618"	"False"	"High"	"[R].DGLCSKTVEYHR.[L]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.00066045"	"0.000721313"	"1"	"1"	"20"	"Q8K201"	"Q8K201 [228-239]"	"Q8K201 1xBiotin [K233]"	"1"	"1690.76759"	"0.035"	"0.819"	"8.35964709993644E-05"	"0.906515362333117"	"82.28"	"47.12"	"160.5"	"5.6"	"134.0"	"22.86"	"148.36"	"70.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.808E-05"	"3.61"	"35.94"
"19194"	"False"	"High"	"[K].FYTNPSYFFDLWK.[E]"	""	"0.000120296"	"0.000721313"	"1"	"2"	"10"	"Q8R5H6"	"Q8R5H6 [150-162]"	""	"0"	"1727.81042"	"85.472"	"9.987"	"0.558773744714173"	"0.906515362333117"	"68.09"	"64.66"	"3.3"	"263.4"	"33.3"	"13.00"	"79.10"	"52.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.134E-05"	"3.52"	"64.98"
"1430"	"False"	"High"	"[R].AGLQFPVGR.[VI]"	""	"0.00117465"	"0.000721313"	"3"	"12"	"45"	"Q64523; Q8BFU2; Q64522"	"Q64523 [22-30]; Q8BFU2 [22-30]; Q64522 [22-30]"	""	"0"	"944.53123"	"126.256"	"3.417"	"0.925138005747468"	"0.906515362333117"	"52.79"	"47.69"	"2.6"	"288.5"	"9.0"	"29.75"	"48.72"	"37.90"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001002"	"3.09"	"38.65"
"110"	"False"	"High"	"[R].AAFQLGSPWR.[R]"	""	"0.00189194"	"0.000721313"	"1"	"1"	"32"	"P47738"	"P47738 [87-96]"	""	"0"	"1132.58980"	"128.242"	"3.119"	"0.925138005747468"	"0.906515362333117"	"60.88"	"55.13"	"2.7"	"289.2"	"8.0"	"43.07"	"36.88"	"24.51"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001576"	"2.69"	"45.90"
"22066"	"False"	"High"	"[R].GNFGGSFAGSFGGAGGHAPGVAR.[K]"	""	"4.65234E-07"	"0.000721313"	"1"	"2"	"24"	"Q9D0E1"	"Q9D0E1 [627-649]"	""	"0"	"2034.95290"	"184.176"	"3.398"	"0.925138005747468"	"0.906515362333117"	"60.58"	"74.74"	"1.5"	"292.1"	"6.4"	"51.29"	"39.36"	"49.53"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.462E-08"	"4.70"	"39.84"
"3421"	"False"	"High"	"[R].AQLGVQAFADALLIIPK.[V]"	""	"2.80324E-06"	"0.000721313"	"1"	"1"	"11"	"P80317"	"P80317 [433-449]"	""	"0"	"1768.03673"	"11.651"	"6.114"	"0.925138005747468"	"0.906515362333117"	"245.02"	"65.03"	"17.7"	"186.2"	"96.1"	"47.65"	"112.15"	"58.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.066E-07"	"4.89"	"67.03"
"17729"	"False"	"High"	"[K].FLEGNSVKPASWER.[E]"	"1xBiotin [K8]"	"0.000169112"	"0.000721313"	"1"	"2"	"12"	"Q9EQ32-1"	"Q9EQ32-1 [489-502]"	"Q9EQ32-1 1xBiotin [K496]"	"0"	"1845.89523"	"0.278"	"1.167"	"0.925138005747468"	"0.957287483848178"	"48.79"	"43.17"	"119.2"	"41.9"	"138.9"	"34.78"	"30.58"	"16.73"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.573E-05"	"3.03"	"46.22"
"7951"	"False"	"High"	"[K].DKLEFAPKAVLNR.[N]"	"1xBiotin [K8]"	"0.000264131"	"0.000721313"	"1"	"1"	"11"	"Q78RX3"	"Q78RX3 [74-86]"	"Q78RX3 1xBiotin [K81]"	"2"	"1726.93089"	"0.109"	"0.543"	"0.589758981291394"	"0.906515362333117"	"65.48"	"63.09"	"177.6"	"20.9"	"101.6"	"50.47"	"43.86"	"48.28"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"2.408E-05"	"3.06"	"48.17"
"8441"	"False"	"High"	"[R].DLQSSNQLSNHISSLFR.[E]"	""	"0.000169112"	"0.000721313"	"1"	"2"	"5"	"Q00612"	"Q00612 [176-192]"	""	"0"	"1945.97263"	"53.870"	"2.857"	"0.525372492707907"	"0.916215054610739"	"70.02"	"110.24"	"5.7"	"279.2"	"15.1"	"36.43"	"61.85"	"76.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"1.569E-05"	"2.74"	"50.04"
"2447"	"False"	"High"	"[K].ALNLAYSSIYGSYR.[N]"	""	"0.00018329"	"0.000721313"	"1"	"2"	"12"	"Q7TMB8-1"	"Q7TMB8-1 [893-906]"	""	"0"	"1577.79583"	"110.022"	"2.797"	"0.433180228049634"	"0.906777072223237"	"29.49"	"38.20"	"2.8"	"289.5"	"7.7"	"35.48"	"16.93"	"18.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.695E-05"	"3.45"	"46.96"
"4602"	"False"	"High"	"[R].AVVYSNTIQSIMAIVK.[A]"	""	"0.000512369"	"0.000721313"	"1"	"1"	"2"	"P08752"	"P08752 [71-86]"	""	"0"	"1736.96152"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"4.554E-05"	"4.07"	""
"17661"	"False"	"High"	"[K].FKWWGLQNK.[V]"	""	"0.00149541"	"0.000721313"	"1"	"1"	"24"	"P53810"	"P53810 [201-209]"	""	"1"	"1206.64184"	"66.127"	"1.794"	"0.982626859977453"	"0.916215054610739"	"60.40"	"64.51"	"4.9"	"286.6"	"8.4"	"68.07"	"24.99"	"31.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001264"	"2.78"	"44.50"
"8203"	"False"	"High"	"[K].DLGLKTSSLVLEK.[C]"	"1xBiotin [K5]"	"0.000106282"	"0.000721313"	"1"	"1"	"19"	"Q6ZPJ0"	"Q6ZPJ0 [390-402]"	"Q6ZPJ0 1xBiotin [K394]"	"1"	"1628.89277"	"0.039"	"0.783"	"0.000101658101904298"	"0.906515362333117"	"47.87"	"35.09"	"159.2"	"6.0"	"134.8"	"33.95"	"24.96"	"29.20"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.006E-05"	"3.08"	"52.42"
"8189"	"False"	"High"	"[K].DLGATWVVLGHSER.[R]"	""	"4.3298E-05"	"0.000721313"	"1"	"1"	"25"	"P17751"	"P17751 [136-149]"	""	"0"	"1539.79142"	"412.898"	"12.949"	"0.925138005747468"	"0.906515362333117"	"50.60"	"51.33"	"0.7"	"290.7"	"8.7"	"49.18"	"33.21"	"24.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.245E-06"	"3.60"	"46.32"
"8173"	"False"	"High"	"[K].DIESYKSGSGVNNR.[R]"	"1xBiotin [K6]"	"0.000164975"	"0.000721313"	"1"	"1"	"11"	"O88630"	"O88630 [145-158]"	"O88630 1xBiotin [K150]"	"1"	"1751.80172"	"0.169"	"0.944"	"0.925138005747468"	"0.906515362333117"	"50.03"	"35.26"	"149.4"	"25.9"	"124.7"	"23.98"	"45.48"	"20.07"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.534E-05"	"3.88"	"37.59"
"2205"	"False"	"High"	"[R].ALGVLAQLIWSR.[A]"	""	"3.7783E-05"	"0.000721313"	"1"	"1"	"31"	"Q9CZU6"	"Q9CZU6 [429-440]"	""	"0"	"1326.78923"	"95.665"	"3.726"	"0.949662611758987"	"0.906515362333117"	"61.04"	"59.43"	"3.1"	"285.3"	"11.6"	"48.65"	"37.33"	"33.45"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.721E-06"	"3.58"	"62.52"
"17668"	"False"	"High"	"[K].FLAAGTHLGGTNLDFQMEQYIYK.[R]"	""	"5.01126E-07"	"0.000721313"	"1"	"1"	"10"	"P14206"	"P14206 [18-40]"	""	"0"	"2617.27553"	"56.894"	"3.563"	"0.529141090895061"	"0.906515362333117"	"137.86"	"118.07"	"4.5"	"281.1"	"14.5"	"53.82"	"80.08"	"90.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.86E-08"	"6.77"	"54.29"
"2102"	"False"	"High"	"[K].ALEQFLQEYFDGNLKR.[Y]"	""	"7.65439E-05"	"0.000721313"	"1"	"1"	"7"	"P27773"	"P27773 [348-363]"	""	"1"	"1970.99705"	"85.706"	"4.450"	"0.466460512690071"	"0.906515362333117"	"101.32"	"70.28"	"4.1"	"280.3"	"15.5"	"44.12"	"81.86"	"51.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001059"	"7.335E-06"	"4.67"	"59.63"
"147"	"False"	"High"	"[K].AAGVSVEPFWPGLFAK.[A]"	""	"7.56017E-05"	"0.000721313"	"1"	"1"	"16"	"P47955"	"P47955 [34-49]"	""	"0"	"1675.88425"	"122.567"	"5.460"	"0.355246428641681"	"0.906515362333117"	"75.53"	"63.83"	"2.4"	"284.8"	"12.8"	"40.28"	"62.58"	"53.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.254E-06"	"3.57"	"61.08"
"8059"	"False"	"High"	"[K].DKYVKGLIEGK.[S]"	"1xBiotin [K5]"	"0.000193796"	"0.000721313"	"1"	"2"	"39"	"Q3U7R1"	"Q3U7R1 [335-345]"	"Q3U7R1 1xBiotin [K339]"	"2"	"1475.79266"	"0.011"	"1.023"	"9.82041984608424E-06"	"0.916215054610739"	"37.22"	"48.00"	"140.9"	"1.7"	"157.4"	"41.05"	"27.13"	"32.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.796E-05"	"4.62"	"41.04"
"17669"	"False"	"High"	"[K].FLAAGTHLGGTNLDFQMEQYIYK.[R]"	"1xOxidation [M17]"	"0.000298957"	"0.000721313"	"1"	"1"	"8"	"P14206"	"P14206 [18-40]"	""	"0"	"2633.27045"	"159.416"	"3.224"	"0.297700169489848"	"0.906515362333117"	"89.72"	"67.72"	"1.9"	"292.8"	"5.2"	"49.81"	"67.47"	"52.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"2.716E-05"	"5.27"	"47.98"
"17690"	"False"	"High"	"[K].FIATLQYIVGR.[S]"	""	"0.00130501"	"0.000721313"	"1"	"1"	"7"	"Q9QUR6"	"Q9QUR6 [652-662]"	""	"0"	"1280.73613"	"181.131"	"4.795"	"0.38219640639727"	"0.906515362333117"	"56.07"	"60.58"	"2.0"	"287.2"	"10.8"	"43.04"	"62.98"	"41.90"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001111"	"2.41"	"52.49"
"1258"	"False"	"High"	"[K].AGDSLMVMIAMKMEHTIK.[A]"	"1xBiotin [K]; 1xOxidation [M]"	"4.86447E-06"	"0.000721313"	"1"	"1"	"32"	"Q99MR8"	"Q99MR8 [666-683]"	"Q99MR8 1xBiotin [K]"	"1"	"2248.06667"	"0.912"	"16.854"	"0.925138005747468"	"0.906515362333117"	"85.85"	"114.80"	"12.5"	"14.1"	"273.4"	"79.89"	"45.07"	"79.89"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.194E-07"	"6.32"	"66.45"
"8028"	"False"	"High"	"[R].DKTASTIQEPAR.[L]"	"1xBiotin [K2]"	"0.00101246"	"0.000721313"	"1"	"1"	"12"	"Q9Z1R4"	"Q9Z1R4 [93-104]"	"Q9Z1R4 1xBiotin [K94]"	"1"	"1542.75807"	"0.049"	"0.741"	"0.00111387603340804"	"0.906515362333117"	"52.32"	"27.26"	"163.7"	"8.4"	"127.8"	"20.72"	"43.45"	"16.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.721E-05"	"3.46"	"31.99"
"22008"	"False"	"High"	"[K].GMTLVTPLQLLLFASK.[K]"	"1xOxidation [M2]"	"2.02137E-05"	"0.000721313"	"1"	"3"	"6"	"O70133"	"O70133 [1060-1075]"	""	"0"	"1748.00266"	"7.795"	"0.999"	"0.982626859977453"	""	"173.66"	"67.86"	"34.1"	"227.7"	"38.3"	"48.54"	"153.96"	"47.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001059"	"2.043E-06"	"4.12"	"67.94"
"18102"	"False"	"High"	"[K].FIYVAIAQFIETTKK.[K]"	""	"0.000518754"	"0.000721313"	"1"	"3"	"1"	"P29351"	"P29351 [507-521]"	""	"1"	"1771.99928"	"56.840"	"1.826"	"0.925138005747468"	"0.950055801575781"	"46.75"	"69.71"	"6.2"	"285.0"	"8.9"	"26.62"	"77.31"	"53.27"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0001059"	"4.607E-05"	"2.67"	"59.80"
"7982"	"False"	"High"	"[K].DKNFQWANTGAAVFGTQTTSK.[G]"	"1xBiotin [K2]"	"1.83068E-05"	"0.000721313"	"1"	"1"	"13"	"Q9ERU9"	"Q9ERU9 [2701-2721]"	"Q9ERU9 1xBiotin [K2702]"	"1"	"2498.17688"	"0.155"	"0.747"	"0.177146025245716"	"0.906515362333117"	"38.89"	"82.39"	"151.7"	"24.4"	"123.9"	"33.66"	"23.71"	"75.13"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.858E-06"	"5.14"	"54.01"
"1259"	"False"	"High"	"[K].AGDSLMVMIAMKMEHTIK.[A]"	"1xBiotin [K]; 2xOxidation [M8; M]"	"0.000168068"	"0.000721313"	"1"	"1"	"16"	"Q99MR8"	"Q99MR8 [666-683]"	"Q99MR8 1xBiotin [K]"	"1"	"2264.06158"	"0.449"	"12.869"	"0.925138005747468"	"0.906515362333117"	"79.04"	"88.38"	"23.0"	"10.2"	"266.8"	"79.32"	"53.13"	"67.99"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.558E-05"	"4.43"	"60.80"
"15606"	"False"	"High"	"[K].ERVPATKTVHLQSR.[A]"	"1xBiotin [K7]"	"0.00015411"	"0.000721313"	"1"	"2"	"7"	"Q9CQ56"	"Q9CQ56 [112-125]"	"Q9CQ56 1xBiotin [K118]"	"2"	"1847.99086"	"0.080"	"0.785"	"0.00407620638413316"	"0.906515362333117"	"64.56"	"40.41"	"158.7"	"13.2"	"128.2"	"34.21"	"48.37"	"19.80"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.437E-05"	"3.38"	"31.29"
"16450"	"False"	"High"	"[K].EVGIHLNYKEDSCVR.[L]"	"1xBiotin [K9]; 1xCarbamidomethyl [C13]"	"0.000251364"	"0.000721313"	"1"	"2"	"11"	"Q64735-1"	"Q64735-1 [443-457]"	"Q64735-1 1xBiotin [K451]"	"1"	"2044.95791"	"0.059"	"1.026"	"0.00256038425937695"	"0.906515362333117"	"54.92"	"39.23"	"138.7"	"7.5"	"153.9"	"23.24"	"49.59"	"21.79"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.301E-05"	"3.74"	"42.08"
"2429"	"False"	"High"	"[K].AIMTYVSSFYHAFSGAQK.[A]"	"1xOxidation [M3]"	"0.000186727"	"0.000721313"	"1"	"2"	"8"	"P57780"	"P57780 [257-274]"	""	"0"	"2023.95822"	"55.688"	"1.973"	"0.925138005747468"	"0.937945192250145"	"141.57"	"45.43"	"4.8"	"285.8"	"9.4"	"41.89"	"108.56"	"23.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.727E-05"	"4.10"	"52.79"
"2411"	"False"	"High"	"[R].ALMLQGVDLLADAVAVTMGPK.[G]"	"2xOxidation [M3; M18]"	"0.000409985"	"0.000721313"	"1"	"1"	"12"	"P63038-1"	"P63038-1 [38-58]"	""	"0"	"2145.12939"	"192.326"	"4.591"	"0.334285145275372"	"0.906515362333117"	"85.17"	"59.48"	"1.4"	"292.0"	"6.6"	"34.02"	"67.31"	"46.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"3.679E-05"	"4.30"	"64.14"
"2410"	"False"	"High"	"[R].ALMLQGVDLLADAVAVTMGPK.[G]"	"1xOxidation [M]"	"3.82539E-05"	"0.000721313"	"1"	"1"	"10"	"P63038-1"	"P63038-1 [38-58]"	""	"0"	"2129.13447"	"27.766"	"4.242"	"0.925138005747468"	"0.906515362333117"	"142.14"	"71.46"	"10.4"	"255.4"	"34.2"	"48.83"	"103.51"	"47.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.775E-06"	"5.97"	"67.11"
"3413"	"False"	"High"	"[K].AQLAAITLIIGTFER.[M]"	""	"0.00190368"	"0.000721313"	"1"	"1"	"2"	"Q9EQH3"	"Q9EQH3 [623-637]"	""	"0"	"1616.93702"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"0.0001592"	"3.59"	""
"19257"	"False"	"High"	"[R].GADKSSSFLYLQVK.[G]"	"1xBiotin [K4]"	"0.000521976"	"0.000721313"	"1"	"1"	"12"	"Q9Z2G9-1"	"Q9Z2G9-1 [134-147]"	"Q9Z2G9-1 1xBiotin [K137]"	"1"	"1768.89383"	"0.231"	"0.550"	"0.925138005747468"	"0.906515362333117"	"71.67"	"80.61"	"183.3"	"36.0"	"80.7"	"42.45"	"47.55"	"63.40"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.643E-05"	"3.35"	"51.32"
"5772"	"False"	"High"	"[R].CPEALFQPSFLGMESCGIHETTFNSIMK.[C]"	"2xCarbamidomethyl [C1; C16]"	"0.00167166"	"0.000721313"	"1"	"2"	"2"	"P60710"	"P60710 [257-284]"	""	"0"	"3231.46177"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001059"	"0.0001408"	"3.76"	""
"18031"	"False"	"High"	"[R].FLSQPFQVAEVFTGHMGK.[L]"	""	"0.000212661"	"0.000721313"	"1"	"1"	"9"	"P56480"	"P56480 [463-480]"	""	"0"	"2023.01059"	"88.598"	"28.085"	"0.490302156448734"	"0.201619692847109"	"89.28"	"101.63"	"2.6"	"223.1"	"74.2"	"39.75"	"71.97"	"115.04"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"1.956E-05"	"4.61"	"58.05"
"17935"	"False"	"High"	"[R].FLPELHKTGTFK.[F]"	"1xBiotin [K]"	"0.000790356"	"0.000721313"	"1"	"1"	"7"	"Q91VE0"	"Q91VE0 [584-595]"	"Q91VE0 1xBiotin [K]"	"1"	"1643.86141"	"0.129"	"0.769"	"0.279574256951947"	"0.906515362333117"	"51.96"	"50.66"	"165.4"	"23.4"	"111.2"	"38.19"	"30.23"	"31.86"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"6.882E-05"	"3.16"	"45.16"
"19346"	"False"	"High"	"[K].GAGTNGLPTKGPTEVSDK.[K]"	"1xBiotin [K10]"	"0.00011099"	"0.000721313"	"1"	"1"	"28"	"Q91WE4"	"Q91WE4 [52-69]"	"Q91WE4 1xBiotin [K61]"	"1"	"1954.95387"	"0.022"	"0.988"	"3.61097378948738E-05"	"0.914437694911087"	"57.93"	"62.52"	"153.4"	"3.0"	"143.6"	"65.58"	"46.82"	"27.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.048E-05"	"4.18"	"36.82"
"2409"	"False"	"High"	"[R].ALMLQGVDLLADAVAVTMGPK.[G]"	""	"6.87254E-07"	"0.000721313"	"1"	"1"	"9"	"P63038-1"	"P63038-1 [38-58]"	""	"0"	"2113.13956"	"0.676"	"1.023"	""	"0.906515362333117"	"29.80"	"82.17"	"108.2"	"69.7"	"122.1"	"26.51"	"24.60"	"100.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.932E-08"	"6.66"	"68.36"
"40"	"False"	"High"	"[R].AAALVLQTIWGYK.[E]"	""	"0.000395031"	"0.000721313"	"1"	"3"	"10"	"P30999-1"	"P30999-1 [821-833]"	""	"0"	"1433.81511"	"74.378"	"1.155"	"0.796214623268785"	"0.906515362333117"	"51.13"	"52.94"	"3.2"	"293.1"	"3.6"	"38.22"	"35.33"	"107.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.552E-05"	"3.57"	"57.99"
"17960"	"False"	"High"	"[R].FIPSQHYVYMFLVK.[W]"	"1xOxidation [M10]"	"0.00218135"	"0.000721313"	"1"	"1"	"7"	"Q09014"	"Q09014 [18-31]"	""	"0"	"1787.91893"	"183.584"	"2.713"	"0.240909553008262"	"0.906777072223237"	"68.16"	"51.91"	"1.6"	"293.8"	"4.6"	"40.04"	"63.89"	"31.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"0.0001801"	"2.71"	"50.79"
"5413"	"False"	"High"	"[K].CKELFSSHQWVSEETCGDEDSLAR.[E]"	"1xBiotin [K2]; 2xCarbamidomethyl [C1; C16]"	"6.21651E-08"	"0.000721313"	"1"	"1"	"26"	"P35821"	"P35821 [324-347]"	"P35821 1xBiotin [K325]"	"1"	"3096.31320"	"0.022"	"1.440"	"3.61097378948738E-05"	"0.971511797192901"	"64.63"	"35.45"	"125.6"	"2.8"	"171.6"	"24.27"	"55.46"	"40.42"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.894E-09"	"6.32"	"48.58"
"22563"	"False"	"High"	"[K].GQLLIFGATNWDLIGR.[K]"	""	"8.04317E-05"	"0.000721313"	"1"	"1"	"5"	"Q8BK67"	"Q8BK67 [102-117]"	""	"0"	"1773.96463"	"40.833"	"1.876"	"0.925138005747468"	"0.954461348772941"	"62.97"	"79.18"	"9.2"	"278.3"	"12.5"	"37.20"	"52.44"	"63.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"7.708E-06"	"3.74"	"63.23"
"22575"	"False"	"High"	"[K].GQLTEASSATSKAYCVYR.[R]"	"1xBiotin [K12]; 1xCarbamidomethyl [C15]"	"0.000506063"	"0.000721313"	"1"	"3"	"3"	"Q9Z329-1"	"Q9Z329-1 [1865-1882]"	"Q9Z329-1 1xBiotin [K1876]"	"1"	"2218.02671"	"0.796"	"1.948"	"0.982626859977453"	"0.956203576360793"	"92.66"	"93.27"	"79.7"	"89.7"	"130.5"	"116.79"	"44.78"	"40.10"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"4.488E-05"	"3.15"	"42.66"
"22614"	"False"	"High"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]"	"2.01888E-06"	"0.000721313"	"1"	"1"	"34"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"1"	"2961.43747"	"0.087"	"7.333"	"0.000823347120420258"	"0.906515362333117"	"64.92"	"62.48"	"42.3"	"3.3"	"254.4"	"36.93"	"209.67"	"50.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.231E-07"	"6.10"	"64.85"
"4739"	"False"	"High"	"[R].CAASGSSSSGSAAAALDADCSLKQNLR.[L]"	"1xBiotin [K23]; 2xCarbamidomethyl [C1; C20]"	"3.61355E-06"	"0.000721313"	"1"	"1"	"5"	"Q99LR1"	"Q99LR1 [15-41]"	"Q99LR1 1xBiotin [K37]"	"1"	"2881.28731"	"0.144"	"0.993"	"0.925138005747468"	"0.916215054610739"	"61.34"	"67.30"	"146.4"	"18.4"	"135.2"	"39.87"	"53.51"	"53.33"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"3.903E-07"	"5.92"	"48.48"
"22615"	"False"	"High"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 1xOxidation [M]"	"2.38633E-06"	"0.000721313"	"1"	"1"	"101"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"1"	"2977.43239"	"0.031"	"3.233"	"6.49983793219649E-05"	"0.906515362333117"	"65.14"	"39.87"	"67.8"	"2.1"	"230.1"	"36.65"	"224.19"	"21.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.628E-07"	"5.69"	"62.08"
"4734"	"False"	"High"	"[K].AYVVLGQFLVLK.[K]"	""	"0.000148489"	"0.000721313"	"1"	"1"	"10"	"O54962"	"O54962 [42-53]"	""	"0"	"1349.81913"	"86.455"	"1.913"	"0.925138005747468"	"0.963994276545741"	"76.79"	"80.30"	"3.0"	"290.6"	"6.3"	"89.44"	"45.78"	"45.85"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"1.388E-05"	"3.38"	"60.33"
"37"	"False"	"High"	"[K].AAALLTKQAGTEVKR.[E]"	"1xBiotin [K7]"	"0.000640316"	"0.000721313"	"1"	"1"	"12"	"Q8VCH8"	"Q8VCH8 [293-307]"	"Q8VCH8 1xBiotin [K299]"	"2"	"1782.98946"	"0.039"	"0.950"	"0.0020049733692574"	"0.906515362333117"	"39.63"	"27.81"	"151.8"	"5.7"	"142.5"	"27.28"	"41.41"	"19.39"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.647E-05"	"2.99"	"36.55"
"22387"	"False"	"High"	"[K].GPQKVVAESLATHSGR.[L]"	"1xBiotin [K4]"	"0.000105626"	"0.000721313"	"1"	"1"	"4"	"Q8CJF7"	"Q8CJF7 [1292-1307]"	"Q8CJF7 1xBiotin [K1295]"	"1"	"1862.95414"	"0.231"	"0.966"	"0.925138005747468"	"0.906515362333117"	"67.13"	"66.47"	"136.4"	"35.6"	"128.0"	"50.12"	"34.54"	"54.63"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"1.001E-05"	"4.04"	"38.55"
"7312"	"False"	"High"	"[R].DETGACGKTDAIFR.[A]"	"1xBiotin [K8]; 1xCarbamidomethyl [C6]"	"0.000366741"	"0.000721313"	"1"	"3"	"12"	"A2AJ88"	"A2AJ88 [462-475]"	"A2AJ88 1xBiotin [K469]"	"1"	"1766.78363"	"0.269"	"0.938"	"0.925138005747468"	"0.906515362333117"	"47.96"	"47.31"	"135.2"	"35.7"	"129.1"	"35.86"	"41.54"	"36.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.306E-05"	"3.60"	"45.05"
"16330"	"False"	"High"	"[R].EVAAFAQFGSDLDAATQQLLSR.[G]"	""	"6.11718E-06"	"0.000721313"	"1"	"1"	"4"	"Q03265"	"Q03265 [442-463]"	""	"0"	"2338.16736"	"1.097"	"1.474"	""	"0.906777072223237"	"28.31"	"81.87"	"83.0"	"89.1"	"127.9"	"22.97"	"18.58"	"56.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"6.492E-07"	"5.35"	"66.58"
"17911"	"False"	"High"	"[R].FLNKSSEDDGASER.[L]"	"1xBiotin [K4]"	"3.61801E-05"	"0.000721313"	"1"	"2"	"7"	"Q9R049"	"Q9R049 [597-610]"	"Q9R049 1xBiotin [K600]"	"1"	"1780.78065"	"0.239"	"1.023"	"0.925138005747468"	"0.906515362333117"	"48.76"	"85.41"	"129.2"	"27.8"	"143.0"	"43.24"	"25.39"	"64.96"	""	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"3.572E-06"	"3.68"	"36.19"
"103"	"False"	"High"	"[R].AAETQQLKDHSR.[G]"	"1xBiotin [K8]"	"0.0019274"	"0.000721313"	"1"	"2"	"8"	"Q8K078"	"Q8K078 [348-359]"	"Q8K078 1xBiotin [K355]"	"1"	"1609.77511"	"0.081"	"0.771"	"0.000741594146050916"	"0.906515362333117"	"142.78"	"67.19"	"161.7"	"13.0"	"125.2"	"34.06"	"148.43"	"79.52"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001609"	"3.14"	"27.30"
"2428"	"False"	"High"	"[K].AIMTYVSSFYHAFSGAQK.[A]"	""	"0.000149412"	"0.000721313"	"1"	"2"	"8"	"P57780"	"P57780 [257-274]"	""	"0"	"2007.96331"	"39.828"	"3.866"	"0.925138005747468"	"0.906515362333117"	"139.24"	"58.63"	"8.0"	"263.4"	"28.6"	"45.48"	"89.94"	"32.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.397E-05"	"4.00"	"59.02"
"22164"	"False"	"High"	"[R].GNTAAYLLYAFTR.[I]"	""	"0.00109055"	"0.000721313"	"1"	"1"	"18"	"Q9D0I9"	"Q9D0I9 [528-540]"	""	"0"	"1460.75324"	"189.889"	"1.596"	"0.925138005747468"	"0.950055801575781"	"84.39"	"104.61"	"1.7"	"293.9"	"4.4"	"77.22"	"42.79"	"54.16"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.365E-05"	"3.72"	"60.17"
"7278"	"False"	"High"	"[R].DEQGACAVLAVHLNTLLGERPVQHR.[E]"	"1xCarbamidomethyl [C6]"	"8.14341E-05"	"0.000721313"	"1"	"1"	"16"	"P24452"	"P24452 [72-96]"	""	"0"	"2783.43695"	"300.587"	"13.535"	"0.925138005747468"	"0.906515362333117"	"51.92"	"68.43"	"0.8"	"287.5"	"11.7"	"33.08"	"33.62"	"53.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.783E-06"	"3.96"	"51.09"
"19360"	"False"	"High"	"[K].GAHSVGLMWWMLAR.[E]"	""	"0.000158957"	"0.000721313"	"1"	"1"	"13"	"P14206"	"P14206 [167-180]"	""	"0"	"1614.80318"	"56.820"	"4.396"	"0.944967096116098"	"0.906515362333117"	"97.23"	"94.94"	"5.2"	"268.8"	"26.0"	"82.36"	"76.04"	"67.80"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.479E-05"	"3.50"	"59.16"
"7058"	"False"	"High"	"[K].DEAHVSDEFSKSR.[S]"	"1xBiotin [K11]"	"0.00196351"	"0.000721313"	"1"	"2"	"7"	"Q99P72-2"	"Q99P72-2 [900-912]"	"Q99P72-2 1xBiotin [K910]"	"1"	"1732.75952"	"0.976"	"0.809"	"0.962122454074805"	"0.906515362333117"	"137.12"	"75.63"	"126.3"	"92.2"	"81.5"	"48.66"	"144.02"	"37.06"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001635"	"3.03"	"34.95"
"7019"	"False"	"High"	"[K].DDSELDFSALCPKISLTVAAK.[E]"	"1xBiotin [K13]; 1xCarbamidomethyl [C11]"	"3.7272E-06"	"0.000721313"	"1"	"4"	"10"	"Q8VE91-1"	"Q8VE91-1 [146-166]"	"Q8VE91-1 1xBiotin [K158]"	"1"	"2506.22039"	"0.373"	"3.516"	"0.925138005747468"	"0.906515362333117"	"54.39"	"48.15"	"62.0"	"22.6"	"215.4"	"61.72"	"21.88"	"19.47"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.028E-07"	"4.50"	"62.23"
"19202"	"False"	"High"	"[R].FYYSSGSSSPTHAKSAHV.[-]"	"1xBiotin [K14]"	"6.20104E-05"	"0.000721313"	"1"	"1"	"24"	"Q60771"	"Q60771 [190-207]"	"Q60771 1xBiotin [K203]"	"1"	"2138.96001"	"0.011"	"0.867"	"9.82041984608424E-06"	"0.906515362333117"	"54.38"	"33.30"	"158.3"	"1.9"	"139.8"	"27.02"	"49.64"	"23.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.985E-06"	"3.85"	"35.65"
"22209"	"False"	"High"	"[R].GPAGSIEQGPYDKMHASK.[R]"	"1xBiotin [K]"	"3.29705E-05"	"0.000721313"	"1"	"1"	"17"	"Q99LI2"	"Q99LI2 [402-419]"	"Q99LI2 1xBiotin [K]"	"1"	"2098.96847"	"0.058"	"0.835"	"0.00172596557076225"	"0.906515362333117"	"76.76"	"65.05"	"166.5"	"8.0"	"125.5"	"64.03"	"46.61"	"22.97"	""	"High"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.275E-06"	"5.30"	"37.81"
"22210"	"False"	"High"	"[R].GPAGSIEQGPYDKMHASK.[R]"	"1xBiotin [K]; 1xOxidation [M14]"	"0.00113182"	"0.000721313"	"1"	"1"	"13"	"Q99LI2"	"Q99LI2 [402-419]"	"Q99LI2 1xBiotin [K]"	"1"	"2114.96339"	"0.163"	"0.772"	"0.925138005747468"	"0.906515362333117"	"51.19"	"70.36"	"144.5"	"27.6"	"127.9"	"39.01"	"40.93"	"61.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.677E-05"	"3.63"	"32.78"
"17865"	"False"	"High"	"[R].FILNLPTFSVR.[V]"	""	"0.000916976"	"0.000721313"	"1"	"1"	"21"	"Q9R1P3"	"Q9R1P3 [171-181]"	""	"0"	"1306.75178"	"164.812"	"4.665"	"0.925138005747468"	"0.906515362333117"	"33.72"	"31.99"	"1.7"	"291.0"	"7.3"	"51.14"	"21.29"	"26.49"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"7.919E-05"	"3.13"	"59.96"
"22229"	"False"	"High"	"[K].GPAVGIDLGTTYSCVGVFQHGK.[V]"	"1xCarbamidomethyl [C14]"	"3.43888E-06"	"0.000721313"	"1"	"1"	"12"	"P63017"	"P63017 [4-25]"	""	"0"	"2263.11758"	"159.513"	"7.635"	"0.802634908923022"	"0.906515362333117"	"36.92"	"46.15"	"2.0"	"284.5"	"13.5"	"31.12"	"28.24"	"38.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.72E-07"	"5.43"	"47.92"
"16224"	"False"	"High"	"[R].ETMVSKMLDR.[L]"	"1xBiotin [K6]"	"0.00171356"	"0.000721313"	"1"	"1"	"12"	"Q9QZL0"	"Q9QZL0 [337-346]"	"Q9QZL0 1xBiotin [K342]"	"1"	"1435.67420"	"0.230"	"1.097"	"0.925138005747468"	"0.937072062058245"	"50.32"	"59.20"	"135.4"	"31.1"	"133.5"	"39.64"	"41.03"	"45.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001434"	"2.99"	"49.86"
"6490"	"False"	"High"	"[K].DAASNEIPTLTKK.[E]"	"1xBiotin [K12]"	"0.000407454"	"0.000721313"	"1"	"2"	"15"	"Q99P72-2"	"Q99P72-2 [789-801]"	"Q99P72-2 1xBiotin [K800]"	"1"	"1613.82033"	"0.122"	"0.853"	"0.193099244381187"	"0.906515362333117"	"67.41"	"42.24"	"161.8"	"18.1"	"120.1"	"27.22"	"50.15"	"34.24"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.644E-05"	"3.64"	"42.59"
"1367"	"False"	"High"	"[K].AGKGGPTPQEAIQR.[L]"	"1xBiotin [K3]"	"0.00060187"	"0.000721313"	"1"	"1"	"9"	"Q9D8B3"	"Q9D8B3 [15-28]"	"Q9D8B3 1xBiotin [K17]"	"1"	"1635.82715"	"0.412"	"0.878"	"0.928611703535518"	"0.906515362333117"	"46.45"	"76.14"	"133.3"	"55.3"	"111.4"	"53.89"	"18.28"	"78.10"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"5.301E-05"	"3.80"	"32.84"
"6485"	"False"	"High"	"[K].DAAQSKAASSLFSAK.[A]"	"1xBiotin [K6]"	"0.000102405"	"0.000721313"	"1"	"1"	"12"	"Q9JIH2"	"Q9JIH2 [304-318]"	"Q9JIH2 1xBiotin [K309]"	"1"	"1707.83705"	"0.202"	"0.569"	"0.925138005747468"	"0.906515362333117"	"83.53"	"85.38"	"174.3"	"40.7"	"85.0"	"64.79"	"30.90"	"68.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.721E-06"	"4.10"	"44.42"
"22273"	"False"	"High"	"[K].GPGCGFWAAGWR.[V]"	"1xCarbamidomethyl [C4]"	"0.00027927"	"0.000721313"	"1"	"1"	"13"	"Q99PV0"	"Q99PV0 [624-635]"	""	"0"	"1321.58949"	"90.779"	"3.549"	"0.822737660380108"	"0.906515362333117"	"78.38"	"79.72"	"3.4"	"284.7"	"11.9"	"80.81"	"31.24"	"24.77"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.547E-05"	"3.38"	"49.24"
"22290"	"False"	"High"	"[R].GPGPKGPSGTVSEAQLAR.[R]"	"1xBiotin [K5]"	"4.74545E-06"	"0.000721313"	"1"	"4"	"28"	"Q69ZN7-1"	"Q69ZN7-1 [163-180]"	"Q69ZN7-1 1xBiotin [K167]"	"1"	"1934.97527"	"0.022"	"0.792"	"3.61097378948738E-05"	"0.906515362333117"	"36.16"	"34.52"	"165.4"	"3.8"	"130.7"	"25.89"	"28.85"	"17.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.066E-07"	"4.20"	"36.97"
"18032"	"False"	"High"	"[R].FLSQPFQVAEVFTGHMGK.[L]"	"1xOxidation [M16]"	"9.21718E-05"	"0.000721313"	"1"	"1"	"16"	"P56480"	"P56480 [463-480]"	""	"0"	"2039.00551"	"284.314"	"14.200"	"0.925138005747468"	"0.906515362333117"	"51.88"	"46.22"	"1.0"	"282.9"	"16.1"	"32.07"	"45.52"	"30.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.768E-06"	"3.83"	"54.01"
"5800"	"False"	"High"	"[K].CPFYAAQPDKGTLGGSNCPFQTTVAVLR.[K]"	"1xBiotin [K10]; 2xCarbamidomethyl [C1; C18]"	"1.07475E-05"	"0.000721313"	"1"	"1"	"12"	"O70252"	"O70252 [264-291]"	"O70252 1xBiotin [K273]"	"1"	"3281.55403"	"0.229"	"1.539"	"0.925138005747468"	"0.978994246450461"	"79.50"	"64.67"	"107.8"	"27.5"	"164.7"	"59.65"	"41.05"	"11.68"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.11E-06"	"5.57"	"56.89"
"17657"	"False"	"High"	"[R].FKVPQQILQGLVDVR.[I]"	"1xBiotin [K2]"	"2.73803E-05"	"0.000721313"	"1"	"2"	"15"	"Q8R2Y0-1"	"Q8R2Y0-1 [222-236]"	"Q8R2Y0-1 1xBiotin [K223]"	"1"	"1966.09426"	"0.889"	"5.987"	"0.975052343286225"	"0.906515362333117"	"68.59"	"63.86"	"37.0"	"41.0"	"221.9"	"53.63"	"42.85"	"25.73"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.736E-06"	"3.38"	"63.56"
"18127"	"False"	"High"	"[K].FMDQHPEMDFSKAK.[F]"	"1xBiotin [K]; 1xOxidation [M2]"	"0.00189194"	"0.000721313"	"1"	"1"	"12"	"O35685"	"O35685 [317-330]"	"O35685 1xBiotin [K]"	"1"	"1952.83395"	"0.181"	"0.778"	"0.925138005747468"	"0.906515362333117"	"64.47"	"47.20"	"149.8"	"33.3"	"116.9"	"46.60"	"41.72"	"28.20"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001579"	"3.51"	"39.34"
"15273"	"False"	"High"	"[K].EQIKWSLLR.[-]"	"1xBiotin [K4]"	"0.000775811"	"0.000721313"	"1"	"1"	"20"	"P61924"	"P61924 [169-177]"	"P61924 1xBiotin [K172]"	"1"	"1398.75622"	"0.011"	"1.003"	"9.24583087648604E-06"	"0.916215054610739"	"46.40"	"29.43"	"147.8"	"1.3"	"150.9"	"22.40"	"39.09"	"22.95"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.771E-05"	"2.80"	"53.93"
"338"	"False"	"High"	"[R].AASIFGGAKPVDTAAR.[E]"	"1xBiotin [K9]"	"0.000259269"	"0.000721313"	"1"	"1"	"13"	"Q8BGD9"	"Q8BGD9 [357-372]"	"Q8BGD9 1xBiotin [K365]"	"0"	"1757.90031"	"0.134"	"0.887"	"0.00886273457831643"	"0.906515362333117"	"56.75"	"39.21"	"145.2"	"20.6"	"134.2"	"33.53"	"43.95"	"25.49"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.362E-05"	"3.27"	"45.16"
"8815"	"False"	"High"	"[K].DNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K10]"	"0.000108947"	"0.000721313"	"1"	"2"	"11"	"Q9CQ56"	"Q9CQ56 [208-225]"	"Q9CQ56 1xBiotin [K217]"	"1"	"2298.08529"	"0.060"	"1.037"	"0.000924578640919382"	"0.918615707119367"	"103.50"	"31.18"	"140.4"	"8.7"	"150.9"	"31.26"	"219.63"	"13.31"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.029E-05"	"4.13"	"44.53"
"21591"	"False"	"High"	"[R].GINPADKPAWAR.[E]"	"1xBiotin [K7]"	"0.000583522"	"0.000721313"	"1"	"3"	"11"	"Q9JM52"	"Q9JM52 [512-523]"	"Q9JM52 1xBiotin [K518]"	"0"	"1521.76309"	"0.148"	"0.907"	"0.925138005747468"	"0.906515362333117"	"77.12"	"40.74"	"137.9"	"20.1"	"142.0"	"39.29"	"51.36"	"26.15"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.151E-05"	"3.50"	"44.64"
"18193"	"False"	"High"	"[K].FMNPFNLPNLYQK.[L]"	"1xOxidation [M2]"	"0.00226386"	"0.000721313"	"1"	"1"	"13"	"Q60864"	"Q60864 [124-136]"	""	"0"	"1641.80938"	"103.345"	"2.527"	"0.84374304274944"	"0.937500052802293"	"63.01"	"60.39"	"2.2"	"291.7"	"6.1"	"51.85"	"49.27"	"49.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001864"	"2.36"	"55.01"
"16859"	"False"	"High"	"[K].FAEEQLLKHGWTQGK.[G]"	"1xBiotin [K8]"	"0.000286274"	"0.000721313"	"1"	"2"	"18"	"Q3TFK5"	"Q3TFK5 [14-28]"	"Q3TFK5 1xBiotin [K21]"	"1"	"1997.99019"	"0.038"	"1.328"	"6.32521385637084E-05"	"0.998316466510713"	"73.39"	"68.77"	"119.6"	"5.4"	"175.1"	"37.64"	"51.32"	"58.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.607E-05"	"3.89"	"46.85"
"15229"	"False"	"High"	"[K].EQGVLSFWR.[G]"	""	"0.00201273"	"0.000721313"	"1"	"1"	"22"	"P51881"	"P51881 [64-72]"	""	"0"	"1121.57382"	"187.956"	"4.647"	"0.925138005747468"	"0.906515362333117"	"49.56"	"58.82"	"1.6"	"291.5"	"6.9"	"71.39"	"15.55"	"27.41"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001675"	"2.85"	"50.98"
"18192"	"False"	"High"	"[K].FMNPFNLPNLYQK.[L]"	""	"0.000957591"	"0.000721313"	"1"	"1"	"8"	"Q60864"	"Q60864 [124-136]"	""	"0"	"1625.81446"	"32.426"	"3.166"	"0.731380567752682"	"0.906515362333117"	"143.06"	"80.20"	"10.8"	"259.0"	"30.3"	"47.85"	"98.00"	"61.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.274E-05"	"3.40"	"58.71"
"17592"	"False"	"High"	"[R].FKEALGGPAWDYR.[N]"	"1xBiotin [K2]"	"3.19652E-05"	"0.000721313"	"1"	"3"	"10"	"Q9Z329-1"	"Q9Z329-1 [1588-1600]"	"Q9Z329-1 1xBiotin [K1589]"	"1"	"1735.82609"	"0.419"	"1.156"	"0.925138005747468"	"0.952991370623084"	"95.42"	"75.00"	"108.8"	"49.3"	"141.9"	"73.06"	"38.08"	"45.61"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.174E-06"	"3.69"	"49.97"
"8689"	"False"	"High"	"[K].DMVAEIEWFGAKGIDKEEER.[M]"	"1xBiotin [K12]; 1xOxidation [M2]"	"9.55441E-06"	"0.000721313"	"1"	"1"	"23"	"Q8VBT6"	"Q8VBT6 [222-241]"	"Q8VBT6 1xBiotin [K233]"	"2"	"2594.19015"	"14.716"	"1.963"	"0.925138005747468"	"0.906515362333117"	"46.59"	"35.87"	"16.8"	"251.1"	"32.1"	"30.73"	"41.78"	"32.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.918E-07"	"4.78"	"54.85"
"18168"	"False"	"High"	"[K].FMKSQGLSQLYHNQSQGLLSQLQGQSK.[D]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.00106387"	"0.000721313"	"1"	"1"	"5"	"Q62448"	"Q62448 [428-454]"	"Q62448 1xBiotin [K430]"	"1"	"3277.60924"	"1.040"	"5.410"	""	"0.906515362333117"	"38.23"	"75.97"	"40.3"	"38.9"	"220.8"	"23.32"	"32.91"	"65.46"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"9.136E-05"	"4.77"	"53.10"
"3446"	"False"	"High"	"[R].AQLSSVSSKAAGVR.[G]"	"1xBiotin [K9]"	"0.000390169"	"0.000721313"	"1"	"2"	"19"	"Q3UPF5-1"	"Q3UPF5-1 [303-316]"	"Q3UPF5-1 1xBiotin [K311]"	"1"	"1586.83190"	"0.123"	"0.917"	"0.893812309331072"	"0.906515362333117"	"87.16"	"31.49"	"151.2"	"15.0"	"133.9"	"50.72"	"47.73"	"17.33"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.506E-05"	"3.33"	"37.86"
"21669"	"False"	"High"	"[K].GLQKTDLYHLQK.[S]"	"1xBiotin [K4]"	"0.000521976"	"0.000721313"	"1"	"2"	"6"	"Q9JK30-1"	"Q9JK30-1 [527-538]"	"Q9JK30-1 1xBiotin [K530]"	"1"	"1669.87304"	"0.202"	"1.193"	"0.925138005747468"	"0.916215054610739"	"39.75"	"56.95"	"122.9"	"25.0"	"152.2"	"29.15"	"35.35"	"76.54"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001059"	"4.631E-05"	"3.91"	"42.20"
"18167"	"False"	"High"	"[K].FMKSQGLSQLYHNQSQGLLSQLQGQSK.[D]"	"1xBiotin [K3]"	"2.51063E-05"	"0.000721313"	"1"	"1"	"6"	"Q62448"	"Q62448 [428-454]"	"Q62448 1xBiotin [K430]"	"1"	"3261.61433"	"0.960"	"1.112"	""	"0.906515362333117"	"55.21"	"70.06"	"105.2"	"93.0"	"101.8"	"42.06"	"31.05"	"85.26"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.517E-06"	"4.57"	"54.42"
"8688"	"False"	"High"	"[K].DMVAEIEWFGAKGIDKEEER.[M]"	"1xBiotin [K12]"	"3.68132E-06"	"0.000721313"	"1"	"1"	"19"	"Q8VBT6"	"Q8VBT6 [222-241]"	"Q8VBT6 1xBiotin [K233]"	"2"	"2578.19524"	"0.723"	"15.930"	"0.102266375989194"	"0.69921766089904"	"144.81"	"66.07"	"17.0"	"10.0"	"273.0"	"65.31"	"154.40"	"32.07"	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.987E-07"	"5.49"	"62.09"
"21698"	"False"	"High"	"[K].GIRPAINVGLSVSR.[V]"	""	"0.00109732"	"0.000721313"	"1"	"1"	"21"	"Q03265"	"Q03265 [403-416]"	""	"0"	"1438.84887"	"317.068"	"9.048"	"0.925138005747468"	"0.906515362333117"	"55.08"	"54.24"	"0.8"	"290.6"	"8.6"	"59.49"	"42.79"	"25.06"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"9.414E-05"	"3.43"	"37.90"
"17606"	"False"	"High"	"[K].FKGPFTDVVTTNLK.[L]"	"1xBiotin [K2]"	"2.78937E-05"	"0.000721313"	"1"	"1"	"15"	"Q9WV55"	"Q9WV55 [25-38]"	"Q9WV55 1xBiotin [K26]"	"1"	"1792.93022"	"0.101"	"0.711"	"0.00671530157851783"	"0.906515362333117"	"56.60"	"39.89"	"164.8"	"17.7"	"117.5"	"19.40"	"49.53"	"39.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.786E-06"	"3.15"	"53.13"
"15395"	"False"	"High"	"[R].EQTKVDHFWGLDDDGDLK.[G]"	"1xBiotin [K4]"	"0.000148489"	"0.000721313"	"1"	"5"	"26"	"Q9D666-1"	"Q9D666-1 [143-160]"	"Q9D666-1 1xBiotin [K146]"	"1"	"2344.05504"	"0.933"	"1.037"	"0.0510611910206471"	"0.918615707119367"	"122.91"	"36.71"	"106.2"	"92.7"	"101.2"	"24.46"	"126.75"	"26.61"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.389E-05"	"4.01"	"51.42"
"21763"	"False"	"High"	"[K].GISTDKPSENPASFGESGDKYSAFR.[E]"	"1xBiotin [K20]"	"2.22642E-07"	"0.000721313"	"1"	"2"	"11"	"Q5SV85"	"Q5SV85 [515-539]"	"Q5SV85 1xBiotin [K534]"	"1"	"2873.30466"	"11.600"	"0.854"	"0.925138005747468"	"0.906515362333117"	"43.68"	"37.04"	"23.3"	"257.8"	"18.9"	"36.24"	"35.63"	"24.96"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"2.686E-08"	"6.25"	"44.70"
"21769"	"False"	"High"	"[K].GLSVLLSHAKAPFFR.[G]"	"1xBiotin [K10]"	"7.49501E-07"	"0.000721313"	"1"	"1"	"34"	"Q99P91"	"Q99P91 [544-558]"	"Q99P91 1xBiotin [K553]"	"1"	"1869.02037"	"0.033"	"3.861"	"0.000148860107973015"	"0.906515362333117"	"57.94"	"48.40"	"63.6"	"2.3"	"234.1"	"39.83"	"38.40"	"16.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.613E-08"	"5.01"	"58.76"
"8816"	"False"	"High"	"[K].DNQTLSHSLKMADQNLEK.[L]"	"1xBiotin [K10]; 1xOxidation [M11]"	"0.00018329"	"0.000721313"	"1"	"2"	"11"	"Q9CQ56"	"Q9CQ56 [208-225]"	"Q9CQ56 1xBiotin [K217]"	"1"	"2314.08021"	"0.717"	"0.541"	"0.0990400127560103"	"0.906515362333117"	"267.73"	"72.24"	"132.5"	"95.8"	"71.6"	"32.80"	"106.66"	"75.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.696E-05"	"4.17"	"41.33"
"8686"	"False"	"High"	"[K].DMVAEIEWFGAKGIDK.[E]"	"1xBiotin [K]"	"0.000545099"	"0.000721313"	"1"	"1"	"11"	"Q8VBT6"	"Q8VBT6 [222-237]"	"Q8VBT6 1xBiotin [K]"	"1"	"2034.96635"	"1.054"	"1.929"	"0.925138005747468"	"0.987614907205453"	"66.34"	"74.23"	"78.9"	"77.9"	"143.2"	"44.15"	"52.34"	"55.81"	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.839E-05"	"3.75"	"64.24"
"21563"	"False"	"High"	"[K].GILTTEKQNFLLFDMTTHPVTNTTEK.[Q]"	"1xBiotin [K7]"	"0.000835649"	"0.000721313"	"1"	"3"	"4"	"Q8R088-1"	"Q8R088-1 [171-196]"	"Q8R088-1 1xBiotin [K177]"	"1"	"3205.59080"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001059"	"7.277E-05"	"3.55"	""
"367"	"False"	"High"	"[R].AATFGLILDDVSLTHLTFGK.[E]"	""	"6.20104E-05"	"0.000721313"	"1"	"1"	"11"	"P67778"	"P67778 [158-177]"	""	"0"	"2119.14338"	"104.207"	"6.452"	"0.434853540501642"	"0.906515362333117"	"86.93"	"81.64"	"2.4"	"280.8"	"16.8"	"61.51"	"63.49"	"73.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.989E-06"	"4.66"	"63.26"
"9451"	"False"	"High"	"[K].DSKSTWVILHHK.[V]"	"1xBiotin [K3]"	"0.000126406"	"0.000721313"	"1"	"1"	"20"	"P56395"	"P56395 [22-33]"	"P56395 1xBiotin [K24]"	"1"	"1676.85772"	"0.023"	"1.064"	"3.77289611927905E-05"	"0.923750342545975"	"53.82"	"50.03"	"161.4"	"3.4"	"135.2"	"37.69"	"41.67"	"35.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.187E-05"	"3.65"	"39.88"
"9300"	"False"	"High"	"[K].DRVDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K5]; 1xOxidation [M13]"	"0.00069399"	"0.000721313"	"1"	"1"	"3"	"P49710"	"P49710 [203-223]"	"P49710 1xBiotin [K207]"	"2"	"2571.18540"	"0.617"	"0.634"	"0.925138005747468"	"0.906515362333117"	"70.93"	"91.74"	"137.6"	"90.6"	"71.8"	"58.15"	"29.70"	"62.93"	""	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"0.0001059"	"6.079E-05"	"4.93"	"40.42"
"9299"	"False"	"High"	"[K].DRVDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K5]"	"0.000286274"	"0.000721313"	"1"	"1"	"5"	"P49710"	"P49710 [203-223]"	"P49710 1xBiotin [K207]"	"2"	"2555.19048"	"0.536"	"0.387"	"0.949662611758987"	"0.906515362333117"	"76.97"	"93.13"	"118.6"	"73.7"	"107.7"	"85.89"	"41.39"	"62.72"	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.61E-05"	"4.61"	"44.87"
"18268"	"False"	"High"	"[K].FNIWGGSLSLGHPFGATGCR.[L]"	"1xCarbamidomethyl [C19]"	"3.64049E-05"	"0.000721313"	"1"	"1"	"12"	"Q99JY0"	"Q99JY0 [418-437]"	""	"0"	"2134.02870"	"191.310"	"9.846"	"0.925138005747468"	"0.906515362333117"	"67.18"	"74.12"	"1.4"	"284.0"	"14.6"	"53.14"	"35.93"	"53.78"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.594E-06"	"4.28"	"55.39"
"22616"	"False"	"High"	"[K].GQPLCVLSAMKMETVVTSPMEGTIR.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C5]; 2xOxidation [M12; M]"	"4.74545E-06"	"0.000721313"	"1"	"1"	"99"	"Q05920"	"Q05920 [1134-1158]"	"Q05920 1xBiotin [K1144]"	"1"	"2993.42730"	"0.030"	"1.916"	"6.32521385637084E-05"	"0.906515362333117"	"39.77"	"26.30"	"107.0"	"3.0"	"190.0"	"29.46"	"26.97"	"20.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.085E-07"	"5.77"	"59.35"
"19592"	"False"	"High"	"[K].GAVPYVQAFDSLLANPVAEYLK.[M]"	""	"0.00053839"	"0.000721313"	"1"	"1"	"4"	"P40124"	"P40124 [38-59]"	""	"0"	"2365.24382"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"4.775E-05"	"3.78"	""
"21428"	"False"	"High"	"[R].GLGMTLSYLFR.[E]"	""	"0.00189194"	"0.000721313"	"1"	"1"	"11"	"Q8K3J1"	"Q8K3J1 [69-79]"	""	"0"	"1257.66601"	"60.168"	"5.273"	"0.495286521064498"	"0.906515362333117"	"84.47"	"73.49"	"4.0"	"271.4"	"24.6"	"79.98"	"90.21"	"37.03"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001059"	"0.0001575"	"2.54"	"60.28"
"21429"	"False"	"High"	"[R].GLGMTLSYLFR.[E]"	"1xOxidation [M4]"	"0.00222222"	"0.000721313"	"1"	"1"	"28"	"Q8K3J1"	"Q8K3J1 [69-79]"	""	"0"	"1273.66092"	"79.509"	"1.777"	"0.994201151226993"	"0.998316466510713"	"42.03"	"38.99"	"4.0"	"289.9"	"6.1"	"28.78"	"33.09"	"24.17"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001833"	"3.19"	"57.40"
"4522"	"False"	"High"	"[K].AVQQSGDKNMSK.[V]"	"1xBiotin [K8]"	"0.000605609"	"0.000721313"	"1"	"1"	"14"	"Q91WE4"	"Q91WE4 [36-47]"	"Q91WE4 1xBiotin [K43]"	"1"	"1518.70392"	"0.038"	"0.742"	"9.52279487103043E-05"	"0.906515362333117"	"69.59"	"36.88"	"171.5"	"6.1"	"122.4"	"27.11"	"230.64"	"27.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.346E-05"	"3.81"	"24.33"
"3092"	"False"	"High"	"[K].APAQKAAGQK.[A]"	"1xBiotin [K5]"	"0.000475676"	"0.000721313"	"1"	"1"	"12"	"Q9CR57"	"Q9CR57 [180-189]"	"Q9CR57 1xBiotin [K184]"	"1"	"1195.62520"	"0.156"	"0.919"	"0.925138005747468"	"0.906515362333117"	"67.18"	"56.79"	"138.9"	"19.0"	"142.0"	"71.92"	"47.73"	"29.24"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.247E-05"	"3.55"	"20.32"
"21485"	"False"	"High"	"[K].GLIAAICAGPTALLAHEVGFGCK.[V]"	"2xCarbamidomethyl [C7; C22]"	"1.95974E-05"	"0.000721313"	"1"	"1"	"4"	"Q99LX0"	"Q99LX0 [100-122]"	""	"0"	"2326.20462"	"2.203"	"3.814"	"0.925138005747468"	"0.906515362333117"	"77.56"	"65.48"	"33.7"	"79.2"	"187.1"	"59.39"	"202.50"	"51.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"1.988E-06"	"4.76"	"60.46"
"3123"	"False"	"High"	"[K].APFAAHGYGAFLTLSILDR.[Y]"	""	"1.10855E-05"	"0.000721313"	"1"	"1"	"12"	"Q9R1P3"	"Q9R1P3 [127-145]"	""	"0"	"2020.06507"	"120.454"	"4.907"	"0.477067253044389"	"0.906515362333117"	"110.16"	"58.25"	"2.4"	"284.3"	"13.3"	"44.82"	"93.80"	"39.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.148E-06"	"3.96"	"60.07"
"18266"	"False"	"High"	"[R].FNISPDEDSSSYSSNSDFNYSYPTKQAALK.[S]"	"1xBiotin [K25]"	"0.000204904"	"0.000721313"	"1"	"1"	"11"	"Q8CFE6"	"Q8CFE6 [9-38]"	"Q8CFE6 1xBiotin [K33]"	"1"	"3588.57475"	"0.124"	"2.423"	"0.00744387776113574"	"0.906515362333117"	"80.36"	"42.05"	"84.7"	"10.1"	"205.2"	"49.66"	"206.35"	"27.37"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.889E-05"	"4.77"	"51.21"
"4523"	"False"	"High"	"[K].AVQQSGDKNMSK.[V]"	"1xBiotin [K8]; 1xOxidation [M10]"	"0.000490635"	"0.000721313"	"1"	"1"	"18"	"Q91WE4"	"Q91WE4 [36-47]"	"Q91WE4 1xBiotin [K43]"	"1"	"1534.69884"	"0.928"	"0.869"	"0.230783538922771"	"0.906515362333117"	"366.86"	"47.45"	"114.3"	"97.2"	"88.6"	"32.39"	"114.32"	"36.08"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.374E-05"	"3.21"	"19.02"
"18248"	"False"	"High"	"[K].FNFLNPNDPYHAYYR.[H]"	""	"0.000861923"	"0.000721313"	"1"	"1"	"12"	"Q8K4Z5"	"Q8K4Z5 [81-95]"	""	"0"	"1930.88711"	"108.491"	"2.448"	"0.469750721179016"	"0.936660535922236"	"66.94"	"75.02"	"2.4"	"290.8"	"6.9"	"55.52"	"31.51"	"52.35"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.477E-05"	"3.18"	"47.42"
"19575"	"False"	"High"	"[K].GAVEALAAALAHISGATSVDQR.[S]"	""	"2.96758E-05"	"0.000721313"	"1"	"1"	"9"	"Q9JIK5"	"Q9JIK5 [678-699]"	""	"0"	"2108.10946"	"39.945"	"2.773"	"0.682558235379042"	"0.913565512658592"	"134.42"	"68.15"	"6.9"	"274.3"	"18.8"	"32.90"	"82.67"	"53.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.955E-06"	"4.62"	"62.92"
"14707"	"False"	"High"	"[K].ENPKVVNEINIEDLCLTKAAYCR.[C]"	"2xBiotin [K4; K18]; 2xCarbamidomethyl [C15; C22]"	"7.10617E-05"	"0.000721313"	"1"	"1"	"4"	"Q9CQB5"	"Q9CQB5 [78-100]"	"Q9CQB5 2xBiotin [K81; K95]"	"2"	"3201.51996"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001059"	"6.818E-06"	"5.62"	""
"9220"	"False"	"High"	"[R].DRADKSAVGFDYK.[G]"	"1xBiotin [K5]"	"0.00132948"	"0.000721313"	"1"	"1"	"17"	"P49710"	"P49710 [129-141]"	"P49710 1xBiotin [K133]"	"2"	"1697.79518"	"0.054"	"0.854"	"0.0028103014004041"	"0.906515362333117"	"47.11"	"39.91"	"161.3"	"9.0"	"129.7"	"18.84"	"41.13"	"29.85"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001129"	"3.20"	"38.31"
"16871"	"False"	"High"	"[K].FAGAKAISSDMFFGR.[E]"	"1xBiotin [K5]"	"2.03142E-06"	"0.000721313"	"1"	"2"	"24"	"Q99K28"	"Q99K28 [424-438]"	"Q99K28 1xBiotin [K428]"	"1"	"1830.86657"	"0.023"	"0.815"	"3.8461976882733E-05"	"0.906515362333117"	"67.55"	"46.19"	"163.0"	"4.1"	"132.9"	"43.40"	"45.69"	"24.65"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.253E-07"	"4.63"	"56.94"
"18238"	"False"	"High"	"[K].FNDKHITTLQASFLTK.[K]"	"1xBiotin [K4]"	"1.82842E-06"	"0.000721313"	"1"	"1"	"19"	"P35282"	"P35282 [42-57]"	"P35282 1xBiotin [K45]"	"1"	"2090.07392"	"0.020"	"0.944"	"3.06818531054616E-05"	"0.906777072223237"	"62.22"	"40.44"	"156.1"	"2.7"	"141.2"	"17.81"	"54.36"	"35.21"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.032E-07"	"5.70"	"49.10"
"21835"	"False"	"High"	"[R].GLYIAKQATGGAAK.[V]"	"1xBiotin [K6]"	"1.60743E-05"	"0.000721313"	"1"	"2"	"34"	"Q8R1X6"	"Q8R1X6 [480-493]"	"Q8R1X6 1xBiotin [K485]"	"1"	"1574.83592"	"0.010"	"0.811"	"9.24583087648604E-06"	"0.906515362333117"	"57.43"	"40.94"	"164.7"	"1.8"	"133.6"	"25.95"	"49.65"	"31.63"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.642E-06"	"4.07"	"39.84"
"1737"	"False"	"High"	"[K].AKEIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"1xBiotin [K14]"	"4.68124E-07"	"0.000721313"	"1"	"1"	"73"	"Q3U9G9"	"Q3U9G9 [187-215]"	"Q3U9G9 1xBiotin [K200]"	"2"	"3394.73113"	"1.202"	"1.030"	"0.0765855153475113"	"0.916215054610739"	"56.94"	"52.19"	"91.6"	"113.5"	"94.8"	"48.51"	"35.97"	"16.78"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.477E-08"	"6.79"	"50.38"
"8508"	"False"	"High"	"[R].DLSYCLSGMYDHR.[Y]"	"1xCarbamidomethyl [C5]; 1xOxidation [M9]"	"0.0006983"	"0.000721313"	"1"	"2"	"13"	"Q9Z2X1-1"	"Q9Z2X1-1 [263-275]"	""	"0"	"1632.67810"	"140.686"	"2.566"	"0.925138005747468"	"0.906515362333117"	"66.81"	"43.26"	"2.0"	"293.1"	"5.0"	"68.27"	"58.98"	"110.34"	"MandatoryModificationMissing"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001059"	"6.104E-05"	"3.59"	"35.73"
"1453"	"False"	"High"	"[K].AGNLGGGVVTIER.[S]"	""	"0.000275832"	"0.000721313"	"1"	"1"	"5"	"P67984"	"P67984 [53-65]"	""	"0"	"1242.68008"	"172.187"	"1.046"	"0.925138005747468"	"0.906515362333117"	"43.94"	"83.52"	"2.0"	"295.9"	"2.0"	"37.39"	"53.78"	"55.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.507E-05"	"3.42"	"34.04"
"4570"	"False"	"High"	"[R].AVTLYDKPASFFK.[E]"	"1xBiotin [K7]"	"0.000123313"	"0.000721313"	"1"	"2"	"15"	"Q921Q3-1"	"Q921Q3-1 [211-223]"	"Q921Q3-1 1xBiotin [K217]"	"0"	"1712.87164"	"0.181"	"1.147"	"0.925138005747468"	"0.916215054610739"	"35.96"	"31.11"	"125.1"	"25.0"	"149.9"	"37.63"	"26.19"	"28.35"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.158E-05"	"3.57"	"55.84"
"8520"	"False"	"High"	"[K].DLTKNMGIIAER.[I]"	"1xBiotin [K4]"	"0.00019141"	"0.000721313"	"1"	"2"	"28"	"Q6P9J9"	"Q6P9J9 [886-897]"	"Q6P9J9 1xBiotin [K889]"	"1"	"1586.80291"	"0.013"	"0.575"	"1.16364095154626E-05"	"0.906515362333117"	"72.38"	"50.46"	"201.1"	"2.0"	"96.9"	"65.79"	"228.70"	"24.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.769E-05"	"4.26"	"48.20"
"8532"	"False"	"High"	"[R].DITYFIQQLLR.[ED]"	""	"0.000509206"	"0.000721313"	"1"	"3"	"10"	"Q641P0"	"Q641P0 [199-209]"	""	"0"	"1409.77873"	"1.093"	"1.240"	"0.987144754730324"	"0.936238272383155"	"84.28"	"110.69"	"92.2"	"98.0"	"109.7"	"41.53"	"149.33"	"147.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.536E-05"	"2.87"	"69.05"
"8545"	"False"	"High"	"[K].DLVKNMPFLK.[V]"	"1xBiotin [K4]"	"0.00201273"	"0.000721313"	"1"	"1"	"14"	"Q8R0X7"	"Q8R0X7 [98-107]"	"Q8R0X7 1xBiotin [K101]"	"1"	"1430.75344"	"0.046"	"1.275"	"0.00160523259630558"	"0.983025330649738"	"50.50"	"61.70"	"122.8"	"5.8"	"171.4"	"26.48"	"48.87"	"41.76"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001672"	"3.46"	"55.38"
"21895"	"False"	"High"	"[R].GMGGAFVLVLYDEIK.[K]"	"1xOxidation [M2]"	"0.00022485"	"0.000721313"	"2"	"2"	"1"	"P48962; P51881"	"P48962 [281-295]; P51881 [281-295]"	""	"0"	"1627.84001"	"47.544"	"1.749"	"0.925138005747468"	"0.969227082684272"	"142.23"	"72.46"	"6.0"	"283.5"	"10.6"	"29.15"	"111.90"	"86.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"2.063E-05"	"2.57"	"61.88"
"2619"	"False"	"High"	"[R].ALSTGEKGFGYK.[G]"	"1xBiotin [K7]"	"0.000963538"	"0.000721313"	"1"	"1"	"12"	"P17742"	"P17742 [38-49]"	"P17742 1xBiotin [K44]"	"1"	"1483.72498"	"0.137"	"0.860"	"0.925138005747468"	"0.906515362333117"	"48.51"	"47.80"	"164.9"	"20.0"	"115.1"	"28.05"	"44.15"	"42.06"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"8.347E-05"	"3.16"	"39.91"
"1257"	"False"	"High"	"[K].AGDSLMVMIAMKMEHTIK.[A]"	"1xBiotin [K12]"	"7.79793E-05"	"0.000721313"	"1"	"1"	"8"	"Q99MR8"	"Q99MR8 [666-683]"	"Q99MR8 1xBiotin [K677]"	"1"	"2232.07175"	"1.046"	"7.818"	""	"0.906515362333117"	"41.61"	"92.30"	"34.6"	"38.5"	"226.9"	"34.23"	"29.13"	"68.13"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.489E-06"	"5.65"	"67.04"
"15560"	"False"	"High"	"[K].ERPQVGGTIKQPPTNPPPRPPAEVR.[K]"	"1xBiotin [K10]"	"0.00142316"	"0.000721313"	"1"	"2"	"13"	"Q61462"	"Q61462 [140-164]"	"Q61462 1xBiotin [K149]"	"1"	"2944.55740"	"0.070"	"0.871"	"0.00691466369426171"	"0.906515362333117"	"60.29"	"58.61"	"156.8"	"11.5"	"131.7"	"44.06"	"47.36"	"31.66"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001207"	"3.51"	"35.54"
"2630"	"False"	"High"	"[K].ALTGHLEEVVLAMLK.[T]"	""	"0.000252926"	"0.000721313"	"1"	"1"	"3"	"P10107"	"P10107 [99-113]"	""	"0"	"1623.91384"	"1.141"	"2.068"	"0.925138005747468"	"0.919235111389825"	"67.95"	"59.31"	"82.0"	"83.0"	"135.0"	"33.64"	"205.48"	"42.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001059"	"2.314E-05"	"4.12"	"63.43"
"16838"	"False"	"High"	"[K].FAAKGEGQLSAAER.[A]"	"1xBiotin [K4]"	"2.92744E-06"	"0.000721313"	"1"	"1"	"35"	"P58252"	"P58252 [236-249]"	"P58252 1xBiotin [K239]"	"1"	"1660.81117"	"0.023"	"0.746"	"3.77583843240853E-05"	"0.906515362333117"	"33.48"	"17.45"	"169.6"	"4.0"	"126.5"	"11.41"	"41.21"	"24.03"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"3.198E-07"	"4.26"	"37.25"
"15396"	"False"	"High"	"[R].EQTKVDHFWGLDDDGDLKGGNK.[A]"	"1xBiotin [K4]"	"4.11544E-06"	"0.000721313"	"1"	"5"	"30"	"Q9D666-1"	"Q9D666-1 [143-164]"	"Q9D666-1 1xBiotin [K146]"	"2"	"2700.23585"	"0.038"	"0.986"	"9.91262448924383E-05"	"0.91398852688127"	"47.74"	"41.89"	"151.2"	"5.2"	"143.6"	"16.94"	"153.11"	"35.73"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"4.425E-07"	"5.74"	"46.68"
"228"	"False"	"High"	"[K].AALSGSYVNFGVFR.[L]"	""	"0.000805175"	"0.000721313"	"1"	"2"	"4"	"Q9EPK7"	"Q9EPK7 [841-854]"	""	"0"	"1487.76414"	"56.901"	"0.785"	"0.925138005747468"	""	"66.72"	"69.74"	"5.5"	"291.0"	"3.5"	"52.74"	"20.38"	"46.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001059"	"7.018E-05"	"2.59"	"52.10"
"21896"	"False"	"High"	"[R].GMGGAFVLVLYDEIKK.[Y]"	""	"0.000835649"	"0.000721313"	"2"	"2"	"6"	"P48962; P51881"	"P48962 [281-296]; P51881 [281-296]"	""	"1"	"1739.94005"	"1.298"	"5.535"	"0.955671426886959"	"0.906515362333117"	"57.19"	"54.44"	"41.0"	"51.0"	"208.0"	"34.62"	"231.15"	"48.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"7.253E-05"	"3.16"	"61.68"
"8564"	"False"	"High"	"[K].DLVSSLTSGLLTIGDR.[F]"	""	"0.00141438"	"0.000721313"	"1"	"1"	"4"	"Q91V92"	"Q91V92 [909-924]"	""	"0"	"1646.89594"	"1.917"	"1.795"	"0.925138005747468"	"0.937072062058245"	"107.68"	"54.67"	"61.0"	"116.9"	"122.1"	"48.06"	"144.58"	"28.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001199"	"3.20"	"66.86"
"8461"	"False"	"High"	"[R].DLSAAGIGLLAAATQSLSMPASLGR.[M]"	"1xOxidation [M19]"	"0.000397485"	"0.000721313"	"1"	"1"	"3"	"Q8K310"	"Q8K310 [20-44]"	""	"0"	"2387.25988"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001059"	"3.575E-05"	"5.16"	""
"17607"	"False"	"High"	"[R].FKGQILMPNIGYGSNKK.[T]"	""	"0.00200031"	"0.000721313"	"1"	"1"	"5"	"P62911"	"P62911 [49-65]"	""	"2"	"1895.02076"	"94.095"	"11.553"	"0.415144032579081"	"0.906515362333117"	"144.86"	"59.35"	"2.6"	"266.9"	"30.5"	"42.74"	"95.86"	"59.68"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001059"	"0.0001665"	"3.27"	"38.79"
"2632"	"False"	"High"	"[R].ALTKGVQAVMGYKPGHGLVTAAAASAENVPGKPWK.[K]"	"1xBiotin [K4]"	"0.000185574"	"0.000721313"	"1"	"2"	"3"	"Q3UM18"	"Q3UM18 [590-624]"	"Q3UM18 1xBiotin [K593]"	"1"	"3730.95600"	"1.118"	"2.523"	""	"0.916215054610739"	"54.11"	"84.03"	"70.3"	"78.7"	"151.0"	"44.57"	"39.63"	"70.49"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"1.717E-05"	"5.35"	"50.80"
"21897"	"False"	"High"	"[R].GMGGAFVLVLYDEIKK.[Y]"	"1xOxidation [M2]"	"6.04932E-05"	"0.000721313"	"2"	"2"	"19"	"P48962; P51881"	"P48962 [281-296]; P51881 [281-296]"	""	"1"	"1755.93497"	"339.632"	"7.106"	"0.925138005747468"	"0.906515362333117"	"69.78"	"69.61"	"0.8"	"294.3"	"4.9"	"41.27"	"77.57"	"75.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"5.871E-06"	"4.81"	"57.76"
"2559"	"False"	"High"	"[R].AIRPEKQAPAAALGQDR.[Q]"	"1xBiotin [K6]"	"1.53923E-05"	"0.000721313"	"1"	"1"	"28"	"O08579"	"O08579 [206-222]"	"O08579 1xBiotin [K211]"	"1"	"2018.06000"	"0.098"	"0.762"	"0.000885680078319812"	"0.906515362333117"	"410.74"	"33.18"	"161.3"	"15.0"	"123.7"	"19.47"	"111.51"	"64.29"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"1.577E-06"	"4.15"	"35.89"
"8521"	"False"	"High"	"[K].DLTKNMGIIAER.[I]"	"1xBiotin [K4]; 1xOxidation [M6]"	"6.47578E-05"	"0.000721313"	"1"	"2"	"21"	"Q6P9J9"	"Q6P9J9 [886-897]"	"Q6P9J9 1xBiotin [K889]"	"1"	"1602.79782"	"2.269"	"0.811"	"0.191321941208505"	"0.906515362333117"	"146.85"	"36.55"	"78.0"	"164.5"	"57.5"	"19.05"	"108.85"	"44.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"6.262E-06"	"3.96"	"41.14"
"21838"	"False"	"High"	"[K].GLYQGFNVSVQGIIIYR.[A]"	""	"2.82414E-05"	"0.000721313"	"1"	"1"	"35"	"P51881"	"P51881 [172-188]"	""	"0"	"1927.04361"	"170.547"	"4.767"	"0.925138005747468"	"0.906515362333117"	"86.48"	"85.04"	"1.9"	"291.8"	"6.4"	"63.41"	"64.34"	"57.21"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"2.811E-06"	"4.03"	"58.52"
"66325"	"False"	"High"	"[RK].TYGVSFFLVK.[E]"	""	"0.00481531"	"0.0007621"	"1"	"2"	"11"	"P26039"	"P26039 [307-316]"	""	"0"	"1160.63502"	"95.138"	"2.841"	"0.979807449139508"	"0.917284228966659"	"49.76"	"53.90"	"3.3"	"287.4"	"9.3"	"54.23"	"27.03"	"26.72"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003762"	"1.94"	"54.06"
"3053"	"False"	"High"	"[K].ANSWWLR.[H]"	""	"0.0134297"	"0.0007621"	"1"	"1"	"39"	"Q9CWJ9"	"Q9CWJ9 [462-468]"	""	"0"	"932.47371"	"147.378"	"3.563"	"0.925138005747468"	"0.906515362333117"	"47.84"	"47.37"	"2.2"	"289.2"	"8.6"	"58.60"	"39.73"	"20.64"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009539"	"2.97"	"43.67"
"47559"	"False"	"High"	"[R].MSFLFSAFK.[R]"	""	"0.0347849"	"0.0007621"	"1"	"2"	"3"	"Q8R1T1-1"	"Q8R1T1-1 [31-39]"	""	"0"	"1077.54376"	"0.904"	"1.652"	"0.931513090357645"	"0.919235111389825"	"59.12"	"77.08"	"88.2"	"76.2"	"135.6"	"22.62"	"219.82"	"62.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.000686"	"0.002323"	"2.22"	"57.50"
"45447"	"False"	"High"	"[R].MISKQFHHQLR.[V]"	"1xBiotin [K4]; 1xOxidation [M1]"	"0.0280885"	"0.0007621"	"1"	"1"	"8"	"Q8R1B4"	"Q8R1B4 [707-717]"	"Q8R1B4 1xBiotin [K710]"	"1"	"1666.83046"	"0.068"	"0.799"	"0.0039633539981223"	"0.906515362333117"	"63.34"	"36.63"	"159.7"	"10.5"	"129.8"	"30.53"	"54.32"	"19.42"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001884"	"2.70"	"30.70"
"3023"	"False"	"High"	"[K].ANNLSSLSKK.[Y]"	"1xBiotin [K9]"	"0.0026101"	"0.0007621"	"1"	"1"	"12"	"O08547"	"O08547 [170-179]"	"O08547 1xBiotin [K178]"	"1"	"1287.67255"	"0.116"	"1.145"	"0.138741892296371"	"0.916215054610739"	"49.47"	"41.83"	"133.2"	"14.3"	"152.5"	"28.10"	"45.26"	"37.68"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002134"	"3.12"	"34.78"
"47560"	"False"	"High"	"[R].MSFLFSAFK.[R]"	"1xOxidation [M1]"	"0.013936"	"0.0007621"	"1"	"2"	"3"	"Q8R1T1-1"	"Q8R1T1-1 [31-39]"	""	"0"	"1093.53868"	"108.427"	"1.879"	"0.399031752280175"	"0.99222742129649"	"68.66"	"83.28"	"2.5"	"293.0"	"4.4"	"53.03"	"34.49"	"74.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009843"	"1.82"	"52.62"
"49115"	"False"	"High"	"[R].MWFQWSEQR.[D]"	"1xOxidation [M1]"	"0.00933004"	"0.0007621"	"1"	"1"	"4"	"Q64310"	"Q64310 [44-52]"	""	"0"	"1313.57317"	"7.891"	"1.219"	"0.925138005747468"	""	"174.50"	"50.77"	"36.1"	"219.8"	"44.0"	"46.65"	"132.09"	"22.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.000685"	"2.15"	"46.28"
"3193"	"False"	"High"	"[K].APIRPDIVNFVHTNLRK.[N]"	""	"0.0325274"	"0.0007621"	"1"	"1"	"6"	"Q9D8E6"	"Q9D8E6 [30-46]"	""	"1"	"1990.13449"	"114.300"	"7.721"	"0.428277182623561"	"0.906515362333117"	"78.83"	"50.10"	"2.9"	"274.5"	"22.6"	"39.92"	"101.84"	"28.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002171"	"3.04"	"42.22"
"46935"	"False"	"High"	"[-G].MQIFVKTLTGKTITLEVEPSDTIENVK.[A]"	""	"0.0264198"	"0.0007621"	"1"	"4"	"1"	"P62984"	"P62984 [1-27]"	""	"2"	"3034.63806"	"0.998"	"2.486"	"0.298054802768637"	"0.916215054610739"	"69.13"	"90.16"	"75.8"	"71.1"	"153.1"	"21.79"	"195.85"	"107.16"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0006427"	"0.001781"	"2.84"	"55.99"
"48541"	"False"	"High"	"[R].MTNQKIR.[I]"	"1xBiotin [K5]"	"0.014914"	"0.0007621"	"1"	"1"	"14"	"Q9CYN9"	"Q9CYN9 [342-348]"	"Q9CYN9 1xBiotin [K346]"	"1"	"1116.56524"	"0.048"	"0.607"	"0.000921940350670161"	"0.906515362333117"	"45.19"	"24.53"	"181.5"	"8.3"	"110.2"	"20.89"	"49.79"	"21.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.00105"	"2.57"	"28.13"
"45177"	"False"	"High"	"[R].MLITIMGTVKPNANR.[I]"	"1xOxidation [M1]"	"0.00751548"	"0.0007621"	"1"	"1"	"7"	"P16110"	"P16110 [144-158]"	""	"0"	"1674.90296"	"124.548"	"9.789"	"0.435748277446407"	"0.906515362333117"	"44.74"	"58.82"	"2.2"	"277.8"	"20.0"	"29.03"	"57.25"	"49.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005654"	"2.77"	"39.15"
"45446"	"False"	"High"	"[R].MISKQFHHQLR.[V]"	"1xBiotin [K4]"	"0.0102358"	"0.0007621"	"1"	"1"	"10"	"Q8R1B4"	"Q8R1B4 [707-717]"	"Q8R1B4 1xBiotin [K710]"	"1"	"1650.83555"	"0.056"	"0.682"	"0.00561266646809541"	"0.906515362333117"	"51.89"	"28.08"	"172.7"	"9.6"	"117.7"	"26.60"	"43.44"	"19.62"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007481"	"2.47"	"33.14"
"45071"	"False"	"High"	"[K].MLLFAFANALAQAR.[L]"	"1xOxidation [M1]"	"0.017505"	"0.0007621"	"1"	"1"	"1"	"Q921S7"	"Q921S7 [313-326]"	""	"0"	"1552.83044"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001216"	"2.43"	""
"3192"	"False"	"High"	"[K].APIRPDIVNFVHTNLR.[K]"	""	"0.00724187"	"0.0007621"	"1"	"1"	"3"	"Q9D8E6"	"Q9D8E6 [30-45]"	""	"0"	"1862.03953"	"38.614"	"2.824"	"0.925138005747468"	"0.91398852688127"	"137.91"	"58.59"	"6.2"	"274.5"	"19.3"	"43.54"	"87.05"	"35.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.000547"	"2.70"	"45.77"
"46564"	"False"	"High"	"[R].MPIPVIQAFGILK.[R]"	""	"0.00728677"	"0.0007621"	"1"	"2"	"4"	"P97807-1"	"P97807-1 [85-97]"	""	"0"	"1426.84905"	"1.182"	"1.865"	"0.925138005747468"	"0.997638395713937"	"59.58"	"47.73"	"83.8"	"85.1"	"131.1"	"25.14"	"201.62"	"38.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0005475"	"3.10"	"63.52"
"47321"	"False"	"High"	"[-].MSAHLQWMVVRNCSSFLIKR.[N]"	"1xCarbamidomethyl [C13]; 1xOxidation [M8]; 1xMet-loss+Acetyl [N-Term]"	"0.0052508"	"0.0007621"	"1"	"1"	"2"	"P41105"	"P41105 [1-20]"	"P41105 1xMet-loss+Acetyl [N-Term]"	"2"	"2390.22200"	"1.379"	"1.009"	"0.973358748574628"	""	"69.30"	"68.07"	"92.5"	"114.2"	"93.3"	"37.20"	"236.36"	"53.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004074"	"3.04"	"46.48"
"47363"	"False"	"High"	"[K].MSATFIGNSTAIQELFK.[R]"	""	"0.00395065"	"0.0007621"	"1"	"3"	"1"	"Q7TMM9"	"Q7TMM9 [363-379]"	""	"0"	"1857.94151"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003131"	"3.27"	""
"45173"	"False"	"High"	"[R].MLISSEDVLHSWAVPSLGLK.[T]"	"1xOxidation [M1]"	"0.0315492"	"0.0007621"	"1"	"1"	"1"	"P00405"	"P00405 [152-171]"	""	"0"	"2198.15257"	"1.071"	"1.209"	"0.972075648754221"	""	"57.56"	"48.20"	"85.6"	"90.7"	"123.7"	"36.13"	"216.85"	"26.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002109"	"2.07"	"57.52"
"16953"	"False"	"High"	"[K].FASCFYGPFR.[D]"	"1xCarbamidomethyl [C4]"	"0.00933004"	"0.0007621"	"1"	"1"	"24"	"P10518"	"P10518 [200-209]"	""	"0"	"1251.56154"	"134.795"	"3.507"	"0.929016530787821"	"0.906515362333117"	"45.79"	"33.95"	"2.4"	"289.4"	"8.2"	"44.10"	"24.38"	"14.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006879"	"2.67"	"46.48"
"16747"	"False"	"High"	"[K].EYFSKQK.[-]"	"1xBiotin [K]"	"0.0352115"	"0.0007621"	"1"	"1"	"10"	"P35700"	"P35700 [193-199]"	"P35700 1xBiotin [K]"	"1"	"1155.55031"	"0.156"	"0.730"	"0.0566043743130039"	"0.906515362333117"	"49.45"	"29.73"	"157.3"	"26.7"	"116.0"	"38.74"	"40.11"	"25.28"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000686"	"0.002352"	"2.04"	"34.96"
"46546"	"False"	"High"	"[K].MPLIGLGTWK.[S]"	"1xOxidation [M1]"	"0.00378324"	"0.0007621"	"1"	"1"	"5"	"Q9JII6"	"Q9JII6 [14-23]"	""	"0"	"1131.62308"	"171.453"	"2.146"	"0.433812357621518"	"0.998099211977233"	"64.04"	"50.15"	"2.1"	"294.1"	"3.9"	"43.25"	"38.65"	"31.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003006"	"2.41"	"47.27"
"49171"	"False"	"High"	"[K].MWVQLLIPR.[I]"	""	"0.00282872"	"0.0007621"	"1"	"1"	"4"	"P61290"	"P61290 [138-146]"	""	"0"	"1155.67070"	"56.824"	"3.149"	"0.606683863879429"	"0.906515362333117"	"64.19"	"65.96"	"6.6"	"275.5"	"17.9"	"39.36"	"54.08"	"59.50"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002296"	"2.64"	"59.17"
"3086"	"False"	"High"	"[K].APAMFNIR.[N]"	"1xOxidation [M4]"	"0.0269099"	"0.0007621"	"1"	"1"	"18"	"P97351"	"P97351 [35-42]"	""	"0"	"935.47675"	"382.997"	"8.139"	"0.908078062980276"	"0.906515362333117"	"51.47"	"74.57"	"0.8"	"292.2"	"6.9"	"72.74"	"60.91"	"32.82"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001804"	"1.87"	"30.39"
"46516"	"False"	"High"	"[-].MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCR.[L]"	"1xCarbamidomethyl [C31]; 2xOxidation [M22; M30]; 1xMet-loss [N-Term]"	"0.00397516"	"0.0007621"	"1"	"2"	"1"	"P52480"	"P52480 [1-32]"	"P52480 1xMet-loss [N-Term]"	"0"	"3555.65660"	"52.519"	"1.853"	"0.58200184989484"	"0.960422171904683"	"144.43"	"109.88"	"6.0"	"284.0"	"10.0"	"27.38"	"156.21"	"80.64"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003152"	"3.78"	"41.04"
"3085"	"False"	"High"	"[K].APAMFNIR.[N]"	""	"0.031937"	"0.0007621"	"1"	"1"	"1"	"P97351"	"P97351 [35-42]"	""	"0"	"919.48183"	"42.177"	"5.019"	"0.925138005747468"	"0.906515362333117"	"145.43"	"76.46"	"5.7"	"260.6"	"33.7"	"87.43"	"117.43"	"75.65"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002135"	"2.34"	"38.83"
"48231"	"False"	"High"	"[-].MSVFGKLFGAGGGK.[A]"	"1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"0.0026426"	"0.0007621"	"1"	"1"	"19"	"Q9D8B3"	"Q9D8B3 [1-14]"	"Q9D8B3 1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1492.76170"	"0.169"	"0.838"	"0.176824294340193"	"0.906515362333117"	"41.66"	"42.52"	"153.7"	"26.0"	"120.3"	"17.83"	"35.49"	"42.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002162"	"2.49"	"65.91"
"45178"	"False"	"High"	"[R].MLITIMGTVKPNANR.[I]"	"2xOxidation [M1; M6]"	"0.00332236"	"0.0007621"	"1"	"1"	"7"	"P16110"	"P16110 [144-158]"	""	"0"	"1690.89787"	"266.048"	"0.839"	"0.925138005747468"	""	"35.44"	"37.39"	"1.2"	"297.8"	"1.0"	"17.50"	"32.98"	"30.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002671"	"2.77"	"32.59"
"16879"	"False"	"High"	"[K].FAGNPWYYGK.[V]"	""	"0.00314244"	"0.0007621"	"1"	"1"	"7"	"Q99M51"	"Q99M51 [277-286]"	""	"0"	"1202.56292"	"258.019"	"7.555"	"0.177146025245716"	"0.906515362333117"	"70.88"	"125.40"	"1.1"	"288.7"	"10.3"	"47.04"	"57.45"	"80.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002541"	"2.68"	"40.97"
"46545"	"False"	"High"	"[K].MPLIGLGTWK.[S]"	""	"0.017505"	"0.0007621"	"1"	"1"	"3"	"Q9JII6"	"Q9JII6 [14-23]"	""	"0"	"1115.62816"	"96.924"	"7.146"	"0.944967096116098"	"0.906515362333117"	"97.96"	"54.80"	"2.5"	"281.1"	"16.5"	"81.70"	"69.62"	"25.97"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0005416"	"0.001214"	"2.24"	"53.07"
"47690"	"False"	"High"	"[-].MSHHWGYSK.[H]"	"1xMet-loss+Acetyl [N-Term]"	"0.0029357"	"0.0007621"	"1"	"1"	"27"	"P00920"	"P00920 [1-9]"	"P00920 1xMet-loss+Acetyl [N-Term]"	"0"	"1043.46935"	"169.723"	"4.473"	"0.925138005747468"	"0.906515362333117"	"70.07"	"81.47"	"1.8"	"290.5"	"7.7"	"89.61"	"39.45"	"63.83"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002375"	"2.98"	"19.83"
"66353"	"False"	"High"	"[K].TYSYLTPDLWK.[E]"	""	"0.00417681"	"0.0007621"	"1"	"1"	"10"	"P25444"	"P25444 [247-257]"	""	"0"	"1386.69399"	"276.638"	"4.943"	"0.925138005747468"	"0.906515362333117"	"49.68"	"74.14"	"1.1"	"293.4"	"5.5"	"45.80"	"37.22"	"59.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003307"	"2.87"	"51.37"
"48288"	"False"	"High"	"[-].MSWWSGVWR.[S]"	"1xMet-loss+Acetyl [N-Term]"	"0.0113686"	"0.0007621"	"1"	"1"	"12"	"Q59J78"	"Q59J78 [1-9]"	"Q59J78 1xMet-loss+Acetyl [N-Term]"	"0"	"1105.52139"	"102.684"	"3.648"	"0.967137869395237"	"0.906515362333117"	"68.58"	"76.49"	"3.2"	"286.1"	"10.7"	"51.87"	"42.56"	"52.51"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000819"	"2.08"	"63.31"
"3052"	"False"	"High"	"[K].ANSVWGALR.[G]"	""	"0.0228031"	"0.0007621"	"1"	"1"	"7"	"P20060"	"P20060 [141-149]"	""	"0"	"973.52139"	"172.516"	"4.099"	"0.433180228049634"	"0.906515362333117"	"48.87"	"68.04"	"1.9"	"290.2"	"7.9"	"36.44"	"43.23"	"57.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0006427"	"0.001549"	"2.06"	"39.32"
"17035"	"False"	"High"	"[K].FCQFLPSFSR.[E]"	"1xCarbamidomethyl [C2]"	"0.00962271"	"0.0007621"	"1"	"1"	"8"	"Q8BY71"	"Q8BY71 [290-299]"	""	"0"	"1288.61430"	"139.257"	"3.892"	"0.418857955363128"	"0.906515362333117"	"61.95"	"71.63"	"2.2"	"289.8"	"8.0"	"51.36"	"33.62"	"43.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0007048"	"2.03"	"49.10"
"46135"	"False"	"High"	"[K].MNLGVGAYR.[D]"	""	"0.023227"	"0.0007621"	"1"	"1"	"1"	"P05202"	"P05202 [60-68]"	""	"0"	"980.49821"	"103.509"	"11.255"	"0.490921933507494"	"0.906515362333117"	"66.28"	"34.78"	"2.5"	"268.2"	"29.2"	"38.34"	"100.70"	"31.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0006427"	"0.001573"	"2.47"	"34.54"
"16681"	"False"	"High"	"[R].EVWFFGLQYQDTK.[A]"	""	"0.0116528"	"0.0007621"	"1"	"1"	"6"	"P26041"	"P26041 [41-53]"	""	"0"	"1660.80058"	"58.665"	"1.188"	"0.925138005747468"	"0.906515362333117"	"77.30"	"45.72"	"6.8"	"286.1"	"7.1"	"41.92"	"57.51"	"21.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0008378"	"2.19"	"58.90"
"46415"	"False"	"High"	"[K].MPESVPLEFIPAKGLLGR.[Q]"	"1xBiotin [K13]"	"0.00239351"	"0.0007621"	"1"	"1"	"3"	"Q8BHY2"	"Q8BHY2 [487-504]"	"Q8BHY2 1xBiotin [K499]"	"1"	"2180.16063"	"0.914"	"1.608"	"0.925138005747468"	"0.92749831706829"	"60.91"	"62.05"	"72.2"	"82.7"	"145.1"	"44.49"	"40.20"	"51.09"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001965"	"3.20"	"63.93"
"46136"	"False"	"High"	"[K].MNLGVGAYR.[D]"	"1xOxidation [M1]"	"0.00968233"	"0.0007621"	"1"	"1"	"10"	"P05202"	"P05202 [60-68]"	""	"0"	"996.49313"	"580.057"	"5.464"	"0.853702144965983"	"0.906515362333117"	"75.81"	"69.08"	"0.4"	"297.2"	"2.4"	"52.53"	"29.51"	"34.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0007102"	"2.35"	"27.41"
"66623"	"False"	"High"	"[K].VAVFFGGLSIK.[K]"	""	"0.00328151"	"0.0007621"	"1"	"1"	"19"	"Q9Z1N5"	"Q9Z1N5 [145-155]"	""	"0"	"1137.66666"	"105.496"	"2.747"	"0.949662611758987"	"0.916215054610739"	"36.32"	"63.87"	"2.8"	"290.3"	"7.0"	"58.18"	"19.81"	"37.83"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002634"	"2.58"	"54.08"
"3234"	"False"	"High"	"[K].APPSSVPKSR.[L]"	"1xBiotin [K8]"	"0.0275773"	"0.0007621"	"1"	"2"	"19"	"Q9JL26"	"Q9JL26 [191-200]"	"Q9JL26 1xBiotin [K198]"	"1"	"1251.65142"	"0.072"	"0.827"	"0.925138005747468"	"0.906515362333117"	"39.56"	"63.00"	"153.9"	"11.2"	"134.9"	"41.17"	"55.04"	"49.88"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001851"	"2.29"	"27.06"
"66281"	"False"	"High"	"[R].TWKPTLVILR.[I]"	""	"0.004308"	"0.0007621"	"1"	"1"	"6"	"Q9WV32"	"Q9WV32 [85-94]"	""	"0"	"1226.76195"	"164.737"	"6.039"	"0.925138005747468"	"0.906515362333117"	"112.36"	"65.79"	"1.7"	"287.9"	"10.4"	"56.30"	"78.66"	"27.27"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003398"	"2.19"	"45.55"
"48683"	"False"	"High"	"[-].MTTTTTFKGVDPNSR.[N]"	"1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"0.0329269"	"0.0007621"	"1"	"1"	"5"	"P97825"	"P97825 [1-15]"	"P97825 1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1792.85342"	"0.398"	"0.921"	"0.925138005747468"	"0.906515362333117"	"75.42"	"71.59"	"109.4"	"60.2"	"130.4"	"53.55"	"49.83"	"39.04"	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002202"	"2.62"	"43.59"
"48459"	"False"	"High"	"[-].MTKEMTENQR.[L]"	"1xBiotin [K3]; 1xMet-loss [N-Term]"	"0.00974232"	"0.0007621"	"1"	"2"	"6"	"P30204-1"	"P30204-1 [1-10]"	"P30204-1 1xBiotin [K3]; 1xMet-loss [N-Term]"	"1"	"1362.61405"	"0.342"	"0.750"	"0.925138005747468"	"0.906515362333117"	"85.97"	"90.76"	"147.5"	"50.4"	"102.1"	"66.34"	"34.49"	"46.19"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007149"	"2.22"	"25.57"
"3184"	"False"	"High"	"[R].APIIAVTR.[N]"	""	"0.0123184"	"0.0007621"	"1"	"2"	"6"	"P52480"	"P52480 [448-455]"	""	"0"	"840.53016"	"270.729"	"1.908"	"0.925138005747468"	"0.963994276545741"	"107.04"	"134.41"	"0.9"	"295.0"	"4.1"	"96.24"	"27.94"	"71.37"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0003479"	"0.0008841"	"2.23"	"29.28"
"48542"	"False"	"High"	"[R].MTNQKIR.[I]"	"1xBiotin [K5]; 1xOxidation [M1]"	"0.0195556"	"0.0007621"	"1"	"1"	"13"	"Q9CYN9"	"Q9CYN9 [342-348]"	"Q9CYN9 1xBiotin [K346]"	"1"	"1132.56016"	"0.157"	"0.799"	"0.0128445177730168"	"0.906515362333117"	"29.64"	"37.22"	"149.5"	"25.9"	"124.6"	"24.34"	"15.00"	"37.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005902"	"0.001345"	"2.02"	"25.00"
"48496"	"False"	"High"	"[K].MTLKEFGTK.[D]"	"1xBiotin [K4]"	"0.0141962"	"0.0007621"	"1"	"1"	"4"	"Q9DBX2"	"Q9DBX2 [119-127]"	"Q9DBX2 1xBiotin [K122]"	"1"	"1280.63774"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0003479"	"0.001005"	"2.49"	""
"48499"	"False"	"High"	"[R].MTIIGVILSFR.[SA]"	"1xOxidation [M1]"	"0.0245458"	"0.0007621"	"1"	"3"	"1"	"Q8K1X4"	"Q8K1X4 [908-918]"	""	"0"	"1265.72861"	"0.676"	"0.878"	"0.925138005747468"	""	"73.38"	"38.42"	"120.3"	"67.3"	"112.4"	"38.51"	"211.36"	"31.17"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001658"	"2.36"	"66.50"
"66643"	"False"	"High"	"[R].VAYISFGPHAGK.[L]"	""	"0.0159602"	"0.0007621"	"1"	"1"	"7"	"Q9CR57"	"Q9CR57 [12-23]"	""	"0"	"1246.65788"	"485.489"	"11.823"	"0.896585727780077"	"0.906515362333117"	"47.22"	"55.66"	"0.5"	"292.8"	"6.7"	"32.41"	"35.00"	"38.97"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0005064"	"0.001113"	"2.20"	"34.98"
"66265"	"False"	"High"	"[K].TVYFFSPWR.[G]"	""	"0.0029357"	"0.0007621"	"1"	"1"	"26"	"P09581"	"P09581 [152-160]"	""	"0"	"1202.59931"	"90.028"	"2.875"	"0.962122454074805"	"0.906515362333117"	"20.93"	"20.65"	"3.2"	"287.1"	"9.6"	"28.14"	"19.57"	"20.58"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002381"	"2.37"	"55.24"
"66347"	"False"	"High"	"[R].TYSLGSALRPSTSR.[S]"	""	"0.0352115"	"0.0007621"	"1"	"1"	"3"	"P20152"	"P20152 [37-50]"	""	"0"	"1495.78633"	"190.363"	"4.645"	"0.925138005747468"	"0.906515362333117"	"40.08"	"37.04"	"1.4"	"291.0"	"7.5"	"27.54"	"30.59"	"29.25"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002352"	"1.93"	"33.12"
"47836"	"False"	"High"	"[R].MSMDLKNNLLGSLR.[M]"	"1xBiotin [K6]; 1xOxidation [M]"	"0.00664149"	"0.0007621"	"1"	"3"	"5"	"Q80Y98"	"Q80Y98 [571-584]"	"Q80Y98 1xBiotin [K576]"	"1"	"1833.90197"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005055"	"3.05"	""
"49083"	"False"	"High"	"[K].MVVSIGWNPYYK.[N]"	"1xOxidation [M1]"	"0.0321326"	"0.0007621"	"1"	"1"	"2"	"Q8CFV9"	"Q8CFV9 [61-72]"	""	"0"	"1472.72425"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.00215"	"2.70"	""
"66235"	"False"	"High"	"[K].TVTAMDVVYALKR.[Q]"	"1xBiotin [K12]"	"0.00441591"	"0.0007621"	"1"	"1"	"8"	"P62806"	"P62806 [81-93]"	"P62806 1xBiotin [K92]"	"1"	"1692.88116"	"0.474"	"0.742"	"0.925138005747468"	"0.906515362333117"	"44.42"	"65.28"	"136.0"	"67.0"	"97.0"	"42.02"	"50.07"	"60.84"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003478"	"3.24"	"61.62"
"3311"	"False"	"High"	"[R].APTTMKK.[F]"	"1xBiotin [K]"	"0.0333312"	"0.0007621"	"1"	"1"	"4"	"Q9DBG7"	"Q9DBG7 [132-138]"	"Q9DBG7 1xBiotin [K]"	"1"	"1002.51108"	"0.281"	"1.256"	"0.925138005747468"	"0.937945192250145"	"56.04"	"43.42"	"120.9"	"32.1"	"146.9"	"16.43"	"53.97"	"39.01"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.002234"	"2.18"	"24.91"
"47710"	"False"	"High"	"[K].MSKFGFAIGSQTAR.[K]"	"1xBiotin [K3]"	"0.0046399"	"0.0007621"	"1"	"1"	"7"	"Q6P8I4"	"Q6P8I4 [68-81]"	"Q6P8I4 1xBiotin [K70]"	"1"	"1726.84036"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003637"	"2.39"	""
"66621"	"False"	"High"	"[R].VAVEEVDEEGKFVR.[L]"	"1xBiotin [K11]"	"0.0176131"	"0.0007621"	"1"	"3"	"1"	"P48678-1"	"P48678-1 [440-453]"	"P48678-1 1xBiotin [K450]"	"1"	"1831.88947"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001222"	"2.52"	""
"17023"	"False"	"High"	"[R].FCLFHAFFK.[T]"	"1xCarbamidomethyl [C2]"	"0.0026426"	"0.0007621"	"1"	"1"	"15"	"Q7TPV4"	"Q7TPV4 [476-484]"	""	"0"	"1216.59720"	"119.540"	"3.377"	"0.935694807094878"	"0.906515362333117"	"40.47"	"46.24"	"2.6"	"289.6"	"7.8"	"50.89"	"13.44"	"24.02"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002165"	"2.79"	"55.26"
"66690"	"False"	"High"	"[K].VCMYFTYK.[V]"	"1xCarbamidomethyl [C2]; 1xOxidation [M3]"	"0.0209239"	"0.0007621"	"1"	"1"	"4"	"P83940"	"P83940 [73-80]"	""	"0"	"1127.49002"	"96.257"	"0.892"	"0.425904733810833"	""	"61.95"	"75.54"	"3.6"	"293.2"	"3.1"	"49.93"	"61.94"	"43.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001425"	"1.88"	"34.38"
"46934"	"False"	"High"	"[-G].MQIFVKTLTGK.[T]"	"1xBiotin [K6]; 1xOxidation [M1]"	"0.00655988"	"0.0007621"	"1"	"4"	"6"	"P62984"	"P62984 [1-11]"	"P62984 1xBiotin [K6]"	"1"	"1507.80112"	"0.395"	"0.785"	"0.925138005747468"	"0.906515362333117"	"33.78"	"37.42"	"138.6"	"52.8"	"108.5"	"21.67"	"27.98"	"29.87"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0004983"	"3.06"	"47.63"
"48298"	"False"	"High"	"[R].MSYILKESSK.[S]"	"1xBiotin [K6]"	"0.00565525"	"0.0007621"	"1"	"1"	"7"	"Q8K4I3"	"Q8K4I3 [611-620]"	"Q8K4I3 1xBiotin [K616]"	"1"	"1411.69598"	"1.047"	"1.766"	"0.975052343286225"	"0.954461348772941"	"61.32"	"95.96"	"68.2"	"75.8"	"156.0"	"60.36"	"24.86"	"60.00"	""	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004352"	"2.52"	"41.72"
"48447"	"False"	"High"	"[R].MTHNLLLNYGLYR.[K]"	"1xOxidation [M1]"	"0.0131835"	"0.0007621"	"1"	"2"	"4"	"O09106"	"O09106 [37-49]"	""	"0"	"1623.83117"	"201.280"	"3.758"	"0.331206025167054"	"0.906515362333117"	"80.36"	"84.46"	"1.0"	"294.5"	"4.5"	"67.64"	"38.54"	"47.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.0009395"	"3.28"	"44.74"
"3071"	"False"	"High"	"[K].ANWYFLLAR.[S]"	""	"0.00360058"	"0.0007621"	"1"	"1"	"20"	"P45952"	"P45952 [198-206]"	""	"0"	"1153.61529"	"114.390"	"2.991"	"0.925138005747468"	"0.906515362333117"	"52.43"	"54.32"	"2.5"	"291.4"	"6.1"	"39.65"	"15.52"	"48.95"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002874"	"1.96"	"57.51"
"45614"	"False"	"High"	"[R].MLVVLLQANR.[D]"	""	"0.0034056"	"0.0007621"	"1"	"1"	"2"	"P48036"	"P48036 [150-159]"	""	"0"	"1156.68707"	"100.582"	"6.474"	"0.434853540501642"	"0.906515362333117"	"76.13"	"83.48"	"3.0"	"279.7"	"17.3"	"114.37"	"43.55"	"41.28"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002738"	"2.47"	"46.80"
"46772"	"False"	"High"	"[K].MPTLGLGTWK.[S]"	"1xOxidation [M1]"	"0.00272563"	"0.0007621"	"1"	"1"	"16"	"P45376"	"P45376 [13-22]"	""	"0"	"1119.58669"	"685.080"	"8.975"	"0.58200184989484"	"0.906515362333117"	"57.76"	"72.87"	"0.5"	"295.9"	"3.6"	"47.10"	"28.45"	"66.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002218"	"2.76"	"42.72"
"46771"	"False"	"High"	"[K].MPTLGLGTWK.[S]"	""	"0.00576114"	"0.0007621"	"1"	"1"	"12"	"P45376"	"P45376 [13-22]"	""	"0"	"1103.59178"	"62.136"	"5.487"	"0.982626859977453"	"0.906515362333117"	"82.12"	"85.63"	"5.3"	"274.6"	"20.2"	"48.17"	"91.29"	"67.60"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004426"	"2.45"	"48.31"
"66689"	"False"	"High"	"[K].VCMYFTYK.[V]"	"1xCarbamidomethyl [C2]"	"0.0172908"	"0.0007621"	"1"	"1"	"7"	"P83940"	"P83940 [73-80]"	""	"0"	"1111.49510"	"1.164"	"2.846"	"0.989440770281069"	"0.906515362333117"	"48.66"	"44.21"	"55.7"	"70.3"	"174.0"	"32.41"	"224.73"	"35.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001198"	"1.90"	"40.62"
"48920"	"False"	"High"	"[K].MVMTVFACLMGK.[G]"	"1xCarbamidomethyl [C8]; 1xOxidation [M]"	"0.0134297"	"0.0007621"	"1"	"2"	"2"	"Q61233"	"Q61233 [611-622]"	""	"0"	"1403.65538"	"1.307"	"4.002"	"0.989369718514603"	"0.906515362333117"	"84.75"	"73.97"	"45.7"	"59.8"	"194.4"	"50.50"	"226.92"	"61.30"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009525"	"2.53"	"52.68"
"16855"	"False"	"High"	"[K].FADYISKAR.[E]"	"1xBiotin [K7]"	"0.00306563"	"0.0007621"	"1"	"1"	"42"	"Q8R5J9"	"Q8R5J9 [179-187]"	"Q8R5J9 1xBiotin [K185]"	"1"	"1296.64052"	"0.223"	"0.622"	"0.00429942622500073"	"0.906515362333117"	"38.57"	"27.22"	"162.9"	"35.5"	"101.6"	"11.20"	"43.68"	"23.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002482"	"3.36"	"41.97"
"16980"	"False"	"High"	"[R].FAVGIVIGR.[N]"	""	"0.00751548"	"0.0007621"	"1"	"2"	"5"	"Q91WJ8"	"Q91WJ8 [281-289]"	""	"0"	"931.57236"	"86.431"	"1.841"	"0.466031980976297"	"0.956043974317412"	"54.32"	"100.74"	"3.8"	"289.7"	"6.5"	"41.24"	"41.34"	"77.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005656"	"2.08"	"44.60"
"17477"	"False"	"High"	"[R].FGSGMNMGR.[I]"	""	"0.00986342"	"0.0007621"	"1"	"2"	"7"	"Q9D0E1"	"Q9D0E1 [362-370]"	""	"0"	"956.40768"	"1.211"	"12.552"	"0.974117697548086"	"0.906515362333117"	"98.03"	"79.09"	"22.4"	"24.4"	"253.2"	"45.52"	"182.64"	"58.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007198"	"2.37"	"26.66"
"66724"	"False"	"High"	"[K].VDCKGAGTNGLPTKGPTEVSDK.[K]"	"2xBiotin [K4; K14]; 1xCarbamidomethyl [C3]"	"0.0123947"	"0.0007621"	"1"	"1"	"4"	"Q91WE4"	"Q91WE4 [48-69]"	"Q91WE4 2xBiotin [K51; K61]"	"2"	"2683.25243"	"0.413"	"1.029"	"0.929016530787821"	"0.906515362333117"	"88.75"	"96.24"	"134.3"	"58.8"	"106.9"	"69.77"	"41.07"	"75.05"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.0008883"	"3.17"	"42.16"
"39527"	"False"	"High"	"[K].LWNLNNYR.[T]"	""	"0.0138503"	"0.0007621"	"1"	"1"	"14"	"Q99PV0"	"Q99PV0 [1464-1471]"	""	"0"	"1092.55850"	"163.816"	"5.507"	"0.925138005747468"	"0.906515362333117"	"32.07"	"34.46"	"1.7"	"289.4"	"8.9"	"20.43"	"30.25"	"50.14"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009835"	"1.93"	"42.21"
"67221"	"False"	"High"	"[R].VGASFLQR.[F]"	""	"0.0120924"	"0.0007621"	"1"	"1"	"6"	"P05202"	"P05202 [140-147]"	""	"0"	"877.48903"	"62.776"	"1.098"	"0.973358748574628"	"0.919235111389825"	"76.60"	"57.81"	"5.4"	"289.0"	"5.6"	"74.51"	"50.33"	"24.57"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003095"	"0.0008669"	"2.27"	"31.84"
"2633"	"False"	"High"	"[R].ALTKGVQAVMGYKPGHGLVTAAAASAENVPGKPWK.[K]"	"1xBiotin [K4]; 1xOxidation [M10]"	"0.00452652"	"0.0007621"	"1"	"2"	"3"	"Q3UM18"	"Q3UM18 [590-624]"	"Q3UM18 1xBiotin [K593]"	"1"	"3746.95092"	"1.134"	"1.271"	""	"0.906515362333117"	"57.56"	"83.88"	"96.2"	"82.7"	"121.1"	"46.06"	"53.26"	"106.46"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.000356"	"3.70"	"46.97"
"39503"	"False"	"High"	"[K].IWHYTGSLLHK.[Y]"	""	"0.0272416"	"0.0007621"	"1"	"2"	"2"	"Q8BJW6-1"	"Q8BJW6-1 [389-399]"	""	"0"	"1354.72663"	"162.435"	"2.510"	"0.432224089536881"	"0.920591500872547"	"74.62"	"128.79"	"2.6"	"293.2"	"4.2"	"38.92"	"104.22"	"104.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.001833"	"2.65"	"36.01"
"67267"	"False"	"High"	"[R].VGFQYEGTYKWVNPHK.[L]"	"1xBiotin [K]"	"0.0038541"	"0.0007621"	"1"	"1"	"5"	"Q00612"	"Q00612 [499-514]"	"Q00612 1xBiotin [K]"	"1"	"2179.04296"	"0.281"	"0.950"	"0.925138005747468"	"0.906515362333117"	"70.17"	"42.41"	"134.7"	"37.3"	"128.0"	"40.56"	"48.53"	"16.53"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003068"	"3.28"	"47.75"
"39480"	"False"	"High"	"[K].LWAYLTINQLLAER.[S]"	""	"0.00447087"	"0.0007621"	"1"	"1"	"2"	"Q61703"	"Q61703 [583-596]"	""	"0"	"1703.94792"	"0.940"	"0.718"	"0.925138005747468"	""	"33.43"	"37.88"	"119.2"	"106.9"	"73.9"	"16.80"	"215.25"	"28.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003508"	"3.45"	"63.82"
"39472"	"False"	"High"	"[K].LVYQIFDTFFSEQIEK.[Y]"	""	"0.0135128"	"0.0007621"	"1"	"2"	"1"	"P13864"	"P13864 [626-641]"	""	"0"	"2007.01097"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.000959"	"2.70"	""
"39471"	"False"	"High"	"[K].LVYNVVFYR.[N]"	""	"0.00938785"	"0.0007621"	"1"	"1"	"11"	"P26151"	"P26151 [141-149]"	""	"0"	"1172.64626"	"159.658"	"4.476"	"0.925138005747468"	"0.906515362333117"	"58.77"	"51.69"	"1.9"	"290.3"	"7.8"	"81.15"	"50.24"	"27.25"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006918"	"2.23"	"47.15"
"17637"	"False"	"High"	"[K].FKPGYLEATLNWFR.[L]"	""	"0.00279393"	"0.0007621"	"1"	"2"	"2"	"Q91VM9"	"Q91VM9 [221-234]"	""	"0"	"1741.90605"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002275"	"3.63"	""
"39440"	"False"	"High"	"[K].IVVLFYK.[A]"	""	"0.0262584"	"0.0007621"	"1"	"2"	"10"	"Q91VK1"	"Q91VK1 [363-369]"	""	"0"	"881.54950"	"159.969"	"3.403"	"0.925138005747468"	"0.906515362333117"	"68.26"	"67.11"	"2.2"	"289.7"	"8.1"	"56.14"	"44.56"	"36.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0006427"	"0.00177"	"2.18"	"45.43"
"67406"	"False"	"High"	"[K].VGVNGFGR.[I]"	""	"0.0277467"	"0.0007621"	"1"	"1"	"6"	"P16858"	"P16858 [4-11]"	""	"0"	"805.43151"	"95.399"	"2.616"	"0.949662611758987"	"0.906515362333117"	"52.32"	"43.56"	"2.8"	"289.5"	"7.7"	"39.20"	"42.59"	"21.81"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0006486"	"0.001864"	"2.30"	"26.32"
"2495"	"False"	"High"	"[R].ALQASALNAWR.[G]"	""	"0.00655988"	"0.0007621"	"1"	"1"	"4"	"P05063"	"P05063 [305-315]"	""	"0"	"1200.64838"	"63.352"	"1.449"	"0.562397331368786"	"0.906515362333117"	"144.33"	"54.76"	"4.5"	"288.7"	"6.8"	"37.59"	"100.98"	"30.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0004985"	"2.91"	"41.16"
"17660"	"False"	"High"	"[R].FKWAIELSGPGGGSR.[G]"	"1xBiotin [K2]"	"0.0107541"	"0.0007621"	"1"	"1"	"4"	"Q9CZX9"	"Q9CZX9 [15-29]"	"Q9CZX9 1xBiotin [K16]"	"1"	"1787.88975"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0002502"	"0.0007802"	"2.43"	""
"39346"	"False"	"High"	"[K].IVQVALNGLENILR.[L]"	""	"0.00441591"	"0.0007621"	"1"	"2"	"1"	"Q60960"	"Q60960 [439-452]"	""	"0"	"1551.92170"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000348"	"2.96"	""
"17662"	"False"	"High"	"[K].FKWWGLQSK.[V]"	""	"0.0125486"	"0.0007621"	"1"	"1"	"17"	"P53811"	"P53811 [200-208]"	""	"1"	"1179.63094"	"61.066"	"1.516"	"0.966090293805027"	"0.954461348772941"	"62.26"	"61.80"	"5.0"	"288.1"	"6.9"	"39.07"	"40.19"	"38.66"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.0008985"	"2.36"	"45.21"
"39530"	"False"	"High"	"[K].LWNTLGVCK.[Y]"	"1xCarbamidomethyl [C8]"	"0.0133471"	"0.0007621"	"1"	"1"	"1"	"P68040"	"P68040 [131-139]"	""	"0"	"1090.57138"	"255.941"	"9.911"	"0.925138005747468"	"0.906515362333117"	"112.23"	"122.41"	"1.3"	"285.4"	"13.3"	"127.53"	"55.67"	"56.10"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009489"	"2.23"	"39.25"
"39312"	"False"	"High"	"[K].IVPVEITISLLK.[R]"	""	"0.00302793"	"0.0007621"	"1"	"1"	"10"	"Q9DBP5"	"Q9DBP5 [62-73]"	""	"0"	"1324.84502"	"82.523"	"3.473"	"0.693273552548466"	"0.906515362333117"	"53.36"	"52.34"	"3.6"	"285.4"	"11.0"	"45.23"	"32.56"	"33.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000245"	"1.79"	"60.01"
"39541"	"False"	"High"	"[R].IWQYVYSK.[D]"	""	"0.0122426"	"0.0007621"	"1"	"2"	"11"	"P61164"	"P61164 [89-96]"	""	"0"	"1086.56186"	"142.885"	"3.774"	"0.925138005747468"	"0.906515362333117"	"47.40"	"51.92"	"2.2"	"289.3"	"8.6"	"42.61"	"30.89"	"30.62"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0003095"	"0.0008752"	"2.26"	"38.24"
"39549"	"False"	"High"	"[K].IWTHPGWSPLK.[T]"	""	"0.00544928"	"0.0007621"	"1"	"1"	"2"	"Q9DAW6"	"Q9DAW6 [475-485]"	""	"0"	"1321.70517"	"109.450"	"3.264"	"0.363340288767383"	"0.906515362333117"	"146.64"	"106.02"	"2.9"	"289.8"	"7.2"	"49.26"	"140.12"	"90.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.000421"	"2.86"	"41.07"
"39674"	"False"	"High"	"[K].LYMVLITTK.[N]"	""	"0.0345735"	"0.0007621"	"1"	"1"	"2"	"Q5XJY5"	"Q5XJY5 [64-72]"	""	"0"	"1081.63258"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.000686"	"0.002311"	"1.45"	""
"39653"	"False"	"High"	"[K].LYLILDFLR.[G]"	""	"0.00824549"	"0.0007621"	"1"	"6"	"10"	"Q9WUT3"	"Q9WUT3 [134-142]"	""	"0"	"1165.69796"	"68.506"	"1.879"	"0.925138005747468"	"0.935866453494337"	"61.89"	"64.47"	"4.1"	"287.1"	"8.7"	"43.49"	"49.42"	"66.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006126"	"1.54"	"66.35"
"17559"	"False"	"High"	"[R].FHSLAPMYYR.[G]"	"1xOxidation [M7]"	"0.00799461"	"0.0007621"	"1"	"1"	"2"	"Q921E2"	"Q921E2 [67-76]"	""	"0"	"1300.61430"	"220.896"	"3.280"	"0.925138005747468"	"0.906515362333117"	"34.99"	"47.87"	"1.3"	"294.7"	"4.0"	"23.29"	"31.99"	"55.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005966"	"2.70"	"32.28"
"39644"	"False"	"High"	"[R].LYIAYQFLR.[A]"	""	"0.00632101"	"0.0007621"	"1"	"1"	"1"	"Q8CG48"	"Q8CG48 [233-241]"	""	"0"	"1186.66191"	"142.184"	"3.635"	"0.925138005747468"	"0.906515362333117"	"70.02"	"70.17"	"2.1"	"291.4"	"6.6"	"68.78"	"37.41"	"41.46"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0004808"	"2.47"	"52.83"
"39636"	"False"	"High"	"[R].LYKHLDV.[-]"	"1xBiotin [K3]"	"0.0230848"	"0.0007621"	"1"	"2"	"17"	"Q3UM18"	"Q3UM18 [638-644]"	"Q3UM18 1xBiotin [K640]"	"1"	"1113.57613"	"0.038"	"0.808"	"9.87614285871791E-05"	"0.906515362333117"	"60.31"	"43.16"	"166.5"	"6.5"	"127.0"	"52.85"	"38.66"	"31.75"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001564"	"2.07"	"44.35"
"39626"	"False"	"High"	"[K].LYHLFLK.[I]"	""	"0.0209239"	"0.0007621"	"1"	"2"	"8"	"Q9Z2I8"	"Q9Z2I8 [229-235]"	""	"0"	"933.55565"	"152.341"	"3.752"	"0.925138005747468"	"0.906515362333117"	"71.45"	"84.26"	"2.6"	"291.2"	"6.2"	"50.72"	"45.60"	"72.86"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000628"	"0.001425"	"2.33"	"39.82"
"39613"	"False"	"High"	"[K].IYFYWICR.[ED]"	"1xCarbamidomethyl [C7]"	"0.02578"	"0.0007621"	"1"	"3"	"5"	"Q61093"	"Q61093 [439-446]"	""	"0"	"1220.59211"	"78.406"	"1.486"	"0.989440770281069"	"0.947573640977216"	"38.70"	"32.82"	"3.7"	"291.3"	"5.0"	"31.88"	"25.06"	"16.71"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001736"	"2.10"	"57.05"
"39609"	"False"	"High"	"[K].IYFMAGSSR.[K]"	"1xOxidation [M4]"	"0.0110913"	"0.0007621"	"1"	"1"	"18"	"P08113"	"P08113 [538-546]"	""	"0"	"1047.49279"	"193.424"	"3.739"	"0.925138005747468"	"0.906515362333117"	"55.71"	"67.83"	"1.6"	"293.7"	"4.6"	"40.60"	"44.85"	"66.05"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008019"	"2.03"	"28.49"
"39608"	"False"	"High"	"[K].IYFMAGSSR.[K]"	""	"0.0240982"	"0.0007621"	"1"	"1"	"8"	"P08113"	"P08113 [538-546]"	""	"0"	"1031.49788"	"46.294"	"4.493"	"0.925138005747468"	"0.906515362333117"	"97.73"	"46.16"	"6.3"	"266.9"	"26.7"	"19.52"	"79.90"	"61.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001627"	"1.97"	"35.77"
"39592"	"False"	"High"	"[R].LYDLYWQAMR.[M]"	"1xOxidation [M9]"	"0.00882542"	"0.0007621"	"1"	"1"	"10"	"Q7TPV4"	"Q7TPV4 [1132-1141]"	""	"0"	"1374.65108"	"114.253"	"2.730"	"0.47151384622871"	"0.916215054610739"	"58.80"	"56.80"	"2.2"	"292.7"	"5.1"	"41.73"	"39.10"	"34.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006535"	"1.78"	"45.57"
"39591"	"False"	"High"	"[R].LYDLYWQAMR.[M]"	""	"0.00944602"	"0.0007621"	"1"	"1"	"4"	"Q7TPV4"	"Q7TPV4 [1132-1141]"	""	"0"	"1358.65617"	"0.670"	"1.828"	"0.925138005747468"	"0.952991370623084"	"120.94"	"61.95"	"86.7"	"55.6"	"157.7"	"25.83"	"159.90"	"101.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0006952"	"2.35"	"51.72"
"17575"	"False"	"High"	"[R].FHYGFNSSYLK.[K]"	""	"0.0101101"	"0.0007621"	"1"	"1"	"4"	"Q9D379"	"Q9D379 [81-91]"	""	"0"	"1362.64771"	"226.641"	"4.907"	"0.925138005747468"	"0.906515362333117"	"64.45"	"78.86"	"1.4"	"293.3"	"5.4"	"42.91"	"48.35"	"63.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007382"	"2.47"	"39.47"
"39556"	"False"	"High"	"[R].IWVNISLSGIK.[I]"	""	"0.0223869"	"0.0007621"	"1"	"3"	"9"	"P98078"	"P98078 [93-103]"	""	"0"	"1229.72523"	"58.068"	"1.427"	"0.830135317126799"	"0.906515362333117"	"23.91"	"79.24"	"5.1"	"287.7"	"7.1"	"14.90"	"36.06"	"61.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001519"	"1.89"	"53.28"
"17589"	"False"	"High"	"[R].FKDFYQFTFNFAK.[N]"	""	"0.013936"	"0.0007621"	"1"	"1"	"6"	"Q9QZ73"	"Q9QZ73 [154-166]"	""	"1"	"1702.82640"	"81.307"	"3.691"	"0.908721208684189"	"0.906515362333117"	"70.47"	"62.80"	"3.3"	"284.1"	"12.7"	"39.20"	"66.76"	"59.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009868"	"3.40"	"55.18"
"39551"	"False"	"High"	"[K].LWTLVSEQTR.[V]"	""	"0.00742315"	"0.0007621"	"1"	"1"	"6"	"P14115"	"P14115 [78-87]"	""	"0"	"1232.66336"	"71.911"	"3.255"	"0.900391444695393"	"0.906515362333117"	"63.87"	"69.73"	"4.2"	"284.2"	"11.6"	"44.17"	"58.02"	"45.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.000558"	"2.37"	"43.05"
"2645"	"False"	"High"	"[R].AITSAYYR.[G]"	""	"0.0172908"	"0.0007621"	"1"	"3"	"10"	"P46638"	"P46638 [75-82]"	""	"0"	"944.48361"	"207.943"	"4.998"	"0.925138005747468"	"0.906515362333117"	"63.25"	"56.08"	"1.5"	"291.2"	"7.3"	"50.98"	"37.99"	"46.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005416"	"0.0012"	"2.25"	"26.69"
"17664"	"False"	"High"	"[K].FKYLGTQDR.[A]"	"1xBiotin [K2]"	"0.00620485"	"0.0007621"	"1"	"2"	"12"	"Q3UPF5-1"	"Q3UPF5-1 [294-302]"	"Q3UPF5-1 1xBiotin [K295]"	"1"	"1353.66198"	"0.199"	"1.352"	"0.925138005747468"	"0.936238272383155"	"54.86"	"31.33"	"117.0"	"25.5"	"157.5"	"16.83"	"48.14"	"50.93"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004744"	"2.49"	"40.17"
"39183"	"False"	"High"	"[K].LVINGKPITIFQERDPTNIK.[W]"	""	"0.00950455"	"0.0007621"	"1"	"1"	"10"	"P16858"	"P16858 [65-84]"	""	"1"	"2296.30234"	"340.653"	"21.857"	"0.925138005747468"	"0.906515362333117"	"78.84"	"63.73"	"0.9"	"282.0"	"17.1"	"50.69"	"65.65"	"37.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0006972"	"2.24"	"44.59"
"39176"	"False"	"High"	"[K].LVIITAGAR.[MQ]"	""	"0.0124714"	"0.0007621"	"1"	"2"	"12"	"P06151"	"P06151 [91-99]"	""	"0"	"913.58293"	"185.769"	"4.359"	"0.925138005747468"	"0.906515362333117"	"63.98"	"69.02"	"1.6"	"292.4"	"6.1"	"59.20"	"22.88"	"57.97"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0008912"	"2.11"	"33.77"
"2431"	"False"	"High"	"[K].AIMVKGVDEATIIDILTK.[R]"	"1xBiotin [K5]"	"0.00270882"	"0.0007621"	"1"	"1"	"4"	"P10107"	"P10107 [54-71]"	"P10107 1xBiotin [K58]"	"1"	"2156.17052"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002212"	"3.87"	""
"38872"	"False"	"High"	"[R].LTSIKSTTLR.[V]"	"1xBiotin [K5]"	"0.00765613"	"0.0007621"	"1"	"2"	"4"	"O55143-1"	"O55143-1 [165-174]"	"O55143-1 1xBiotin [K169]"	"1"	"1345.75080"	"0.361"	"0.807"	"0.925138005747468"	"0.906515362333117"	"50.89"	"71.74"	"137.4"	"49.6"	"113.0"	"45.60"	"32.50"	"30.51"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005725"	"2.11"	"39.80"
"38801"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYKDK.[Q]"	"2xBiotin [K7; K25]"	"0.0138503"	"0.0007621"	"1"	"1"	"2"	"Q3U9G9"	"Q3U9G9 [127-159]"	"Q3U9G9 2xBiotin [K133; K151]"	"2"	"4155.03880"	"1.010"	"2.292"	""	"0.935866453494337"	"46.48"	"50.18"	"76.1"	"68.9"	"155.0"	"27.81"	"35.86"	"83.74"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0003479"	"0.0009805"	"3.78"	"55.58"
"17862"	"False"	"High"	"[K].FLINGKPFYFQGVNK.[H]"	""	"0.00710881"	"0.0007621"	"1"	"1"	"3"	"P12265"	"P12265 [332-346]"	""	"0"	"1771.95300"	"115.896"	"4.079"	"0.545092645246401"	"0.906515362333117"	"52.94"	"67.34"	"2.5"	"287.9"	"9.6"	"47.28"	"15.66"	"53.65"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005358"	"2.44"	"48.39"
"38798"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"1xBiotin [K]; 1xOxidation [M23]"	"0.00404962"	"0.0007621"	"1"	"1"	"6"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 1xBiotin [K]"	"1"	"3701.83421"	"0.947"	"6.145"	"0.994441929761612"	"0.906515362333117"	"69.15"	"67.26"	"34.3"	"43.6"	"222.2"	"73.53"	"33.99"	"27.46"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003203"	"4.01"	"49.29"
"38797"	"False"	"High"	"[K].LTPLVLKPFGNSVSVYNGEPEHMEKNATPYK.[D]"	"1xBiotin [K25]"	"0.00676582"	"0.0007621"	"1"	"1"	"2"	"Q3U9G9"	"Q3U9G9 [127-157]"	"Q3U9G9 1xBiotin [K151]"	"1"	"3685.83930"	"1.568"	"15.703"	""	"0.906515362333117"	"69.10"	"65.21"	"16.4"	"26.7"	"256.9"	"60.39"	"39.69"	"22.57"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0005134"	"4.22"	"51.29"
"17894"	"False"	"High"	"[R].FLMSLVNQVPK.[I]"	""	"0.0199197"	"0.0007621"	"1"	"1"	"1"	"Q9DCH4"	"Q9DCH4 [311-321]"	""	"0"	"1275.71296"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0005902"	"0.001368"	"2.01"	""
"38745"	"False"	"High"	"[K].ITITNDKGR.[L]"	"1xBiotin [K7]"	"0.00351258"	"0.0007621"	"1"	"5"	"18"	"P63017"	"P63017 [501-509]"	"P63017 1xBiotin [K507]"	"1"	"1243.64633"	"0.123"	"1.032"	"0.00145439856911307"	"0.916215054610739"	"217.70"	"72.25"	"140.5"	"16.1"	"143.4"	"43.47"	"127.88"	"55.16"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002819"	"2.82"	"33.53"
"17909"	"False"	"High"	"[R].FLNHFANYR.[W]"	""	"0.0196762"	"0.0007621"	"1"	"1"	"7"	"Q9DC69"	"Q9DC69 [213-221]"	""	"0"	"1181.58505"	"192.968"	"5.625"	"0.925138005747468"	"0.906515362333117"	"61.75"	"76.28"	"1.6"	"291.8"	"6.6"	"54.43"	"38.92"	"80.25"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0005902"	"0.001349"	"2.10"	"33.72"
"67693"	"False"	"High"	"[K].VKSPNGK.[A]"	"1xBiotin [K2]"	"0.0300439"	"0.0007621"	"1"	"1"	"11"	"O88455"	"O88455 [12-18]"	"O88455 1xBiotin [K13]"	"1"	"955.50296"	"0.057"	"0.717"	"0.00130168402165753"	"0.906515362333117"	"68.42"	"57.58"	"154.2"	"10.4"	"135.4"	"47.59"	"39.56"	"30.47"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002007"	"2.15"	"19.65"
"67704"	"False"	"High"	"[R].VKTLHPAVHAGILAR.[N]"	"1xBiotin [K2]"	"0.0302281"	"0.0007621"	"1"	"1"	"1"	"Q9CWJ9"	"Q9CWJ9 [65-79]"	"Q9CWJ9 1xBiotin [K66]"	"1"	"1809.03160"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.00202"	"2.65"	""
"17929"	"False"	"High"	"[K].FINYVKNCFR.[M]"	"1xBiotin [K6]; 1xCarbamidomethyl [C8]"	"0.0178314"	"0.0007621"	"1"	"1"	"7"	"Q61937"	"Q61937 [266-275]"	"Q61937 1xBiotin [K271]"	"1"	"1586.76065"	"1.174"	"0.955"	"0.925138005747468"	"0.906515362333117"	"61.91"	"76.80"	"85.5"	"108.9"	"105.6"	"49.01"	"31.02"	"77.72"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0005416"	"0.001234"	"1.89"	"49.09"
"38641"	"False"	"High"	"[R].ITGSVGKGLAAITMDKEYQQK.[R]"	"1xBiotin [K7]; 1xOxidation [M14]"	"0.00938785"	"0.0007621"	"1"	"3"	"4"	"Q8BX70-1"	"Q8BX70-1 [3476-3496]"	"Q8BX70-1 1xBiotin [K3482]"	"2"	"2480.25236"	"0.220"	"0.495"	"0.925138005747468"	"0.906515362333117"	"53.77"	"57.55"	"169.3"	"41.5"	"89.2"	"31.32"	"45.81"	"47.06"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0006882"	"3.27"	"44.94"
"38639"	"False"	"High"	"[R].ITGSVGKGLAAITMDK.[E]"	"1xBiotin [K7]; 1xOxidation [M14]"	"0.00270882"	"0.0007621"	"1"	"3"	"7"	"Q8BX70-1"	"Q8BX70-1 [3476-3491]"	"Q8BX70-1 1xBiotin [K3482]"	"1"	"1803.93432"	"0.548"	"1.242"	"0.925138005747468"	"0.906515362333117"	"98.40"	"83.48"	"107.2"	"58.8"	"134.0"	"72.91"	"44.44"	"21.48"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002209"	"3.88"	"47.36"
"17940"	"False"	"High"	"[K].FLPGMAVGFSSSK.[L]"	"1xOxidation [M5]"	"0.028261"	"0.0007621"	"1"	"1"	"5"	"Q64674"	"Q64674 [136-148]"	""	"0"	"1343.66640"	"95.433"	"1.431"	"0.506135008668742"	""	"42.21"	"53.03"	"3.3"	"292.0"	"4.7"	"34.23"	"33.33"	"33.97"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.001893"	"2.15"	"38.77"
"38878"	"False"	"High"	"[K].LTSMHFYGWK.[Q]"	"1xOxidation [M4]"	"0.00655988"	"0.0007621"	"1"	"1"	"14"	"P07742"	"P07742 [720-729]"	""	"0"	"1285.60341"	"249.534"	"2.673"	"0.925138005747468"	"0.906515362333117"	"67.17"	"63.37"	"1.6"	"294.3"	"4.2"	"55.81"	"63.99"	"36.45"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0004981"	"2.82"	"34.17"
"17855"	"False"	"High"	"[R].FLLLFTFLK.[K]"	""	"0.00927258"	"0.0007621"	"1"	"1"	"2"	"Q8K363"	"Q8K363 [403-411]"	""	"0"	"1141.70198"	"0.940"	"1.393"	"0.287137137027041"	"0.935866453494337"	"73.28"	"93.30"	"94.5"	"93.5"	"112.0"	"39.53"	"240.69"	"87.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0006819"	"2.24"	"67.79"
"67554"	"False"	"High"	"[K].VKEGMNIVEAMER.[F]"	"1xBiotin [K2]"	"0.0304135"	"0.0007621"	"1"	"1"	"2"	"P17742"	"P17742 [132-144]"	"P17742 1xBiotin [K133]"	"1"	"1731.82266"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002039"	"2.31"	""
"17848"	"False"	"High"	"[R].FLIKEDVR.[D]"	"1xBiotin [K4]"	"0.0107541"	"0.0007621"	"1"	"1"	"5"	"Q921R4"	"Q921R4 [202-209]"	"Q921R4 1xBiotin [K205]"	"1"	"1245.66600"	"0.272"	"0.855"	"0.925138005747468"	"0.906515362333117"	"34.68"	"52.30"	"137.6"	"37.7"	"124.7"	"24.20"	"34.90"	"57.42"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007794"	"2.48"	"45.08"
"17711"	"False"	"High"	"[K].FLDGIYVSEK.[G]"	""	"0.0217098"	"0.0007621"	"1"	"1"	"4"	"P51410"	"P51410 [175-184]"	""	"0"	"1170.60412"	"123.210"	"1.945"	"0.911117679842347"	"0.975028610040254"	"64.81"	"86.59"	"2.4"	"291.7"	"6.0"	"59.42"	"36.37"	"55.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.000628"	"0.00148"	"2.72"	"42.45"
"39158"	"False"	"High"	"[K].LVIKNQQFHK.[E]"	"1xBiotin [K4]"	"0.0240982"	"0.0007621"	"1"	"1"	"3"	"Q99K48"	"Q99K48 [242-251]"	"Q99K48 1xBiotin [K245]"	"1"	"1480.80931"	"0.173"	"0.684"	"0.925138005747468"	"0.906515362333117"	"68.23"	"69.68"	"153.5"	"27.0"	"119.5"	"62.35"	"32.52"	"47.11"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001626"	"2.19"	"35.46"
"39137"	"False"	"High"	"[R].LVLCKTYR.[L]"	"1xBiotin [K5]; 1xCarbamidomethyl [C4]"	"0.0117976"	"0.0007621"	"1"	"1"	"10"	"Q8VCZ6"	"Q8VCZ6 [611-618]"	"Q8VCZ6 1xBiotin [K615]"	"1"	"1278.66971"	"0.294"	"0.875"	"0.47240665661602"	"0.906515362333117"	"44.53"	"86.94"	"146.7"	"41.5"	"111.9"	"59.61"	"13.62"	"59.35"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008501"	"2.27"	"41.79"
"17752"	"False"	"High"	"[R].FLFLLLGPAGK.[A]"	""	"0.00676582"	"0.0007621"	"1"	"2"	"5"	"Q8BTY2"	"Q8BTY2 [335-345]"	""	"0"	"1175.71869"	"75.895"	"2.080"	"0.925138005747468"	"0.915242122105656"	"58.07"	"66.67"	"3.0"	"289.3"	"7.7"	"59.30"	"30.16"	"38.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005127"	"1.73"	"62.31"
"67508"	"False"	"High"	"[K].VHVIFNYK.[G]"	""	"0.00620485"	"0.0007621"	"1"	"1"	"12"	"P14211"	"P14211 [144-151]"	""	"0"	"1019.56728"	"149.313"	"3.588"	"0.925138005747468"	"0.906515362333117"	"74.60"	"66.22"	"2.4"	"289.3"	"8.3"	"65.69"	"42.78"	"31.45"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004739"	"2.34"	"33.15"
"39067"	"False"	"High"	"[K].IVFADGNFWGR.[T]"	""	"0.0042288"	"0.0007621"	"1"	"1"	"9"	"P29758"	"P29758 [170-180]"	""	"0"	"1281.63748"	"161.715"	"3.954"	"0.925138005747468"	"0.906515362333117"	"51.53"	"48.77"	"2.0"	"289.4"	"8.6"	"41.23"	"38.77"	"14.83"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003342"	"2.34"	"51.25"
"39046"	"False"	"High"	"[R].LVEIDNGKQR.[E]"	"1xBiotin [K8]"	"0.00395065"	"0.0007621"	"1"	"3"	"9"	"P48678-1"	"P48678-1 [226-235]"	"P48678-1 1xBiotin [K233]"	"1"	"1397.72056"	"0.224"	"0.584"	"0.925138005747468"	"0.906515362333117"	"78.67"	"112.07"	"172.8"	"44.7"	"82.5"	"60.50"	"47.97"	"105.09"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003143"	"2.93"	"34.87"
"2685"	"False"	"High"	"[K].AIVLQKTIDYIQFLHK.[E]"	"1xBiotin [K6]"	"0.00355631"	"0.0007621"	"1"	"3"	"3"	"O08609"	"O08609 [174-189]"	"O08609 1xBiotin [K179]"	"1"	"2156.19364"	"1.288"	"1.685"	"0.925138005747468"	"0.935866453494337"	"63.78"	"58.86"	"77.9"	"85.8"	"136.3"	"47.68"	"32.56"	"29.01"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000284"	"2.96"	"61.63"
"17756"	"False"	"High"	"[R].FLFSLFGQK.[H]"	""	"0.00357838"	"0.0007621"	"1"	"1"	"28"	"Q8R010"	"Q8R010 [216-224]"	""	"0"	"1086.59824"	"127.440"	"2.891"	"0.925138005747468"	"0.906515362333117"	"60.93"	"45.91"	"2.6"	"290.2"	"7.2"	"35.25"	"49.07"	"21.45"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002862"	"2.46"	"59.02"
"38937"	"False"	"High"	"[K].ITVVGVGAVGMACAISILMK.[D]"	"1xCarbamidomethyl [C13]; 1xOxidation [M19]"	"0.0181637"	"0.0007621"	"1"	"1"	"1"	"P06151"	"P06151 [23-42]"	""	"0"	"2006.08469"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001252"	"2.53"	""
"17768"	"False"	"High"	"[R].FLGGLVKGK.[S]"	"1xBiotin [K]"	"0.0144613"	"0.0007621"	"1"	"2"	"6"	"Q3U7R1"	"Q3U7R1 [652-660]"	"Q3U7R1 1xBiotin [K]"	"1"	"1144.65471"	"0.202"	"0.848"	"0.925138005747468"	"0.906515362333117"	"52.14"	"24.23"	"143.3"	"35.1"	"121.6"	"44.47"	"33.87"	"4.96"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0003479"	"0.001018"	"2.16"	"45.73"
"17781"	"False"	"High"	"[R].FLGSGGFIGYAPSLSK.[L]"	""	"0.00664149"	"0.0007621"	"1"	"1"	"4"	"Q9R0E2"	"Q9R0E2 [152-167]"	""	"0"	"1600.83697"	"5.907"	"0.911"	"0.952905080717326"	""	"241.73"	"48.36"	"38.3"	"226.6"	"35.1"	"32.15"	"123.57"	"33.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005044"	"2.40"	"51.27"
"38904"	"False"	"High"	"[K].LTTPTYGDLNHLVSATMSGVTTCLR.[F]"	"1xCarbamidomethyl [C23]; 1xOxidation [M17]"	"0.00639965"	"0.0007621"	"3"	"5"	"6"	"Q7TMM9; Q9D6F9; P99024"	"Q7TMM9 [217-241]; Q9D6F9 [217-241]; P99024 [217-241]"	""	"0"	"2724.33313"	"9.692"	"1.410"	"0.999791625166089"	"0.929126568169679"	"226.29"	"97.03"	"23.5"	"242.9"	"33.6"	"43.17"	"116.84"	"101.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"0.0002502"	"0.0004888"	"3.37"	"53.48"
"17824"	"False"	"High"	"[R].FLKNIGWGTDQGIGGFGEEPGIK.[S]"	"1xBiotin [K3]"	"0.00330187"	"0.0007621"	"1"	"1"	"6"	"Q9CR20"	"Q9CR20 [27-49]"	"Q9CR20 1xBiotin [K29]"	"1"	"2646.30208"	"0.769"	"1.686"	"0.925138005747468"	"0.948812631860987"	"59.29"	"96.51"	"90.0"	"58.2"	"151.8"	"34.80"	"41.82"	"66.68"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002656"	"3.55"	"58.95"
"17844"	"False"	"High"	"[K].FLLGYFPWDSTK.[E]"	""	"0.00702147"	"0.0007621"	"1"	"1"	"5"	"Q9CXF4"	"Q9CXF4 [341-352]"	""	"0"	"1473.74128"	"68.326"	"0.985"	"0.925138005747468"	"0.906515362333117"	"51.10"	"48.39"	"5.0"	"290.4"	"4.6"	"32.94"	"39.14"	"40.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0005316"	"2.48"	"61.63"
"2445"	"False"	"High"	"[K].AINFNFGYAK.[A]"	""	"0.0222498"	"0.0007621"	"1"	"1"	"2"	"Q8BML9"	"Q8BML9 [283-292]"	""	"0"	"1144.57857"	"94.702"	"1.780"	"0.444204574430925"	"0.939158492962313"	"54.62"	"28.72"	"2.9"	"292.0"	"5.1"	"36.28"	"60.10"	"22.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001512"	"1.95"	"45.06"
"38938"	"False"	"High"	"[K].ITVVGVGAVGMACAISILMK.[D]"	"1xCarbamidomethyl [C13]; 2xOxidation [M11; M19]"	"0.0061286"	"0.0007621"	"1"	"1"	"2"	"P06151"	"P06151 [23-42]"	""	"0"	"2022.07960"	"0.830"	"0.745"	"0.925138005747468"	""	"74.84"	"59.08"	"117.5"	"99.0"	"83.5"	"29.21"	"238.89"	"44.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.0004697"	"3.03"	"56.29"
"39681"	"False"	"High"	"[K].LYNLFLK.[Y]"	""	"0.0222498"	"0.0007621"	"1"	"1"	"7"	"Q9Z2I9"	"Q9Z2I9 [243-249]"	""	"0"	"910.53967"	"143.317"	"3.637"	"0.925138005747468"	"0.906515362333117"	"55.30"	"64.82"	"1.9"	"291.0"	"7.0"	"47.63"	"26.29"	"39.86"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001509"	"1.89"	"47.88"
"39682"	"False"	"High"	"[K].LYNLLLLR.[M]"	""	"0.0267456"	"0.0007621"	"1"	"3"	"3"	"Q8R5H1-1"	"Q8R5H1-1 [606-613]"	""	"0"	"1017.64553"	"155.526"	"2.265"	"0.428314351768477"	"0.950056859071916"	"59.02"	"81.56"	"1.8"	"294.1"	"4.2"	"40.75"	"57.35"	"68.59"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001795"	"1.78"	"54.55"
"2711"	"False"	"High"	"[K].ALWFQGR.[C]"	""	"0.0331284"	"0.0007621"	"1"	"1"	"17"	"Q8K310"	"Q8K310 [556-562]"	""	"0"	"877.46790"	"107.415"	"4.592"	"0.931513090357645"	"0.906515362333117"	"97.27"	"90.27"	"2.1"	"286.3"	"11.6"	"75.84"	"49.64"	"29.30"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002214"	"1.92"	"42.18"
"43521"	"False"	"High"	"[R-].MGCVKSR.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]; 1xOxidation [M1]"	"0.0251555"	"0.0007621"	"1"	"2"	"7"	"P08103-1"	"P08103-1 [22-28]"	"P08103-1 1xBiotin [K26]"	"1"	"1079.47947"	"0.266"	"0.648"	"0.925138005747468"	"0.906515362333117"	"54.36"	"59.07"	"141.8"	"43.1"	"115.1"	"43.10"	"23.23"	"32.54"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001692"	"1.93"	"21.59"
"43520"	"False"	"High"	"[R-].MGCVKSR.[F]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.027409"	"0.0007621"	"1"	"2"	"7"	"P08103-1"	"P08103-1 [22-28]"	"P08103-1 1xBiotin [K26]"	"1"	"1063.48455"	"0.311"	"0.814"	"0.925138005747468"	"0.906515362333117"	"40.43"	"54.96"	"143.8"	"47.0"	"109.2"	"18.83"	"37.06"	"56.22"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001838"	"2.23"	"26.21"
"43411"	"False"	"High"	"[K].MFVGGLSWDTSK.[K]"	"1xOxidation [M1]"	"0.0126262"	"0.0007621"	"1"	"1"	"5"	"Q99020"	"Q99020 [77-88]"	""	"0"	"1343.63001"	"86.451"	"1.001"	"0.452844787848141"	""	"79.38"	"60.62"	"3.5"	"293.1"	"3.3"	"39.33"	"68.29"	"46.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009046"	"2.85"	"43.51"
"67111"	"False"	"High"	"[R].VFGFSLITNK.[V]"	""	"0.00312306"	"0.0007621"	"1"	"1"	"8"	"P23492"	"P23492 [235-244]"	""	"0"	"1125.63027"	"131.860"	"3.552"	"0.925138005747468"	"0.906515362333117"	"40.00"	"27.51"	"2.3"	"289.6"	"8.1"	"23.71"	"28.94"	"14.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002524"	"2.29"	"52.27"
"43313"	"False"	"High"	"[K].MFNYAGWK.[N]"	"1xOxidation [M1]"	"0.0181637"	"0.0007621"	"1"	"1"	"5"	"Q924Z4"	"Q924Z4 [251-258]"	""	"0"	"1032.46076"	"394.669"	"5.968"	"0.925138005747468"	"0.906515362333117"	"67.94"	"65.39"	"0.8"	"294.6"	"4.6"	"64.69"	"31.91"	"29.29"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001254"	"2.23"	"38.21"
"43312"	"False"	"High"	"[K].MFNYAGWK.[N]"	""	"0.0131024"	"0.0007621"	"1"	"1"	"3"	"Q924Z4"	"Q924Z4 [251-258]"	""	"0"	"1016.46585"	"30.510"	"6.943"	"0.761043863563627"	"0.906515362333117"	"147.03"	"42.76"	"8.2"	"242.4"	"49.4"	"38.26"	"113.43"	"20.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0003479"	"0.000933"	"2.25"	"42.18"
"67112"	"False"	"High"	"[K].VFGWVHR.[L]"	""	"0.0226635"	"0.0007621"	"1"	"1"	"18"	"Q8BP47"	"Q8BP47 [141-147]"	""	"0"	"900.48388"	"89.627"	"1.971"	"0.962827962014213"	"0.913565512658592"	"49.80"	"29.39"	"3.3"	"289.8"	"6.9"	"41.79"	"46.59"	"12.61"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001539"	"1.82"	"34.23"
"43297"	"False"	"High"	"[-].MFLVNSFLK.[G]"	"1xAcetyl [N-Term]"	"0.00944602"	"0.0007621"	"1"	"1"	"4"	"O88456"	"O88456 [1-9]"	"O88456 1xAcetyl [N-Term]"	"0"	"1140.61218"	"1.121"	"1.183"	"0.925138005747468"	"0.906515362333117"	"95.51"	"68.55"	"86.1"	"116.1"	"97.9"	"51.98"	"205.95"	"38.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006952"	"2.36"	"68.85"
"67123"	"False"	"High"	"[K].VFLDFFTYAPPKPR.[S]"	""	"0.0280885"	"0.0007621"	"1"	"1"	"3"	"Q8BKS9"	"Q8BKS9 [330-343]"	""	"0"	"1697.90499"	"67.208"	"1.670"	"0.925138005747468"	"0.963164873258715"	"62.47"	"67.38"	"4.7"	"288.7"	"6.6"	"47.92"	"31.61"	"125.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001887"	"2.17"	"56.10"
"43248"	"False"	"High"	"[R].MFGTYFR.[V]"	"1xOxidation [M1]"	"0.0190803"	"0.0007621"	"2"	"3"	"23"	"Q8C147; Q8R1A4"	"Q8C147 [1791-1797]; Q8R1A4 [1828-1834]"	""	"0"	"937.42365"	"327.858"	"4.049"	"0.925138005747468"	"0.906515362333117"	"47.59"	"61.61"	"0.9"	"295.7"	"3.4"	"40.30"	"32.36"	"51.02"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001316"	"2.15"	"37.16"
"67130"	"False"	"High"	"[K].VFLENVIR.[D]"	""	"0.0307875"	"0.0007621"	"1"	"1"	"3"	"P62806"	"P62806 [61-68]"	""	"0"	"989.57784"	"109.272"	"1.958"	"0.962122454074805"	"0.981281916820826"	"74.98"	"88.26"	"2.0"	"293.4"	"4.6"	"57.32"	"38.07"	"59.29"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006486"	"0.002061"	"1.74"	"44.33"
"42294"	"False"	"High"	"[K].MDVTEEISGLWK.[Q]"	""	"0.0082966"	"0.0007621"	"1"	"2"	"1"	"E9PVX6"	"E9PVX6 [1610-1621]"	""	"0"	"1407.68244"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006168"	"2.83"	""
"67134"	"False"	"High"	"[K].VFLIFLGSSVR.[W]"	""	"0.00342673"	"0.0007621"	"1"	"3"	"5"	"Q5SUQ9-1"	"Q5SUQ9-1 [791-801]"	""	"0"	"1237.73032"	"59.538"	"0.953"	"0.925138005747468"	"0.906515362333117"	"50.98"	"41.76"	"5.0"	"290.4"	"4.6"	"45.80"	"36.44"	"52.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002745"	"2.30"	"59.76"
"41845"	"False"	"High"	"[-].MDDDIAALVVDNGSGMCK.[A]"	"1xCarbamidomethyl [C17]; 1xOxidation [M16]; 1xMet-loss+Acetyl [N-Term]"	"0.0337404"	"0.0007621"	"1"	"1"	"1"	"P60710"	"P60710 [1-18]"	"P60710 1xMet-loss+Acetyl [N-Term]"	"0"	"1837.79425"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000686"	"0.002263"	"2.33"	""
"41722"	"False"	"High"	"[K].MCLFAGFQR.[K]"	"1xCarbamidomethyl [C2]"	"0.00366802"	"0.0007621"	"1"	"2"	"19"	"Q8VEK3"	"Q8VEK3 [569-577]"	""	"0"	"1129.52813"	"46.829"	"3.954"	"0.929016530787821"	"0.906515362333117"	"70.55"	"63.87"	"5.5"	"270.7"	"23.8"	"46.14"	"60.58"	"43.37"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002927"	"2.65"	"48.76"
"2834"	"False"	"High"	"[K].AMLIMTMLLAK.[K]"	""	"0.00845184"	"0.0007621"	"1"	"1"	"4"	"P70444"	"P70444 [147-157]"	""	"0"	"1235.69242"	"6.532"	"1.435"	"0.994201151226993"	"0.906515362333117"	"141.87"	"59.84"	"35.2"	"210.3"	"54.5"	"40.53"	"114.69"	"40.24"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006269"	"2.31"	"63.64"
"17313"	"False"	"High"	"[K].FFVGGNWK.[M]"	""	"0.0239508"	"0.0007621"	"1"	"1"	"43"	"P17751"	"P17751 [57-64]"	""	"0"	"954.48321"	"125.589"	"5.247"	"0.925138005747468"	"0.906515362333117"	"60.40"	"53.86"	"2.3"	"287.3"	"10.4"	"42.11"	"45.73"	"49.73"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001621"	"2.04"	"42.23"
"17308"	"False"	"High"	"[R].FFTAMFPFEK.[N]"	"1xOxidation [M5]"	"0.00378324"	"0.0007621"	"1"	"2"	"1"	"P05555-1"	"P05555-1 [759-768]"	""	"0"	"1280.60201"	"10.400"	"0.983"	"0.925138005747468"	""	"217.67"	"55.00"	"26.7"	"246.4"	"27.0"	"38.73"	"105.99"	"40.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003019"	"2.06"	"52.85"
"2856"	"False"	"High"	"[R].AMPSEFTSAKLR.[S]"	"1xBiotin [K10]"	"0.00246872"	"0.0007621"	"1"	"1"	"5"	"O88829"	"O88829 [27-38]"	"O88829 1xBiotin [K36]"	"1"	"1563.76580"	"0.284"	"1.036"	"0.925138005747468"	"0.929117268927915"	"34.50"	"37.09"	"126.4"	"35.1"	"138.4"	"50.39"	"39.03"	"24.11"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002024"	"2.64"	"45.25"
"17203"	"False"	"High"	"[K].FEIPLKIR.[L]"	"1xBiotin [K6]"	"0.0194357"	"0.0007621"	"1"	"1"	"2"	"Q9CZW4"	"Q9CZW4 [674-681]"	"Q9CZW4 1xBiotin [K679]"	"1"	"1241.70748"	"0.761"	"0.704"	"0.925138005747468"	"0.906515362333117"	"83.89"	"82.66"	"107.0"	"97.2"	"95.8"	"118.17"	"44.26"	"46.27"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001334"	"1.79"	"54.60"
"44931"	"False"	"High"	"[-].MLFYSFFK.[S]"	"1xOxidation [M1]"	"0.00487524"	"0.0007621"	"1"	"1"	"44"	"O35900"	"O35900 [1-8]"	""	"0"	"1098.53287"	"166.953"	"2.096"	"0.925138005747468"	"0.906515362333117"	"57.34"	"61.27"	"1.9"	"294.1"	"4.0"	"50.32"	"29.61"	"35.19"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003797"	"2.65"	"54.83"
"44930"	"False"	"High"	"[-].MLFYSFFK.[S]"	""	"0.00660056"	"0.0007621"	"1"	"1"	"18"	"O35900"	"O35900 [1-8]"	""	"0"	"1082.53795"	"36.381"	"2.328"	"0.925138005747468"	"0.906515362333117"	"62.32"	"48.40"	"8.3"	"270.7"	"21.0"	"31.72"	"57.37"	"36.35"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005008"	"2.07"	"59.22"
"66831"	"False"	"High"	"[K].VDPEIQNVK.[S]"	""	"0.0188469"	"0.0007621"	"1"	"1"	"3"	"Q3TTY5"	"Q3TTY5 [188-196]"	""	"0"	"1041.55750"	"70.894"	"0.601"	"0.98927749808913"	"0.906515362333117"	"99.46"	"89.76"	"4.1"	"293.6"	"2.3"	"71.01"	"140.99"	"82.83"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001298"	"2.17"	"24.13"
"17251"	"False"	"High"	"[K].FFEVILIDPFHK.[A]"	""	"0.00286394"	"0.0007621"	"1"	"1"	"2"	"Q9CZM2"	"Q9CZM2 [129-140]"	""	"0"	"1504.81986"	"44.490"	"2.489"	"0.925138005747468"	"0.937072062058245"	"44.22"	"57.78"	"6.6"	"277.0"	"16.4"	"19.63"	"37.99"	"67.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002334"	"3.03"	"61.02"
"44564"	"False"	"High"	"[-].MKPKLMYQELK.[V]"	"1xBiotin [K4]; 1xOxidation [M]"	"0.0298607"	"0.0007621"	"1"	"1"	"2"	"O35405"	"O35405 [1-11]"	"O35405 1xBiotin [K4]"	"1"	"1650.84160"	"0.999"	"1.000"	"0.925138005747468"	"0.906515362333117"	"31.67"	"54.60"	"96.2"	"99.7"	"104.1"	"23.07"	"20.99"	"43.28"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006486"	"0.002001"	"3.30"	"39.50"
"17254"	"False"	"High"	"[R].FFFNLGVK.[A]"	""	"0.019198"	"0.0007621"	"1"	"1"	"9"	"B2RRE7"	"B2RRE7 [696-703]"	""	"0"	"971.53491"	"127.148"	"4.335"	"0.925138005747468"	"0.906515362333117"	"47.55"	"52.89"	"2.2"	"287.1"	"10.7"	"35.81"	"38.28"	"39.51"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001319"	"1.76"	"53.97"
"17409"	"False"	"High"	"[K].FGKQWTPLIILANSR.[S]"	"1xBiotin [K3]"	"0.00478562"	"0.0007621"	"1"	"1"	"5"	"Q9R1C6"	"Q9R1C6 [210-224]"	"Q9R1C6 1xBiotin [K212]"	"1"	"1970.06805"	"0.892"	"1.323"	"0.925138005747468"	"0.906515362333117"	"62.13"	"29.96"	"94.1"	"74.3"	"131.6"	"30.25"	"48.24"	"20.04"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003741"	"3.06"	"64.00"
"17255"	"False"	"High"	"[K].FFFSNQGR.[V]"	""	"0.0341544"	"0.0007621"	"1"	"1"	"2"	"Q9CWX2"	"Q9CWX2 [260-267]"	""	"0"	"1002.47919"	"212.027"	"4.159"	"0.581586540779411"	"0.906515362333117"	"41.98"	"81.59"	"1.3"	"291.7"	"7.0"	"29.04"	"41.31"	"75.59"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002282"	"1.66"	"38.33"
"17275"	"False"	"High"	"[K].FFLSHPAYR.[H]"	""	"0.00279393"	"0.0007621"	"1"	"4"	"11"	"P39054-1"	"P39054-1 [258-266]"	""	"0"	"1137.58399"	"221.385"	"6.200"	"0.925138005747468"	"0.906515362333117"	"45.68"	"46.53"	"1.2"	"290.3"	"8.5"	"35.92"	"40.91"	"38.91"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002278"	"2.30"	"35.25"
"44414"	"False"	"High"	"[-].MKHYEVEIR.[D]"	"1xBiotin [K2]"	"0.00866334"	"0.0007621"	"1"	"1"	"1"	"Q9CY27"	"Q9CY27 [1-9]"	"Q9CY27 1xBiotin [K2]"	"1"	"1430.69190"	"0.256"	"0.808"	"0.925138005747468"	"0.906515362333117"	"35.70"	"21.42"	"145.4"	"40.2"	"114.3"	"22.95"	"25.92"	"17.78"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006403"	"2.94"	"37.28"
"17284"	"False"	"High"	"[K].FFNIPFLQLQR.[E]"	""	"0.0127044"	"0.0007621"	"1"	"1"	"4"	"Q5U3K5"	"Q5U3K5 [226-236]"	""	"0"	"1422.78923"	"62.775"	"2.403"	"0.925138005747468"	"0.929117268927915"	"65.20"	"68.49"	"4.5"	"284.4"	"11.2"	"42.80"	"48.89"	"48.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.0009071"	"2.22"	"63.41"
"17286"	"False"	"High"	"[R].FFNYVPSGIR.[C]"	""	"0.00639965"	"0.0007621"	"1"	"1"	"11"	"Q8R2N2"	"Q8R2N2 [11-20]"	""	"0"	"1199.62077"	"171.047"	"3.296"	"0.341221730163315"	"0.906515362333117"	"49.74"	"40.65"	"1.8"	"292.8"	"5.4"	"49.48"	"24.63"	"19.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004862"	"2.33"	"44.95"
"66903"	"False"	"High"	"[K].VEALTYKK.[A]"	"1xBiotin [K]"	"0.0343633"	"0.0007621"	"1"	"1"	"8"	"Q9CY18"	"Q9CY18 [299-306]"	"Q9CY18 1xBiotin [K]"	"1"	"1177.62856"	"0.134"	"0.965"	"0.925138005747468"	"0.909223670800027"	"59.15"	"58.96"	"144.3"	"19.7"	"136.0"	"22.04"	"51.83"	"45.16"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000686"	"0.002292"	"2.43"	"36.24"
"2857"	"False"	"High"	"[R].AMPSEFTSAKLR.[S]"	"1xBiotin [K10]; 1xOxidation [M2]"	"0.00404962"	"0.0007621"	"1"	"1"	"5"	"O88829"	"O88829 [27-38]"	"O88829 1xBiotin [K36]"	"1"	"1579.76071"	"0.372"	"0.736"	"0.035579145790797"	"0.906515362333117"	"102.35"	"106.08"	"132.9"	"39.0"	"128.1"	"78.16"	"35.10"	"64.34"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003199"	"2.40"	"41.07"
"44208"	"False"	"High"	"[-].MHPPEATTKMSSVR.[F]"	"1xAcetyl [N-Term]; 1xBiotin [K9]"	"0.00639965"	"0.0007621"	"1"	"1"	"11"	"Q924N4"	"Q924N4 [1-14]"	"Q924N4 1xAcetyl [N-Term]; 1xBiotin [K9]"	"1"	"1839.85502"	"0.261"	"0.774"	"0.925138005747468"	"0.906515362333117"	"39.58"	"93.56"	"155.0"	"39.3"	"105.6"	"29.86"	"28.07"	"97.53"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004865"	"2.62"	"42.25"
"2944"	"False"	"High"	"[K].ANFWYQPSFHGVDLSALR.[G]"	""	"0.0242465"	"0.0007621"	"1"	"2"	"3"	"Q9WVG6-1"	"Q9WVG6-1 [311-328]"	""	"0"	"2108.03483"	"1.990"	"1.541"	"0.925138005747468"	""	"92.37"	"80.90"	"55.6"	"144.0"	"100.4"	"67.95"	"198.95"	"27.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001634"	"2.04"	"56.08"
"45070"	"False"	"High"	"[K].MLLFAFANALAQAR.[L]"	""	"0.0082966"	"0.0007621"	"1"	"1"	"1"	"Q921S7"	"Q921S7 [313-326]"	""	"0"	"1536.83553"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0006169"	"2.17"	""
"41612"	"False"	"High"	"[K].MAVTFIGNSTAIQELFKR.[I]"	""	"0.0345735"	"0.0007621"	"1"	"1"	"2"	"P99024"	"P99024 [363-380]"	""	"1"	"2026.07901"	"1.183"	"1.341"	"0.925138005747468"	"0.906515362333117"	"56.56"	"42.31"	"87.6"	"93.7"	"118.7"	"33.76"	"208.06"	"29.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.000686"	"0.002315"	"3.63"	"58.56"
"17443"	"False"	"High"	"[K].FGLYLPLFKPSASTSK.[V]"	""	"0.0052508"	"0.0007621"	"1"	"1"	"6"	"Q9QXX4"	"Q9QXX4 [655-670]"	""	"0"	"1755.96798"	"116.563"	"2.292"	"0.461454191032477"	"0.935866453494337"	"52.66"	"56.03"	"2.8"	"289.9"	"7.3"	"42.40"	"27.20"	"33.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0004075"	"2.74"	"56.16"
"40139"	"False"	"High"	"[K].MAATFIGNSTAIQELFK.[R]"	"1xOxidation [M1]"	"0.00974232"	"0.0007621"	"1"	"1"	"2"	"Q9D6F9"	"Q9D6F9 [363-379]"	""	"0"	"1857.94151"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007152"	"2.37"	""
"39865"	"False"	"High"	"[-].MAAAPPLTKAEYLK.[R]"	"1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"0.0352115"	"0.0007621"	"1"	"2"	"11"	"Q8R149"	"Q8R149 [1-14]"	"Q8R149 1xBiotin [K9]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1640.87164"	"0.183"	"0.780"	"0.925138005747468"	"0.906515362333117"	"55.63"	"57.87"	"153.4"	"26.8"	"119.7"	"41.34"	"40.84"	"38.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.000686"	"0.002353"	"2.75"	"54.10"
"17493"	"False"	"High"	"[K].FGTSVLSYFSFLR.[W]"	""	"0.0317425"	"0.0007621"	"1"	"2"	"4"	"Q32NZ6-1"	"Q32NZ6-1 [404-416]"	""	"0"	"1523.78929"	"4.617"	"2.585"	"0.950889694496892"	"0.913702580837398"	"135.81"	"82.07"	"49.0"	"135.7"	"115.3"	"32.79"	"131.29"	"65.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002118"	"2.38"	"63.94"
"17499"	"False"	"High"	"[K].FGVIFAGAQK.[N]"	""	"0.0277467"	"0.0007621"	"1"	"1"	"1"	"Q99K85"	"Q99K85 [191-200]"	""	"0"	"1037.57784"	"134.548"	"2.605"	"0.929016530787821"	"0.916215054610739"	"56.01"	"44.36"	"2.1"	"292.4"	"5.5"	"66.78"	"49.47"	"23.45"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001863"	"1.80"	"41.32"
"67173"	"False"	"High"	"[K].VFQFLNAK.[C]"	""	"0.0138503"	"0.0007621"	"1"	"1"	"29"	"Q8BP67"	"Q8BP67 [28-35]"	""	"0"	"966.54073"	"146.445"	"4.126"	"0.925138005747468"	"0.906515362333117"	"63.34"	"71.51"	"1.9"	"291.6"	"6.5"	"55.79"	"26.50"	"56.49"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009808"	"1.99"	"42.74"
"39751"	"False"	"High"	"[K].LYTVDYLSNMVGGR.[K]"	""	"0.0313571"	"0.0007621"	"1"	"1"	"2"	"Q8R016"	"Q8R016 [283-296]"	""	"0"	"1587.78355"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0006486"	"0.002096"	"2.44"	""
"17505"	"False"	"High"	"[K].FGVVVVGVGR.[A]"	""	"0.0286091"	"0.0007621"	"1"	"1"	"5"	"Q9CY64"	"Q9CY64 [9-18]"	""	"0"	"988.59383"	"82.688"	"1.556"	"0.693247756009836"	"0.916215054610739"	"46.11"	"52.08"	"3.3"	"291.9"	"4.8"	"33.66"	"39.91"	"41.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.001922"	"2.33"	"40.81"
"67175"	"False"	"High"	"[R].VFQGFFTGR.[G]"	""	"0.0311661"	"0.0007621"	"1"	"1"	"2"	"P97329"	"P97329 [466-474]"	""	"0"	"1058.54179"	"135.960"	"3.489"	"0.339573869323658"	"0.906515362333117"	"58.52"	"61.05"	"1.8"	"291.2"	"7.0"	"44.50"	"44.17"	"43.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.002089"	"1.75"	"45.18"
"39726"	"False"	"High"	"[K].LYSLSVLYK.[G]"	""	"0.0168701"	"0.0007621"	"1"	"1"	"4"	"Q9CQW1"	"Q9CQW1 [3-11]"	""	"0"	"1085.62412"	"60.227"	"1.083"	"0.556403604815838"	"0.906515362333117"	"51.75"	"71.56"	"5.3"	"289.4"	"5.3"	"36.71"	"34.99"	"73.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0005064"	"0.001172"	"1.78"	"46.93"
"39725"	"False"	"High"	"[R].LYSLLFR.[R]"	""	"0.0171846"	"0.0007621"	"1"	"1"	"22"	"Q8R1I1"	"Q8R1I1 [10-16]"	""	"0"	"911.53491"	"112.683"	"3.176"	"0.927764216800857"	"0.906515362333117"	"55.09"	"51.81"	"2.6"	"289.0"	"8.4"	"41.60"	"19.26"	"26.98"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001191"	"1.98"	"49.23"
"17513"	"False"	"High"	"[R].FHALGPIYYR.[D]"	""	"0.0101101"	"0.0007621"	"1"	"1"	"4"	"P35282"	"P35282 [79-88]"	""	"0"	"1236.65240"	"281.622"	"6.140"	"0.925138005747468"	"0.906515362333117"	"54.41"	"68.14"	"1.1"	"291.1"	"7.8"	"54.75"	"37.67"	"40.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.000736"	"2.66"	"39.09"
"39712"	"False"	"High"	"[R].LYQTDPSGTYHAWK.[A]"	""	"0.0152863"	"0.0007621"	"1"	"2"	"2"	"Q9Z2U0"	"Q9Z2U0 [144-157]"	""	"0"	"1666.78600"	"98.451"	"3.322"	"0.454924058924831"	"0.906515362333117"	"41.09"	"74.00"	"3.2"	"286.6"	"10.1"	"35.28"	"28.93"	"58.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0004044"	"0.00107"	"2.80"	"32.47"
"39698"	"False"	"High"	"[K].IYPTIWWLFR.[D]"	""	"0.00316194"	"0.0007621"	"1"	"2"	"11"	"Q00612"	"Q00612 [48-57]"	""	"0"	"1394.76195"	"225.340"	"7.826"	"0.925138005747468"	"0.906515362333117"	"62.25"	"60.10"	"1.1"	"290.5"	"8.4"	"54.62"	"36.66"	"70.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002556"	"2.59"	"67.45"
"39697"	"False"	"High"	"[R].IYPTFLHLHGK.[T]"	""	"0.00548308"	"0.0007621"	"1"	"2"	"9"	"Q08943"	"Q08943 [218-228]"	""	"0"	"1325.73647"	"159.058"	"4.053"	"0.925138005747468"	"0.906515362333117"	"66.81"	"58.76"	"1.8"	"290.6"	"7.6"	"52.07"	"39.70"	"28.84"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0004229"	"2.52"	"38.18"
"67184"	"False"	"High"	"[R].VFSKFPIK.[D]"	"1xBiotin [K4]"	"0.0190803"	"0.0007621"	"1"	"3"	"9"	"P06800"	"P06800 [650-657]"	"P06800 1xBiotin [K653]"	"1"	"1191.65946"	"0.235"	"0.832"	"0.925138005747468"	"0.906515362333117"	"64.27"	"34.83"	"144.6"	"36.8"	"118.6"	"50.07"	"40.77"	"70.38"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001313"	"2.21"	"48.57"
"67157"	"False"	"High"	"[K].VFNLYPR.[K]"	""	"0.0253102"	"0.0007621"	"1"	"1"	"21"	"O08553"	"O08553 [391-397]"	""	"0"	"908.49886"	"128.508"	"5.923"	"0.925138005747468"	"0.906515362333117"	"60.77"	"78.90"	"2.6"	"283.0"	"14.5"	"57.83"	"69.02"	"55.59"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001707"	"2.01"	"39.22"
"40393"	"False"	"High"	"[-].MAEGKAGGAAGLFAK.[Q]"	"1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"0.0302281"	"0.0007621"	"1"	"1"	"1"	"D3Z6Q9"	"D3Z6Q9 [1-15]"	"D3Z6Q9 1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1515.76242"	"0.263"	"0.871"	"0.925138005747468"	"0.906515362333117"	"27.93"	"29.57"	"139.1"	"36.7"	"124.2"	"20.79"	"20.60"	"40.69"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002021"	"2.02"	"49.75"
"40437"	"False"	"High"	"[-].MAENGKNCDQR.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C8]; 1xMet-loss+Acetyl [N-Term]"	"0.00286394"	"0.0007621"	"1"	"1"	"22"	"Q99KU0"	"Q99KU0 [1-11]"	"Q99KU0 1xBiotin [K6]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1459.60527"	"5.054"	"0.880"	"0.430383505746853"	"0.906515362333117"	"143.84"	"54.01"	"43.5"	"219.8"	"36.7"	"39.43"	"88.08"	"33.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002321"	"2.86"	"25.85"
"67155"	"False"	"High"	"[K].VFNHCLTGSGVIDWLVSNK.[L]"	"1xCarbamidomethyl [C5]"	"0.00515428"	"0.0007621"	"1"	"1"	"1"	"Q9JHK5"	"Q9JHK5 [151-169]"	""	"0"	"2146.07498"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004"	"2.92"	""
"17449"	"False"	"High"	"[R].FGNAFLNR.[F]"	""	"0.02578"	"0.0007621"	"1"	"1"	"1"	"Q9EQP2"	"Q9EQP2 [131-138]"	""	"0"	"938.48428"	"190.281"	"5.846"	"0.925138005747468"	"0.906515362333117"	"55.58"	"67.97"	"1.6"	"291.0"	"7.4"	"35.43"	"81.21"	"70.57"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.00174"	"1.94"	"36.18"
"67139"	"False"	"High"	"[R].VFLPNKQR.[T]"	"1xBiotin [K6]"	"0.031937"	"0.0007621"	"1"	"3"	"13"	"P28028-1"	"P28028-1 [143-150]"	"P28028-1 1xBiotin [K148]"	"1"	"1227.66667"	"0.071"	"0.878"	"0.00377588650983478"	"0.906515362333117"	"61.29"	"30.66"	"150.2"	"11.1"	"138.7"	"23.81"	"43.87"	"22.68"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002138"	"1.77"	"39.45"
"41394"	"False"	"High"	"[K].MASTPASYGNTTTKPMGLLSR.[V]"	"1xBiotin [K14]; 2xOxidation [M1; M16]"	"0.00496654"	"0.0007621"	"1"	"2"	"1"	"Q8BRF7"	"Q8BRF7 [499-519]"	"Q8BRF7 1xBiotin [K512]"	"0"	"2442.14618"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0003865"	"3.53"	""
"41392"	"False"	"High"	"[K].MASTPASYGNTTTKPMGLLSR.[V]"	"1xBiotin [K14]"	"0.00291759"	"0.0007621"	"1"	"2"	"2"	"Q8BRF7"	"Q8BRF7 [499-519]"	"Q8BRF7 1xBiotin [K512]"	"0"	"2410.15635"	"0.438"	"1.078"	"0.91600845929028"	"0.906515362333117"	"84.33"	"83.96"	"128.8"	"50.1"	"121.1"	"46.38"	"61.46"	"67.70"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002362"	"2.51"	"49.01"
"41291"	"False"	"High"	"[-].MASKSQHNAPK.[V]"	"1xBiotin [K4]; 1xMet-loss+Acetyl [N-Term]"	"0.00404962"	"0.0007621"	"1"	"1"	"16"	"O88455"	"O88455 [1-11]"	"O88455 1xBiotin [K4]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1335.64739"	"0.022"	"0.935"	"3.61097378948738E-05"	"0.906515362333117"	"61.87"	"55.03"	"152.6"	"2.8"	"144.6"	"39.79"	"44.94"	"40.67"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003199"	"2.72"	"22.47"
"41290"	"False"	"High"	"[-].MASKSQHNAPK.[V]"	"1xBiotin [K4]; 1xMet-loss [N-Term]"	"0.0091023"	"0.0007621"	"1"	"1"	"4"	"O88455"	"O88455 [1-11]"	"O88455 1xBiotin [K4]; 1xMet-loss [N-Term]"	"1"	"1293.63683"	"0.028"	"0.730"	"5.3214210908962E-05"	"0.906515362333117"	"56.97"	"76.84"	"193.5"	"6.4"	"100.1"	"49.01"	"39.56"	"55.71"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006703"	"3.31"	"15.44"
"67147"	"False"	"High"	"[R].VFLWGSFR.[D]"	""	"0.00632101"	"0.0007621"	"1"	"1"	"35"	"Q8VE37"	"Q8VE37 [140-147]"	""	"0"	"1011.54106"	"89.144"	"2.746"	"0.964150902908502"	"0.906515362333117"	"78.54"	"60.30"	"2.8"	"289.8"	"7.4"	"66.26"	"51.03"	"38.75"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004834"	"2.19"	"53.69"
"17427"	"False"	"High"	"[R].FGIKAAEEQLSAR.[G]"	"1xBiotin [K4]"	"0.0183887"	"0.0007621"	"1"	"1"	"1"	"Q8BHX1"	"Q8BHX1 [194-206]"	"Q8BHX1 1xBiotin [K197]"	"1"	"1645.83665"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001266"	"2.28"	""
"17478"	"False"	"High"	"[R].FGSGMNMGR.[I]"	"1xOxidation [M]"	"0.0311661"	"0.0007621"	"1"	"2"	"9"	"Q9D0E1"	"Q9D0E1 [362-370]"	""	"0"	"972.40260"	"25.642"	"4.754"	"0.592458659195948"	"0.906515362333117"	"145.77"	"71.37"	"7.0"	"255.9"	"37.1"	"55.30"	"113.35"	"42.98"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002085"	"1.71"	"18.28"
"40756"	"False"	"High"	"[-].MAKVEQVLSLEPQHELK.[F]"	"1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"0.0187313"	"0.0007621"	"1"	"1"	"2"	"Q9QY76"	"Q9QY76 [1-17]"	"Q9QY76 1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"1"	"2116.11070"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001292"	"2.19"	""
"40755"	"False"	"High"	"[-].MAKTYDYLFK.[L]"	"1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"0.0137652"	"0.0007621"	"1"	"2"	"10"	"P61028"	"P61028 [1-10]"	"P61028 1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1416.68680"	"0.207"	"0.776"	"0.925138005747468"	"0.906515362333117"	"26.44"	"54.00"	"156.6"	"31.3"	"112.2"	"24.37"	"17.64"	"45.55"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0009784"	"1.94"	"58.48"
"40728"	"False"	"High"	"[-].MAKIAQGAMYR.[G]"	"1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"0.0313571"	"0.0007621"	"1"	"1"	"9"	"P14824"	"P14824 [1-11]"	"P14824 1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1376.68134"	"0.401"	"1.119"	"0.925138005747468"	"0.913565512658592"	"64.76"	"46.99"	"116.0"	"47.4"	"136.6"	"36.16"	"44.41"	"39.18"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002099"	"1.98"	"46.80"
"40710"	"False"	"High"	"[-].MAKCLLTSSLSVR.[T]"	"1xBiotin [K3]; 1xCarbamidomethyl [C4]; 1xMet-loss+Acetyl [N-Term]"	"0.014914"	"0.0007621"	"1"	"1"	"3"	"Q9D9V3-2"	"Q9D9V3-2 [1-13]"	"Q9D9V3-2 1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1602.83421"	"0.521"	"0.867"	"0.925138005747468"	"0.906515362333117"	"54.31"	"47.11"	"139.0"	"60.5"	"100.5"	"24.43"	"53.65"	"35.08"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.001052"	"2.70"	"59.90"
"40617"	"False"	"High"	"[-].MAGMKTASGDYIDSSWELR.[V]"	"1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"0.0256224"	"0.0007621"	"1"	"1"	"4"	"Q8K1B8"	"Q8K1B8 [1-19]"	"Q8K1B8 1xBiotin [K5]; 1xMet-loss+Acetyl [N-Term]"	"1"	"2255.01073"	"0.789"	"0.872"	"0.947989303413716"	"0.906515362333117"	"78.19"	"86.60"	"107.7"	"87.2"	"105.1"	"71.67"	"35.82"	"55.44"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001729"	"2.47"	"58.56"
"67154"	"False"	"High"	"[R].VFNFLWR.[A]"	""	"0.0108878"	"0.0007621"	"1"	"1"	"8"	"P58854"	"P58854 [661-667]"	""	"0"	"981.53050"	"95.006"	"2.107"	"0.9808393111267"	"0.906515362333117"	"52.09"	"103.92"	"3.1"	"290.3"	"6.6"	"43.04"	"18.62"	"75.20"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007883"	"1.82"	"55.38"
"40577"	"False"	"High"	"[-].MAGEKAPDTK.[E]"	"1xBiotin [K5]; 1xMet-loss [N-Term]"	"0.0052508"	"0.0007621"	"1"	"1"	"11"	"P47911"	"P47911 [1-10]"	"P47911 1xBiotin [K5]; 1xMet-loss [N-Term]"	"1"	"1142.55103"	"0.105"	"0.640"	"0.0195943690629657"	"0.906515362333117"	"71.82"	"45.79"	"164.6"	"18.8"	"116.6"	"33.21"	"54.60"	"29.12"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004066"	"3.14"	"21.44"
"40960"	"False"	"High"	"[R].MANEKHSK.[N]"	"1xBiotin [K5]"	"0.0156678"	"0.0007621"	"1"	"3"	"8"	"Q9Z1W5"	"Q9Z1W5 [9-16]"	"Q9Z1W5 1xBiotin [K13]"	"1"	"1170.53942"	"0.617"	"0.860"	"0.925138005747468"	"0.906515362333117"	"77.84"	"76.26"	"115.1"	"77.1"	"107.8"	"63.40"	"44.75"	"57.56"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000459"	"0.0011"	"2.17"	"16.42"
"66234"	"False"	"High"	"[K].TVTAMDVVYALK.[R]"	"1xOxidation [M5]"	"0.00933004"	"0.0007621"	"1"	"1"	"2"	"P62806"	"P62806 [81-92]"	""	"0"	"1326.69737"	"0.893"	"1.064"	"0.123248539745854"	""	"88.84"	"68.70"	"98.9"	"85.2"	"115.9"	"35.44"	"241.65"	"48.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006842"	"2.22"	"45.26"
"3684"	"False"	"High"	"[R].ARVEENFLKLTHVQR.[Q]"	"1xBiotin [K9]"	"0.00251498"	"0.0007621"	"1"	"3"	"4"	"Q9D024"	"Q9D024 [411-425]"	"Q9D024 1xBiotin [K419]"	"2"	"2066.09639"	"28.603"	"0.730"	"0.925138005747468"	"0.906515362333117"	"45.88"	"48.34"	"9.7"	"283.8"	"6.5"	"25.87"	"40.88"	"42.34"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002058"	"4.01"	"43.87"
"49242"	"False"	"High"	"[R].MYLFYGNK.[T]"	"1xOxidation [M1]"	"0.0132651"	"0.0007621"	"1"	"2"	"6"	"P17426"	"P17426 [776-783]"	""	"0"	"1051.49173"	"260.586"	"3.070"	"0.576594498417037"	"0.906515362333117"	"37.21"	"57.10"	"1.1"	"295.3"	"3.5"	"26.41"	"26.09"	"45.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0009422"	"2.08"	"36.39"
"59811"	"False"	"High"	"[R].SGVSLAALK.[K]"	""	"0.00888012"	"0.0007621"	"3"	"4"	"9"	"P43275; P15864; P43277"	"P43275 [57-65]; P15864 [55-63]; P43277 [56-64]"	""	"0"	"845.50909"	"100.378"	"2.356"	"0.973358748574628"	"0.935866453494337"	"57.01"	"59.26"	"3.0"	"290.0"	"7.0"	"50.01"	"35.58"	"36.41"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006547"	"2.10"	"34.90"
"59784"	"False"	"High"	"[R].SGTKLIFR.[R]"	"1xBiotin [K4]"	"0.0106879"	"0.0007621"	"1"	"1"	"5"	"Q80X80"	"Q80X80 [642-649]"	"Q80X80 1xBiotin [K645]"	"1"	"1147.62923"	"0.147"	"0.857"	"0.925138005747468"	"0.906515362333117"	"67.90"	"27.17"	"151.8"	"22.3"	"125.9"	"9.31"	"51.47"	"21.28"	""	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.000775"	"2.32"	"44.56"
"59777"	"False"	"High"	"[R].SGSSKALDK.[T]"	"1xBiotin [K5]"	"0.0104272"	"0.0007621"	"1"	"1"	"5"	"Q8K2C8"	"Q8K2C8 [98-106]"	"Q8K2C8 1xBiotin [K102]"	"1"	"1118.55103"	"0.329"	"0.669"	"0.925138005747468"	"0.906515362333117"	"32.33"	"51.78"	"144.4"	"48.6"	"107.0"	"22.10"	"34.89"	"39.44"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007581"	"2.76"	"25.74"
"4521"	"False"	"High"	"[K].AVQQPDGLAVLGIFLKIGPASQGLQK.[V]"	""	"0.0102992"	"0.0007621"	"1"	"1"	"2"	"P00920"	"P00920 [133-158]"	""	"1"	"2648.51340"	"0.894"	"1.205"	"0.0989039091531243"	"0.906515362333117"	"77.46"	"46.75"	"100.3"	"90.4"	"109.3"	"33.96"	"240.55"	"26.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007508"	"2.72"	"65.66"
"9731"	"False"	"High"	"[K].DTKSLHLNR.[V]"	"1xBiotin [K3]"	"0.0245458"	"0.0007621"	"1"	"2"	"8"	"Q9JIG4-1"	"Q9JIG4-1 [649-657]"	"Q9JIG4-1 1xBiotin [K651]"	"1"	"1309.66813"	"0.110"	"0.630"	"0.00760868257561414"	"0.906515362333117"	"33.53"	"21.82"	"171.8"	"18.6"	"109.6"	"7.61"	"194.31"	"26.41"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001653"	"2.34"	"33.87"
"59686"	"False"	"High"	"[R].SGMFWLR.[F]"	"1xOxidation [M3]"	"0.00899052"	"0.0007621"	"1"	"1"	"38"	"Q9CZ13"	"Q9CZ13 [473-479]"	""	"0"	"912.43963"	"313.596"	"5.034"	"0.925138005747468"	"0.906515362333117"	"85.04"	"69.02"	"0.9"	"295.0"	"4.1"	"86.77"	"57.76"	"15.32"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006634"	"2.23"	"41.03"
"59685"	"False"	"High"	"[R].SGMFWLR.[F]"	""	"0.0229436"	"0.0007621"	"1"	"1"	"22"	"Q9CZ13"	"Q9CZ13 [473-479]"	""	"0"	"896.44472"	"33.677"	"4.218"	"0.925138005747468"	"0.906515362333117"	"87.61"	"75.60"	"8.4"	"255.4"	"36.2"	"76.41"	"98.54"	"41.14"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001554"	"2.11"	"49.07"
"59683"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSRR.[D]"	"1xBiotin [K11]; 1xOxidation [M]"	"0.0131835"	"0.0007621"	"1"	"1"	"6"	"Q99J27"	"Q99J27 [16-40]"	"Q99J27 1xBiotin [K26]"	"2"	"2943.33348"	"0.738"	"2.757"	"0.0991736550615938"	"0.916215054610739"	"73.39"	"103.27"	"50.3"	"45.6"	"204.0"	"94.15"	"33.77"	"44.46"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.0009362"	"2.04"	"47.47"
"9644"	"False"	"High"	"[R].DSWSYVNSKSNDD.[-]"	"1xBiotin [K9]"	"0.00760895"	"0.0007621"	"1"	"1"	"13"	"Q00651"	"Q00651 [1027-1039]"	"Q00651 1xBiotin [K1035]"	"1"	"1742.69625"	"0.071"	"0.960"	"0.00221474652898688"	"0.906515362333117"	"56.23"	"40.20"	"146.3"	"13.0"	"140.7"	"35.86"	"39.33"	"23.78"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005704"	"3.38"	"44.72"
"59682"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSRR.[D]"	"1xBiotin [K11]"	"0.00728677"	"0.0007621"	"1"	"1"	"3"	"Q99J27"	"Q99J27 [16-40]"	"Q99J27 1xBiotin [K26]"	"2"	"2927.33856"	"0.595"	"2.211"	""	"0.936238272383155"	"79.17"	"83.87"	"105.4"	"51.4"	"143.2"	"51.94"	"58.33"	"66.97"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0005476"	"2.68"	"51.41"
"9746"	"False"	"High"	"[R].DTLQLSIKQR.[L]"	"1xBiotin [K8]"	"0.00469765"	"0.0007621"	"1"	"1"	"5"	"Q3ZK22-1"	"Q3ZK22-1 [717-726]"	"Q3ZK22-1 1xBiotin [K724]"	"1"	"1427.76751"	"0.208"	"0.533"	"0.925138005747468"	"0.906515362333117"	"66.85"	"36.55"	"170.1"	"41.7"	"88.2"	"38.99"	"49.87"	"22.08"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003684"	"2.44"	"44.45"
"59665"	"False"	"High"	"[K].SGLTGYIKGIFGFR.[S]"	"1xBiotin [K8]"	"0.00275957"	"0.0007621"	"1"	"1"	"4"	"Q8BMA6"	"Q8BMA6 [611-624]"	"Q8BMA6 1xBiotin [K618]"	"1"	"1741.90942"	"1.278"	"1.347"	""	"0.906777072223237"	"69.77"	"40.62"	"77.8"	"118.7"	"103.6"	"32.28"	"43.78"	"28.17"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002243"	"3.42"	"66.55"
"59648"	"False"	"High"	"[R].SGLLDKWK.[I]"	"1xBiotin [K6]"	"0.00728677"	"0.0007621"	"1"	"1"	"9"	"Q9CYN2"	"Q9CYN2 [33-40]"	"Q9CYN2 1xBiotin [K38]"	"1"	"1172.61324"	"0.148"	"0.928"	"0.925138005747468"	"0.906515362333117"	"44.35"	"34.69"	"145.4"	"20.6"	"134.1"	"19.73"	"41.61"	"47.10"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.00055"	"2.92"	"51.31"
"63844"	"False"	"High"	"[R].TFSLKGMTTK.[L]"	"1xBiotin [K5]"	"0.00572563"	"0.0007621"	"1"	"1"	"5"	"Q91YJ2"	"Q91YJ2 [352-361]"	"Q91YJ2 1xBiotin [K356]"	"1"	"1339.67485"	"0.255"	"1.060"	"0.925138005747468"	"0.906515362333117"	"54.27"	"27.86"	"128.9"	"32.8"	"138.3"	"21.40"	"50.65"	"19.42"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0002312"	"0.0004403"	"2.10"	"46.51"
"59590"	"False"	"High"	"[K].SGGDKMFSLK.[K]"	"1xBiotin [K5]; 1xOxidation [M6]"	"0.00597889"	"0.0007621"	"1"	"1"	"3"	"Q9WTZ1"	"Q9WTZ1 [24-33]"	"Q9WTZ1 1xBiotin [K28]"	"1"	"1311.60717"	"0.558"	"0.827"	"0.925138005747468"	"0.906515362333117"	"37.84"	"54.16"	"131.5"	"71.4"	"97.1"	"30.96"	"21.54"	"61.31"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002312"	"0.0004587"	"2.88"	"39.67"
"59589"	"False"	"High"	"[K].SGGDKMFSLK.[K]"	"1xBiotin [K5]"	"0.00452652"	"0.0007621"	"1"	"1"	"11"	"Q9WTZ1"	"Q9WTZ1 [24-33]"	"Q9WTZ1 1xBiotin [K28]"	"1"	"1295.61225"	"0.287"	"0.693"	"0.925138005747468"	"0.906515362333117"	"76.66"	"62.14"	"145.1"	"52.0"	"102.9"	"50.94"	"40.54"	"24.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003559"	"2.70"	"44.98"
"59584"	"False"	"High"	"[K].SGFWGWR.[T]"	""	"0.0195556"	"0.0007621"	"1"	"1"	"23"	"Q80UP5"	"Q80UP5 [248-254]"	""	"0"	"895.42095"	"80.924"	"2.161"	"0.982626859977453"	"0.906515362333117"	"60.01"	"66.85"	"3.6"	"289.7"	"6.7"	"41.29"	"46.14"	"51.48"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005902"	"0.001344"	"1.86"	"47.98"
"59580"	"False"	"High"	"[K].SGFLVWR.[Y]"	""	"0.0204157"	"0.0007621"	"1"	"2"	"7"	"Q8VDF2"	"Q8VDF2 [575-581]"	""	"0"	"864.47265"	"131.228"	"3.045"	"0.925138005747468"	"0.906515362333117"	"83.68"	"84.08"	"2.1"	"290.5"	"7.4"	"68.38"	"28.35"	"41.16"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001397"	"2.23"	"47.78"
"9736"	"False"	"High"	"[R].DTIFQKER.[F]"	"1xBiotin [K6]"	"0.00839977"	"0.0007621"	"2"	"2"	"21"	"P28867-2; P28867-1"	"P28867-2 [217-224]; P28867-1 [217-224]"	"P28867-2 1xBiotin [K222]; P28867-1 1xBiotin [K222]"	"1"	"1262.61978"	"0.021"	"0.824"	"3.23757188555403E-05"	"0.906515362333117"	"36.17"	"20.13"	"161.3"	"3.5"	"135.2"	"26.89"	"23.54"	"29.78"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006238"	"2.29"	"41.78"
"59824"	"False"	"High"	"[R].SHATSPGSNVIQKGSSLGTEWQTPVISETFR.[S]"	"1xBiotin [K13]"	"0.0033846"	"0.0007621"	"1"	"1"	"2"	"Q8BMK0"	"Q8BMK0 [12-42]"	"Q8BMK0 1xBiotin [K24]"	"1"	"3527.72236"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000271"	"4.46"	""
"63759"	"False"	"High"	"[R].TFCQLILDPIFK.[V]"	"1xCarbamidomethyl [C3]"	"0.00850422"	"0.0007621"	"1"	"1"	"5"	"P58252"	"P58252 [288-299]"	""	"0"	"1494.80250"	"32.005"	"1.909"	"0.925138005747468"	"0.950055801575781"	"90.84"	"67.78"	"8.6"	"275.5"	"15.9"	"30.12"	"80.58"	"54.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0006303"	"2.77"	"61.37"
"63746"	"False"	"High"	"[K].TEWLDGKHVVFGK.[V]"	"1xBiotin [K7]"	"0.00253059"	"0.0007621"	"1"	"1"	"16"	"P17742"	"P17742 [119-131]"	"P17742 1xBiotin [K125]"	"1"	"1741.87304"	"0.091"	"1.034"	"0.925138005747468"	"0.906515362333117"	"61.41"	"59.66"	"153.2"	"13.4"	"133.4"	"30.03"	"64.18"	"58.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002069"	"2.98"	"49.82"
"8783"	"False"	"High"	"[R].DNIQGITKPAIR.[R]"	"1xBiotin [K8]"	"0.00809403"	"0.0007621"	"1"	"1"	"7"	"P62806"	"P62806 [25-36]"	"P62806 1xBiotin [K32]"	"0"	"1551.83117"	"0.251"	"0.900"	"0.925138005747468"	"0.906515362333117"	"105.11"	"91.09"	"126.3"	"31.2"	"142.5"	"78.26"	"48.80"	"28.48"	""	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006048"	"2.00"	"43.51"
"60212"	"False"	"High"	"[R].SKVTAIK.[S]"	"1xBiotin [K2]"	"0.0211827"	"0.0007621"	"1"	"1"	"25"	"O35623"	"O35623 [41-47]"	"O35623 1xBiotin [K42]"	"1"	"972.55466"	"0.001"	"0.965"	"3.16514884857177E-08"	"0.909223670800027"	"43.19"	"29.43"	"148.4"	"0.2"	"151.4"	"47.68"	"30.13"	"40.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000628"	"0.001446"	"2.98"	"31.43"
"8956"	"False"	"High"	"[K].DPLKAPGR.[L]"	"1xBiotin [K4]"	"0.0101728"	"0.0007621"	"1"	"1"	"23"	"P58742"	"P58742 [53-60]"	"P58742 1xBiotin [K56]"	"1"	"1079.56663"	"0.006"	"0.681"	"2.55696572722952E-06"	"0.906515362333117"	"83.35"	"25.62"	"178.6"	"1.0"	"120.4"	"9.86"	"62.32"	"20.68"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007428"	"2.37"	"32.00"
"9095"	"False"	"High"	"[K].DQENKYQASHPNLR.[R]"	"1xBiotin [K5]"	"0.0113686"	"0.0007621"	"1"	"1"	"7"	"Q9ERB0"	"Q9ERB0 [155-168]"	"Q9ERB0 1xBiotin [K159]"	"1"	"1925.89227"	"0.752"	"0.992"	"0.957833173268411"	"0.906515362333117"	"59.89"	"81.24"	"100.2"	"91.9"	"108.0"	"51.84"	"37.75"	"84.85"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008205"	"2.47"	"32.21"
"63257"	"False"	"High"	"[R].TALNLFFK.[L]"	""	"0.0152863"	"0.0007621"	"1"	"1"	"2"	"Q8CIE6"	"Q8CIE6 [1107-1114]"	""	"0"	"953.54548"	"103.014"	"1.721"	"0.529141090895061"	"0.992134392955587"	"43.98"	"42.71"	"2.6"	"293.1"	"4.3"	"36.43"	"23.63"	"23.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0004044"	"0.00107"	"2.10"	"51.49"
"60135"	"False"	"High"	"[K].SKPQDSDKLNSLSIPSVSK.[R]"	"1xBiotin [K8]"	"0.014109"	"0.0007621"	"1"	"1"	"5"	"P49070"	"P49070 [63-81]"	"P49070 1xBiotin [K70]"	"1"	"2256.15402"	"0.463"	"0.909"	"0.925138005747468"	"0.906515362333117"	"92.31"	"93.25"	"145.8"	"48.8"	"105.4"	"51.40"	"46.80"	"84.85"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0009951"	"2.93"	"45.23"
"60122"	"False"	"High"	"[K].SKNPWYIDEVAEDPAK.[S]"	"1xBiotin [K2]"	"0.0185022"	"0.0007621"	"1"	"2"	"5"	"Q80TQ2-1"	"Q80TQ2-1 [367-382]"	"Q80TQ2-1 1xBiotin [K368]"	"1"	"2087.97427"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001278"	"2.86"	""
"60099"	"False"	"High"	"[R].SKINLQDLQGTCTK.[K]"	"1xBiotin [K2]; 1xCarbamidomethyl [C12]"	"0.0206683"	"0.0007621"	"1"	"1"	"4"	"Q01237"	"Q01237 [871-884]"	"Q01237 1xBiotin [K872]"	"1"	"1831.90408"	"1.067"	"0.946"	"0.975052343286225"	"0.906515362333117"	"51.38"	"47.27"	"93.7"	"115.9"	"90.4"	"27.53"	"43.01"	"41.72"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001416"	"2.66"	"44.78"
"60091"	"False"	"High"	"[R].SKLGPYNEELR.[A]"	"1xBiotin [K2]"	"0.00490549"	"0.0007621"	"1"	"1"	"9"	"Q9D1E6"	"Q9D1E6 [128-138]"	"Q9D1E6 1xBiotin [K129]"	"1"	"1531.75734"	"0.204"	"0.784"	"0.925138005747468"	"0.906515362333117"	"36.21"	"63.27"	"152.6"	"32.9"	"114.5"	"27.52"	"24.93"	"53.47"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003815"	"2.85"	"41.70"
"9280"	"False"	"High"	"[K].DRPFFPGLVK.[Y]"	""	"0.0284345"	"0.0007621"	"1"	"1"	"6"	"Q01768"	"Q01768 [57-66]"	""	"0"	"1175.65716"	"149.518"	"5.832"	"0.925138005747468"	"0.906515362333117"	"46.39"	"41.99"	"2.0"	"287.5"	"10.5"	"29.62"	"69.64"	"33.10"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001908"	"2.35"	"43.26"
"60073"	"False"	"High"	"[K].SKHILFTEDSGKPFVVCK.[S]"	"1xBiotin [K2]; 1xCarbamidomethyl [C17]"	"0.0185022"	"0.0007621"	"1"	"1"	"2"	"Q923W1"	"Q923W1 [485-502]"	"Q923W1 1xBiotin [K486]"	"1"	"2318.16717"	"0.611"	"1.518"	"0.925138005747468"	"0.943485193068069"	"53.34"	"64.11"	"100.0"	"63.0"	"137.0"	"42.15"	"26.28"	"46.84"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0005416"	"0.001273"	"2.62"	"45.30"
"60062"	"False"	"High"	"[K].SKGNYDEGFGR.[K]"	"1xBiotin [K2]"	"0.0045546"	"0.0007621"	"1"	"1"	"10"	"Q8BGB5"	"Q8BGB5 [99-109]"	"Q8BGB5 1xBiotin [K100]"	"1"	"1455.63214"	"0.129"	"0.713"	"0.925138005747468"	"0.906515362333117"	"69.74"	"53.87"	"151.4"	"23.1"	"125.5"	"47.00"	"52.05"	"44.09"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003576"	"2.01"	"36.15"
"63343"	"False"	"High"	"[K].TAYGKPK.[L]"	"1xBiotin [K5]"	"0.0307875"	"0.0007621"	"1"	"2"	"12"	"Q9WU40-1"	"Q9WU40-1 [450-456]"	"Q9WU40-1 1xBiotin [K454]"	"0"	"990.50771"	"0.028"	"0.633"	"5.28264377019083E-05"	"0.906515362333117"	"44.37"	"32.13"	"178.8"	"5.1"	"116.0"	"16.76"	"41.03"	"26.35"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002057"	"1.64"	"28.33"
"63346"	"False"	"High"	"[R].TAYLLYYR.[R]"	""	"0.028261"	"0.0007621"	"1"	"2"	"2"	"P52479"	"P52479 [780-787]"	""	"0"	"1062.56186"	"119.633"	"1.212"	"0.45528731500856"	"0.906515362333117"	"61.75"	"96.10"	"2.5"	"293.9"	"3.5"	"47.09"	"54.77"	"75.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0006486"	"0.001896"	"2.06"	"42.53"
"60042"	"False"	"High"	"[K].SKEYFSK.[Q]"	"1xBiotin [K2]"	"0.0178314"	"0.0007621"	"1"	"1"	"11"	"P35700"	"P35700 [191-197]"	"P35700 1xBiotin [K192]"	"1"	"1114.52376"	"0.187"	"0.682"	"0.0508030184052922"	"0.906515362333117"	"26.03"	"37.39"	"159.7"	"28.8"	"111.5"	"17.63"	"19.95"	"71.65"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001234"	"2.50"	"34.76"
"63476"	"False"	"High"	"[R].TDGKVFQFLNAK.[C]"	"1xBiotin [K4]"	"0.00312306"	"0.0007621"	"1"	"1"	"4"	"Q8BP67"	"Q8BP67 [24-35]"	"Q8BP67 1xBiotin [K27]"	"1"	"1593.80937"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002527"	"2.50"	""
"60001"	"False"	"High"	"[R].SKAQILALLK.[S]"	"1xBiotin [K2]"	"0.0327265"	"0.0007621"	"1"	"2"	"1"	"Q0VGT4"	"Q0VGT4 [252-261]"	"Q0VGT4 1xBiotin [K253]"	"1"	"1310.78645"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002184"	"2.95"	""
"59993"	"False"	"High"	"[K].SKAFDFLSEETEASLASR.[R]"	"1xBiotin [K2]"	"0.0135128"	"0.0007621"	"1"	"6"	"2"	"Q58A65"	"Q58A65 [604-621]"	"Q58A65 1xBiotin [K605]"	"1"	"2214.03832"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009578"	"2.60"	""
"59986"	"False"	"High"	"[K].SHYVLYGLVAAMQPR.[M]"	"1xOxidation [M12]"	"0.00866334"	"0.0007621"	"1"	"1"	"2"	"Q8VDM4"	"Q8VDM4 [814-828]"	""	"0"	"1720.88394"	"81.521"	"1.371"	"0.925138005747468"	"0.913702580837398"	"73.66"	"68.34"	"3.3"	"291.4"	"5.3"	"49.88"	"63.80"	"38.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0002502"	"0.0006425"	"3.23"	"44.08"
"59579"	"False"	"High"	"[R].SGFGKFER.[G]"	"1xBiotin [K5]"	"0.00950455"	"0.0007621"	"1"	"2"	"11"	"Q62167"	"Q62167 [114-121]"	"Q62167 1xBiotin [K118]"	"1"	"1153.54589"	"0.100"	"1.042"	"0.925138005747468"	"0.906515362333117"	"44.31"	"51.28"	"138.7"	"15.0"	"146.3"	"27.52"	"43.93"	"60.15"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000697"	"2.48"	"42.21"
"60224"	"False"	"High"	"[K].SKYSSLEQSER.[R]"	"1xBiotin [K2]"	"0.00306563"	"0.0007621"	"1"	"1"	"8"	"Q80W37"	"Q80W37 [33-43]"	"Q80W37 1xBiotin [K34]"	"1"	"1539.71078"	"0.118"	"1.159"	"0.516864114435048"	"0.906515362333117"	"80.16"	"80.56"	"139.5"	"16.8"	"143.7"	"60.08"	"51.68"	"75.28"	""	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000248"	"2.43"	"36.27"
"63847"	"False"	"High"	"[K].TFSNWPTYPQLYVR.[G]"	""	"0.00326127"	"0.0007621"	"1"	"1"	"8"	"Q9CQM9"	"Q9CQM9 [297-310]"	""	"0"	"1771.88023"	"114.182"	"5.173"	"0.949662611758987"	"0.906515362333117"	"80.90"	"94.90"	"2.7"	"282.3"	"15.0"	"88.33"	"27.15"	"41.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0001583"	"0.000263"	"2.77"	"53.15"
"59521"	"False"	"High"	"[K].SFYQFQHYR.[A]"	""	"0.00518626"	"0.0007621"	"1"	"1"	"20"	"Q9CZU3"	"Q9CZU3 [586-594]"	""	"0"	"1275.59053"	"265.235"	"8.771"	"0.925138005747468"	"0.906515362333117"	"80.01"	"72.46"	"1.1"	"288.4"	"10.4"	"71.45"	"39.61"	"30.44"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004029"	"2.32"	"34.57"
"64122"	"False"	"High"	"[K].TGVTGPYVLGTGLSLYFLSK.[E]"	""	"0.029139"	"0.0007621"	"1"	"1"	"3"	"Q9CQQ7"	"Q9CQQ7 [71-90]"	""	"0"	"2073.12667"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.001947"	"2.80"	""
"58468"	"False"	"High"	"[R].SAANYKTATR.[T]"	"1xBiotin [K6]"	"0.00710881"	"0.0007621"	"1"	"1"	"1"	"P70227"	"P70227 [1565-1574]"	"P70227 1xBiotin [K1570]"	"1"	"1308.63650"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005375"	"2.79"	""
"64159"	"False"	"High"	"[K].THILLFLPK.[S]"	""	"0.00390208"	"0.0007621"	"1"	"1"	"16"	"P09103"	"P09103 [257-265]"	""	"0"	"1081.67683"	"188.878"	"5.208"	"0.925138005747468"	"0.906515362333117"	"52.16"	"44.45"	"1.4"	"290.8"	"7.8"	"73.05"	"43.78"	"40.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003106"	"2.70"	"46.49"
"58413"	"False"	"High"	"[R].RYIGIVKQAGLDR.[M]"	"1xBiotin [K7]"	"0.00541569"	"0.0007621"	"1"	"2"	"6"	"Q9Z2X1-1"	"Q9Z2X1-1 [218-230]"	"Q9Z2X1-1 1xBiotin [K224]"	"2"	"1714.94212"	"0.180"	"0.679"	"0.0128776403420873"	"0.906515362333117"	"128.83"	"56.25"	"163.9"	"29.4"	"106.7"	"57.92"	"165.96"	"63.89"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0004185"	"2.99"	"41.31"
"4380"	"False"	"High"	"[K].AVGKVIPELNGK.[L]"	"1xBiotin [K4]"	"0.00770359"	"0.0007621"	"1"	"1"	"7"	"P16858"	"P16858 [214-225]"	"P16858 1xBiotin [K217]"	"1"	"1450.80865"	"0.226"	"0.930"	"0.925138005747468"	"0.906515362333117"	"49.33"	"48.44"	"146.7"	"29.0"	"124.2"	"34.72"	"44.10"	"31.86"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0005759"	"2.67"	"44.83"
"4367"	"False"	"High"	"[R].AVFPSIVGRPR.[H]"	""	"0.00330187"	"0.0007621"	"1"	"6"	"83"	"P60710"	"P60710 [29-39]"	""	"0"	"1198.70550"	"168.615"	"3.546"	"0.925138005747468"	"0.906515362333117"	"55.99"	"41.58"	"1.8"	"291.2"	"7.0"	"35.75"	"45.74"	"25.47"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002652"	"2.63"	"36.79"
"58368"	"False"	"High"	"[R].RWGYTVK.[G]"	""	"0.0341544"	"0.0007621"	"1"	"1"	"7"	"P29758"	"P29758 [155-161]"	""	"1"	"909.49411"	"98.936"	"3.311"	"0.945683295219289"	"0.906515362333117"	"78.59"	"67.71"	"2.8"	"288.1"	"9.1"	"67.83"	"71.14"	"48.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002288"	"2.19"	"24.92"
"4292"	"False"	"High"	"[K].AVAASKER.[S]"	"1xBiotin [K6]"	"0.0349975"	"0.0007621"	"2"	"3"	"10"	"P15864; P43277"	"P15864 [47-54]; P43277 [48-55]"	"P15864 1xBiotin [K52]; P43277 1xBiotin [K53]"	"1"	"1057.54589"	"0.098"	"0.797"	"0.0692288962996529"	"0.906515362333117"	"62.03"	"44.72"	"161.2"	"15.8"	"123.0"	"23.15"	"54.48"	"44.05"	"NotUnique"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002349"	"2.39"	"23.01"
"58606"	"False"	"High"	"[K].SALASVIMGLSPILGK.[D]"	""	"0.00447087"	"0.0007621"	"1"	"1"	"2"	"Q76MZ3"	"Q76MZ3 [343-358]"	""	"0"	"1556.90803"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003513"	"2.60"	""
"4289"	"False"	"High"	"[K].ATYINLKPAR.[K]"	"1xBiotin [K7]"	"0.0077994"	"0.0007621"	"1"	"1"	"6"	"Q9CXX9"	"Q9CXX9 [270-279]"	"Q9CXX9 1xBiotin [K276]"	"0"	"1372.74057"	"0.213"	"1.009"	"0.925138005747468"	"0.919235111389825"	"51.12"	"68.62"	"127.8"	"29.2"	"143.0"	"42.49"	"32.04"	"47.44"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005827"	"2.30"	"42.88"
"64377"	"False"	"High"	"[K].TKPLWHNYFLCGFK.[G]"	"1xCarbamidomethyl [C11]"	"0.0256224"	"0.0007621"	"1"	"1"	"1"	"Q68FH4"	"Q68FH4 [103-116]"	""	"0"	"1810.90976"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001727"	"2.53"	""
"58238"	"False"	"High"	"[R].RVFQNYGK.[Y]"	""	"0.00809403"	"0.0007621"	"1"	"1"	"15"	"P10107"	"P10107 [235-242]"	""	"1"	"1011.53704"	"193.419"	"4.899"	"0.925138005747468"	"0.906515362333117"	"35.18"	"62.55"	"1.5"	"291.2"	"7.3"	"50.74"	"21.30"	"45.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006039"	"2.56"	"19.22"
"58081"	"False"	"High"	"[R].RTELFLKEHDHLR.[N]"	"1xBiotin [K7]"	"0.00938785"	"0.0007621"	"1"	"1"	"4"	"O88630"	"O88630 [159-171]"	"O88630 1xBiotin [K165]"	"2"	"1919.99086"	"17.808"	"1.802"	"0.987144754730324"	"0.919063063983313"	"144.96"	"86.65"	"11.6"	"269.3"	"19.1"	"63.16"	"114.47"	"50.14"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006914"	"1.88"	"38.57"
"4267"	"False"	"High"	"[R].ATTLSNAVSSLASTGLSLTK.[V]"	""	"0.00274255"	"0.0007621"	"1"	"6"	"3"	"Q7M6Y3-1"	"Q7M6Y3-1 [299-318]"	""	"0"	"1922.04406"	"0.969"	"0.945"	"0.925138005747468"	"0.906515362333117"	"143.95"	"75.15"	"113.2"	"93.9"	"92.8"	"55.06"	"153.04"	"67.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002238"	"2.75"	"59.69"
"64397"	"False"	"High"	"[R].TKSDLSLK.[M]"	"1xBiotin [K2]"	"0.0104918"	"0.0007621"	"1"	"1"	"1"	"Q9EQJ0"	"Q9EQJ0 [765-772]"	"Q9EQJ0 1xBiotin [K766]"	"1"	"1117.59217"	"0.105"	"0.802"	"0.00587526965505829"	"0.906515362333117"	"43.55"	"41.47"	"156.0"	"18.0"	"126.0"	"22.12"	"40.22"	"44.29"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.000765"	"2.62"	"35.65"
"57770"	"False"	"High"	"[R].RRFPPYYMR.[R]"	""	"0.0143724"	"0.0007621"	"1"	"1"	"4"	"P62960"	"P62960 [189-197]"	""	"2"	"1285.66226"	"23.478"	"0.726"	"0.925138005747468"	"0.906515362333117"	"104.91"	"105.49"	"15.5"	"274.9"	"9.6"	"79.77"	"92.28"	"75.85"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.001016"	"2.83"	"28.23"
"57685"	"False"	"High"	"[R].RQKGLDYR.[L]"	"1xBiotin [K3]"	"0.00324116"	"0.0007621"	"1"	"1"	"13"	"Q99LI2"	"Q99LI2 [381-388]"	"Q99LI2 1xBiotin [K383]"	"2"	"1261.64700"	"0.036"	"0.892"	"9.06719145300864E-05"	"0.906515362333117"	"37.62"	"42.06"	"155.5"	"5.8"	"138.7"	"25.89"	"34.25"	"37.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002603"	"3.30"	"29.70"
"64400"	"False"	"High"	"[K].TKSGLTGYIK.[G]"	"1xBiotin [K2]"	"0.0217098"	"0.0007621"	"1"	"1"	"1"	"Q8BMA6"	"Q8BMA6 [609-618]"	"Q8BMA6 1xBiotin [K610]"	"1"	"1293.68713"	"0.046"	"0.606"	"0.0041333639999365"	"0.906515362333117"	"66.98"	"65.79"	"190.1"	"9.6"	"100.3"	"48.57"	"36.58"	"38.34"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001474"	"2.37"	"41.26"
"58250"	"False"	"High"	"[R].RVHPISTMIK.[G]"	"1xOxidation [M8]"	"0.00362292"	"0.0007621"	"1"	"1"	"10"	"P06151"	"P06151 [269-278]"	""	"1"	"1197.67724"	"292.495"	"4.562"	"0.925138005747468"	"0.906515362333117"	"41.98"	"40.85"	"0.9"	"294.6"	"4.6"	"37.97"	"30.61"	"31.74"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002893"	"2.70"	"18.65"
"58609"	"False"	"High"	"[R].SAICIQSWWR.[G]"	"1xCarbamidomethyl [C4]"	"0.0159602"	"0.0007621"	"1"	"4"	"2"	"Q9WTI7-1"	"Q9WTI7-1 [760-769]"	""	"0"	"1306.63610"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0005064"	"0.001114"	"1.97"	""
"10479"	"False"	"High"	"[K].EALELLKTAIAK.[A]"	"1xBiotin [K7]"	"0.0131835"	"0.0007621"	"1"	"1"	"2"	"P17182"	"P17182 [222-233]"	"P17182 1xBiotin [K228]"	"1"	"1525.86583"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009367"	"2.79"	""
"4497"	"False"	"High"	"[R].AVNYFSK.[V]"	""	"0.0327265"	"0.0007621"	"1"	"1"	"2"	"Q68FD5"	"Q68FD5 [1435-1441]"	""	"0"	"828.42503"	"295.973"	"1.287"	"0.925138005747468"	""	"35.49"	"56.14"	"1.0"	"297.7"	"1.4"	"21.80"	"40.14"	"43.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002185"	"2.11"	"26.74"
"59511"	"False"	"High"	"[K].SFVPNMIGGASQADLAVLVISAR.[K]"	"1xOxidation [M6]"	"0.0124714"	"0.0007621"	"1"	"3"	"1"	"Q8R050"	"Q8R050 [301-323]"	""	"0"	"2332.23294"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.00089"	"2.95"	""
"59510"	"False"	"High"	"[K].SFVLNLGK.[D]"	""	"0.031937"	"0.0007621"	"1"	"1"	"9"	"P16045"	"P16045 [30-37]"	""	"0"	"877.51418"	"125.181"	"3.102"	"0.933451859704016"	"0.906515362333117"	"32.25"	"49.26"	"2.3"	"290.9"	"6.8"	"27.97"	"18.64"	"43.76"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002138"	"1.74"	"42.37"
"63867"	"False"	"High"	"[K].TFVVQGFGNVGLHSMR.[Y]"	"1xOxidation [M15]"	"0.00927258"	"0.0007621"	"1"	"1"	"1"	"P26443"	"P26443 [303-318]"	""	"0"	"1764.88500"	"63.566"	"0.972"	"0.925138005747468"	"0.906515362333117"	"82.28"	"66.65"	"4.1"	"291.1"	"4.8"	"48.54"	"55.23"	"34.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0006817"	"2.67"	"43.02"
"59479"	"False"	"High"	"[K].SFQQQMQNYLK.[D]"	""	"0.0128621"	"0.0007621"	"1"	"1"	"4"	"P41731"	"P41731 [118-128]"	""	"0"	"1414.67836"	"0.999"	"1.193"	"0.961956235049573"	"0.906515362333117"	"143.94"	"96.75"	"95.0"	"90.2"	"114.8"	"47.27"	"148.99"	"65.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0003479"	"0.0009151"	"2.30"	"44.42"
"63928"	"False"	"High"	"[K].TGFKFSAEKPVIEVPSMTILDK.[K]"	"1xBiotin [K4]"	"0.00383034"	"0.0007621"	"1"	"1"	"1"	"Q8BGR2"	"Q8BGR2 [258-279]"	"Q8BGR2 1xBiotin [K261]"	"1"	"2663.38231"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003054"	"4.02"	""
"59464"	"False"	"High"	"[R].SFPDFPIPGVLFR.[D]"	""	"0.00986342"	"0.0007621"	"1"	"1"	"12"	"P08030"	"P08030 [15-27]"	""	"0"	"1491.79946"	"74.148"	"4.239"	"0.925138005747468"	"0.906515362333117"	"72.45"	"66.83"	"3.5"	"279.5"	"17.0"	"61.16"	"40.06"	"36.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000722"	"1.97"	"64.62"
"4519"	"False"	"High"	"[R].AVQQNGAPATTKVK.[A]"	"1xBiotin [K12]"	"0.0107541"	"0.0007621"	"1"	"1"	"15"	"Q9JLJ5"	"Q9JLJ5 [264-277]"	"Q9JLJ5 1xBiotin [K275]"	"1"	"1638.86320"	"0.049"	"0.818"	"0.0028405762584529"	"0.906515362333117"	"67.75"	"64.11"	"161.6"	"8.7"	"129.7"	"56.71"	"49.53"	"23.94"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007788"	"3.84"	"28.44"
"9954"	"False"	"High"	"[R].DVNGVTKSR.[F]"	"1xBiotin [K7]"	"0.0331284"	"0.0007621"	"1"	"1"	"6"	"Q9CZV8-1"	"Q9CZV8-1 [4-12]"	"Q9CZV8-1 1xBiotin [K10]"	"1"	"1201.59938"	"0.456"	"0.621"	"0.931513090357645"	"0.906515362333117"	"68.22"	"89.67"	"125.4"	"77.4"	"97.2"	"53.67"	"32.67"	"49.31"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002212"	"2.13"	"28.11"
"9955"	"False"	"High"	"[K].DVNLSKTEK.[M]"	"1xBiotin [K6]"	"0.0225248"	"0.0007621"	"1"	"3"	"6"	"Q8R4D1"	"Q8R4D1 [483-491]"	"Q8R4D1 1xBiotin [K488]"	"1"	"1259.63001"	"14.159"	"0.605"	"0.835322069431012"	"0.906515362333117"	"58.86"	"49.79"	"20.6"	"266.1"	"13.3"	"29.75"	"101.82"	"48.65"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0006427"	"0.001533"	"2.37"	"33.70"
"59348"	"False"	"High"	"[K].SESGWWFCQMK.[T]"	"1xCarbamidomethyl [C8]; 1xOxidation [M10]"	"0.0205416"	"0.0007621"	"1"	"1"	"5"	"Q09014"	"Q09014 [189-199]"	""	"0"	"1461.59258"	"85.149"	"1.366"	"0.528662158103966"	"0.913654994205556"	"61.58"	"57.06"	"3.5"	"291.3"	"5.2"	"46.63"	"49.70"	"35.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001405"	"2.07"	"46.44"
"59347"	"False"	"High"	"[K].SESGWWFCQMK.[T]"	"1xCarbamidomethyl [C8]"	"0.0185022"	"0.0007621"	"1"	"1"	"2"	"Q09014"	"Q09014 [189-199]"	""	"0"	"1445.59767"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001275"	"1.94"	""
"9968"	"False"	"High"	"[R].DVPISEVNKMFFLGAK.[E]"	"1xBiotin [K9]; 1xOxidation [M10]"	"0.0122426"	"0.0007621"	"1"	"1"	"3"	"Q9JHG1"	"Q9JHG1 [113-128]"	"Q9JHG1 1xBiotin [K121]"	"1"	"2037.01838"	"0.682"	"0.694"	"0.928461841781804"	"0.906515362333117"	"53.98"	"44.70"	"124.8"	"88.7"	"86.5"	"38.44"	"40.88"	"26.75"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0003479"	"0.0008796"	"2.19"	"57.68"
"4505"	"False"	"High"	"[K].AVPQLQGYLR.[S]"	""	"0.0302281"	"0.0007621"	"1"	"1"	"8"	"P47911"	"P47911 [271-280]"	""	"0"	"1144.64732"	"133.492"	"3.146"	"0.925138005747468"	"0.906515362333117"	"82.22"	"83.10"	"2.1"	"290.7"	"7.2"	"77.86"	"40.22"	"28.81"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002029"	"1.92"	"41.28"
"59242"	"False"	"High"	"[R].SEKAASFK.[L]"	"1xBiotin [K3]"	"0.00528337"	"0.0007621"	"1"	"1"	"25"	"Q9Z0F8"	"Q9Z0F8 [806-813]"	"Q9Z0F8 1xBiotin [K808]"	"1"	"1093.53466"	"0.032"	"0.541"	"7.09049378902528E-05"	"0.906515362333117"	"554.93"	"28.68"	"192.1"	"5.6"	"102.3"	"23.18"	"108.50"	"9.60"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004095"	"2.80"	"30.71"
"59241"	"False"	"High"	"[K].SEHITKNIHK.[A]"	"1xBiotin [K6]"	"0.0038541"	"0.0007621"	"1"	"2"	"13"	"Q920B0"	"Q920B0 [884-893]"	"Q920B0 1xBiotin [K889]"	"1"	"1432.73654"	"0.097"	"0.868"	"0.00666482858032578"	"0.906515362333117"	"73.44"	"41.41"	"153.1"	"15.4"	"131.5"	"45.57"	"212.87"	"33.62"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003056"	"3.03"	"25.23"
"58919"	"False"	"High"	"[R].SCTTLENYNFELYDGLKHK.[V]"	"1xBiotin [K19]; 1xCarbamidomethyl [C2]"	"0.00366802"	"0.0007621"	"1"	"4"	"2"	"O35375-1"	"O35375-1 [901-919]"	"O35375-1 1xBiotin [K919]"	"1"	"2558.16902"	"1.045"	"1.894"	""	"0.983025330649738"	"63.92"	"69.76"	"65.8"	"79.9"	"154.3"	"41.93"	"54.31"	"51.99"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002933"	"4.13"	"52.02"
"58871"	"False"	"High"	"[K].SCNCLLLK.[V]"	"2xCarbamidomethyl [C2; C4]"	"0.015099"	"0.0007621"	"1"	"1"	"6"	"P17182"	"P17182 [336-343]"	""	"0"	"1007.50125"	"163.742"	"6.528"	"0.466031980976297"	"0.906515362333117"	"48.15"	"50.57"	"1.9"	"284.5"	"13.7"	"42.19"	"29.95"	"27.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.001058"	"2.15"	"31.61"
"10172"	"False"	"High"	"[R].DYVFYLAVGNYR.[L]"	""	"0.00551709"	"0.0007621"	"1"	"1"	"6"	"Q9CQ92"	"Q9CQ92 [72-83]"	""	"0"	"1479.72669"	"107.357"	"2.827"	"0.47240665661602"	"0.906515362333117"	"44.15"	"81.66"	"2.7"	"289.8"	"7.5"	"35.34"	"33.26"	"73.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0004265"	"2.58"	"55.69"
"64033"	"False"	"High"	"[R].TGPPGPTAAYHKQVSLSHV.[-]"	"1xBiotin [K12]"	"0.00597889"	"0.0007621"	"1"	"1"	"4"	"Q9EQD0"	"Q9EQD0 [567-585]"	"Q9EQD0 1xBiotin [K578]"	"1"	"2173.08588"	"0.433"	"0.988"	"0.925138005747468"	"0.906515362333117"	"97.87"	"92.93"	"131.0"	"61.2"	"107.8"	"67.45"	"41.80"	"58.54"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002312"	"0.0004576"	"3.10"	"41.76"
"63851"	"False"	"High"	"[R].TFSWASVTSK.[N]"	""	"0.00392629"	"0.0007621"	"1"	"1"	"7"	"P97855"	"P97855 [246-255]"	""	"0"	"1113.55750"	"212.792"	"8.528"	"0.925138005747468"	"0.906515362333117"	"59.82"	"66.23"	"1.5"	"287.3"	"11.2"	"47.39"	"46.50"	"51.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003116"	"2.44"	"41.77"
"8782"	"False"	"High"	"[R].DNIQGITKPAIR.[R]"	""	"0.0144613"	"0.0007621"	"1"	"1"	"1"	"P62806"	"P62806 [25-36]"	""	"0"	"1325.75357"	"122.779"	"1.655"	"0.508455572107838"	""	"56.00"	"51.22"	"2.1"	"293.9"	"4.0"	"40.10"	"49.51"	"32.21"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.001018"	"2.60"	"29.24"
"60261"	"False"	"High"	"[K].SLASIVQFYYMWK.[T]"	"1xOxidation [M11]"	"0.0134297"	"0.0007621"	"1"	"1"	"1"	"Q9R190"	"Q9R190 [299-311]"	""	"0"	"1651.81888"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009532"	"2.62"	""
"63228"	"False"	"High"	"[K].TAKLILER.[F]"	"1xBiotin [K3]"	"0.00334298"	"0.0007621"	"1"	"1"	"8"	"Q7TQ95"	"Q7TQ95 [131-138]"	"Q7TQ95 1xBiotin [K133]"	"1"	"1169.67109"	"0.047"	"0.758"	"0.00137004363932709"	"0.906515362333117"	"52.40"	"31.59"	"167.6"	"8.1"	"124.3"	"25.03"	"45.79"	"32.20"	""	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002686"	"2.76"	"42.40"
"62174"	"False"	"High"	"[R].SSGVSYKYSK.[V]"	"1xBiotin [K7]"	"0.0347849"	"0.0007621"	"1"	"1"	"1"	"Q07113"	"Q07113 [2336-2345]"	"Q07113 1xBiotin [K2342]"	"1"	"1331.63001"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.000686"	"0.002321"	"2.20"	""
"7447"	"False"	"High"	"[R].DFSYNYFGFK.[T]"	""	"0.011023"	"0.0007621"	"1"	"1"	"5"	"P07742"	"P07742 [140-149]"	""	"0"	"1287.56807"	"177.356"	"1.389"	"0.240909553008262"	"0.952728074834293"	"87.85"	"68.93"	"1.8"	"295.6"	"2.6"	"36.07"	"61.20"	"106.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007984"	"2.30"	"53.66"
"7467"	"False"	"High"	"[R].DFYLSVYFFK.[K]"	""	"0.0284345"	"0.0007621"	"1"	"1"	"5"	"Q3U821"	"Q3U821 [174-183]"	""	"0"	"1328.65615"	"50.979"	"1.859"	"0.925138005747468"	"0.96247554139247"	"55.32"	"56.71"	"5.5"	"284.0"	"10.5"	"44.43"	"33.13"	"49.56"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.001903"	"1.62"	"63.37"
"62147"	"False"	"High"	"[K].SSGGFVWACK.[N]"	"1xCarbamidomethyl [C9]"	"0.0251555"	"0.0007621"	"1"	"1"	"1"	"P54071"	"P54071 [300-309]"	""	"0"	"1098.50369"	"58.092"	"2.269"	"0.925138005747468"	"0.906515362333117"	"71.63"	"60.95"	"4.5"	"282.8"	"12.8"	"42.83"	"69.89"	"88.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001697"	"1.79"	"37.67"
"4625"	"False"	"High"	"[R].AWGPGLHGGIVGR.[S]"	""	"0.0236586"	"0.0007621"	"1"	"1"	"6"	"Q80X90"	"Q80X90 [554-566]"	""	"0"	"1276.69091"	"158.884"	"4.505"	"0.803011281197749"	"0.906515362333117"	"55.54"	"66.96"	"1.5"	"291.3"	"7.2"	"42.05"	"31.14"	"59.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001602"	"2.65"	"35.91"
"62132"	"False"	"High"	"[K].SSFLIMWR.[R]"	"1xOxidation [M6]"	"0.0125486"	"0.0007621"	"1"	"2"	"13"	"Q9CQ80"	"Q9CQ80 [95-102]"	""	"0"	"1055.53426"	"251.400"	"4.341"	"0.925138005747468"	"0.906515362333117"	"63.20"	"63.69"	"1.2"	"294.1"	"4.7"	"52.41"	"31.19"	"37.57"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0008989"	"2.35"	"49.70"
"7609"	"False"	"High"	"[K].DGKNNVADITGPIILQTYR.[A]"	"1xBiotin [K3]"	"0.0151924"	"0.0007621"	"1"	"1"	"5"	"Q09014"	"Q09014 [144-162]"	"Q09014 1xBiotin [K146]"	"1"	"2314.18599"	"0.677"	"0.941"	"0.925138005747468"	"0.906515362333117"	"51.82"	"71.51"	"121.9"	"79.8"	"98.3"	"44.13"	"44.81"	"57.16"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0004044"	"0.001065"	"3.15"	"56.76"
"61912"	"False"	"High"	"[K].SRFWYFVSQLK.[K]"	""	"0.0152863"	"0.0007621"	"1"	"1"	"15"	"P62717"	"P62717 [42-52]"	""	"1"	"1460.76850"	"188.052"	"6.407"	"0.925138005747468"	"0.906515362333117"	"63.86"	"54.95"	"2.0"	"288.3"	"9.7"	"38.12"	"64.45"	"43.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0004044"	"0.001074"	"2.98"	"54.30"
"62191"	"False"	"High"	"[R].SSHSNAYFYGFFK.[N]"	""	"0.00605328"	"0.0007621"	"1"	"1"	"5"	"Q80W54"	"Q80W54 [261-273]"	""	"0"	"1554.70120"	"69.754"	"2.822"	"0.925138005747468"	"0.906515362333117"	"70.25"	"48.02"	"3.8"	"284.9"	"11.2"	"45.01"	"66.10"	"18.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002312"	"0.000463"	"3.12"	"47.61"
"7727"	"False"	"High"	"[K].DGSGFLINLIDSPGHVDFSSEVTAALR.[V]"	""	"0.00664149"	"0.0007621"	"1"	"1"	"1"	"P58252"	"P58252 [94-120]"	""	"0"	"2817.40536"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005053"	"2.26"	""
"61756"	"False"	"High"	"[K].SQLYTVKYK.[D]"	"1xBiotin [K7]"	"0.0156678"	"0.0007621"	"1"	"1"	"6"	"Q3U9G9"	"Q3U9G9 [34-42]"	"Q3U9G9 1xBiotin [K40]"	"1"	"1355.70278"	"0.240"	"0.625"	"0.925138005747468"	"0.906515362333117"	"89.27"	"115.63"	"184.7"	"35.4"	"80.0"	"66.04"	"40.91"	"126.32"	""	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.000459"	"0.001097"	"2.04"	"39.18"
"4624"	"False"	"High"	"[R].AWGILTFK.[G]"	""	"0.0182758"	"0.0007621"	"1"	"1"	"9"	"Q9JIK9"	"Q9JIK9 [114-121]"	""	"0"	"935.53491"	"156.861"	"3.997"	"0.925138005747468"	"0.906515362333117"	"78.91"	"83.48"	"1.9"	"289.2"	"8.9"	"65.17"	"65.91"	"77.61"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001258"	"2.22"	"52.48"
"7864"	"False"	"High"	"[K].DHTQVVSLKDKLEFAPK.[A]"	"1xBiotin [K]"	"0.00579687"	"0.0007621"	"1"	"1"	"7"	"Q78RX3"	"Q78RX3 [65-81]"	"Q78RX3 1xBiotin [K]"	"2"	"2181.13725"	"0.223"	"0.918"	"0.925138005747468"	"0.913702580837398"	"71.88"	"64.60"	"145.4"	"42.3"	"112.3"	"55.11"	"42.78"	"43.05"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002312"	"0.0004463"	"3.34"	"47.71"
"61713"	"False"	"High"	"[K].SQHNAPKVK.[S]"	"1xBiotin [K7]"	"0.00962271"	"0.0007621"	"1"	"1"	"11"	"O88455"	"O88455 [5-13]"	"O88455 1xBiotin [K11]"	"1"	"1234.63610"	"0.092"	"1.060"	"0.00625641360415653"	"0.916215054610739"	"75.78"	"68.69"	"130.6"	"13.7"	"155.8"	"60.66"	"185.60"	"21.54"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007047"	"3.15"	"18.69"
"61694"	"False"	"High"	"[R].SQETYETLKHEKPPQ.[-]"	"1xBiotin [K]"	"0.00933004"	"0.0007621"	"1"	"1"	"9"	"P20491"	"P20491 [72-86]"	"P20491 1xBiotin [K]"	"1"	"2040.96952"	"0.201"	"1.175"	"0.0199394926997096"	"0.916215054610739"	"100.14"	"45.10"	"125.2"	"23.4"	"151.4"	"54.79"	"212.25"	"23.52"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006874"	"3.17"	"36.79"
"61646"	"False"	"High"	"[K].SPYLYPLYGLGELPQGFAR.[L]"	""	"0.003448"	"0.0007621"	"1"	"3"	"5"	"Q61598"	"Q61598 [222-240]"	""	"0"	"2141.10660"	"1.366"	"1.078"	"0.925138005747468"	""	"81.29"	"57.59"	"82.3"	"121.2"	"96.5"	"43.52"	"213.56"	"38.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002765"	"3.37"	"62.04"
"7876"	"False"	"High"	"[R].DKAALGYDYKGETEK.[H]"	"1xBiotin [K2]"	"0.0262584"	"0.0007621"	"1"	"1"	"1"	"P49710"	"P49710 [169-183]"	"P49710 1xBiotin [K170]"	"2"	"1913.89495"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001767"	"2.50"	""
"63021"	"False"	"High"	"[R].SWLSYSYQSR.[F]"	""	"0.00397516"	"0.0007621"	"1"	"2"	"11"	"Q921M3-1"	"Q921M3-1 [719-728]"	""	"0"	"1276.59568"	"353.282"	"7.065"	"0.925138005747468"	"0.906515362333117"	"80.58"	"62.09"	"0.8"	"293.1"	"6.1"	"51.44"	"69.12"	"36.74"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003157"	"2.20"	"41.66"
"7752"	"False"	"High"	"[K].DGTEAMLVLK.[-]"	"1xBiotin [K10]"	"0.00281127"	"0.0007621"	"1"	"1"	"7"	"Q8K358"	"Q8K358 [425-434]"	"Q8K358 1xBiotin [K434]"	"0"	"1302.64322"	"0.295"	"0.870"	"0.925138005747468"	"0.906515362333117"	"28.89"	"42.87"	"134.8"	"42.1"	"123.1"	"21.55"	"19.34"	"43.59"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002286"	"2.13"	"56.75"
"62251"	"False"	"High"	"[R].SSISHSVLSEMQMIEQETPLSAKSSR.[S]"	"1xBiotin [K23]"	"0.0131835"	"0.0007621"	"1"	"2"	"1"	"Q99K28"	"Q99K28 [313-338]"	"Q99K28 1xBiotin [K335]"	"1"	"3088.47478"	"0.593"	"1.673"	""	"0.938162963724392"	"39.82"	"48.43"	"96.6"	"56.9"	"146.5"	"33.82"	"30.31"	"48.06"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009408"	"3.36"	"59.98"
"62264"	"False"	"High"	"[R].SSIWQFFSR.[L]"	""	"0.00472679"	"0.0007621"	"1"	"6"	"8"	"Q58A65"	"Q58A65 [550-558]"	""	"0"	"1157.57382"	"105.341"	"2.757"	"0.460755515898751"	"0.924093719723529"	"66.06"	"63.61"	"2.7"	"289.3"	"7.9"	"39.55"	"43.23"	"39.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.00037"	"2.35"	"58.30"
"62984"	"False"	"High"	"[K].SVVLYVILAPFDNEQSDLVHR.[I]"	""	"0.00355631"	"0.0007621"	"1"	"1"	"5"	"Q9D8W5"	"Q9D8W5 [269-289]"	""	"0"	"2414.27144"	"2.258"	"1.371"	"0.929016530787821"	"0.906515362333117"	"87.10"	"64.20"	"88.0"	"121.6"	"90.4"	"47.09"	"145.84"	"53.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002851"	"2.52"	"63.35"
"62715"	"False"	"High"	"[R].SVAGKLSVFANGVMTSIQDR.[Y]"	"1xBiotin [K5]"	"0.00304672"	"0.0007621"	"1"	"1"	"1"	"Q9D8S3"	"Q9D8S3 [501-520]"	"Q9D8S3 1xBiotin [K505]"	"1"	"2306.16315"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.000247"	"3.46"	""
"62714"	"False"	"High"	"[R].SVAGGFVYTYK.[L]"	""	"0.00512251"	"0.0007621"	"1"	"2"	"3"	"Q921M3-1"	"Q921M3-1 [919-929]"	""	"0"	"1191.60445"	"73.669"	"1.157"	"0.69920017797184"	"0.906515362333117"	"68.90"	"68.53"	"4.7"	"290.2"	"5.1"	"46.32"	"61.14"	"58.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0001583"	"0.0003986"	"2.35"	"38.23"
"5663"	"False"	"High"	"[K].CMPTFQFYK.[K]"	"1xCarbamidomethyl [C1]"	"0.01116"	"0.0007621"	"1"	"1"	"5"	"P10639"	"P10639 [73-81]"	""	"0"	"1221.54311"	"46.959"	"6.220"	"0.952239842749319"	"0.906515362333117"	"79.36"	"61.67"	"5.6"	"263.9"	"30.6"	"49.17"	"64.47"	"39.07"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008049"	"1.78"	"46.15"
"5664"	"False"	"High"	"[K].CMPTFQFYK.[K]"	"1xCarbamidomethyl [C1]; 1xOxidation [M2]"	"0.00733195"	"0.0007621"	"1"	"1"	"23"	"P10639"	"P10639 [73-81]"	""	"0"	"1237.53803"	"425.330"	"5.381"	"0.852034109887306"	"0.906515362333117"	"51.23"	"63.73"	"0.6"	"295.8"	"3.6"	"63.52"	"43.41"	"86.95"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005502"	"2.13"	"40.39"
"62674"	"False"	"High"	"[K].STTTIGLVQALGAHLR.[Q]"	""	"0.0172908"	"0.0007621"	"1"	"1"	"1"	"Q922D8"	"Q922D8 [387-402]"	""	"0"	"1637.93333"	"1.324"	"1.610"	"0.94340856990521"	"0.916215054610739"	"58.43"	"61.52"	"75.8"	"110.4"	"113.8"	"37.42"	"207.48"	"54.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0005416"	"0.001199"	"2.75"	"53.11"
"4702"	"False"	"High"	"[R].AYPFYWAWLPQAK.[V]"	""	"0.0311661"	"0.0007621"	"1"	"1"	"2"	"Q2TBE6"	"Q2TBE6 [361-373]"	""	"0"	"1640.82601"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006486"	"0.002082"	"2.17"	""
"62871"	"False"	"High"	"[K].SVLTGGLDALEFIGKK.[T]"	"1xBiotin [K]"	"0.00392629"	"0.0007621"	"1"	"1"	"2"	"Q9D281"	"Q9D281 [223-238]"	"Q9D281 1xBiotin [K]"	"1"	"1874.00920"	"1.029"	"1.154"	"0.925138005747468"	"0.906515362333117"	"41.39"	"67.89"	"91.9"	"97.5"	"110.6"	"26.82"	"28.42"	"62.75"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003122"	"2.97"	"62.53"
"62560"	"False"	"High"	"[K].STGGAPTFNVTVTMTAK.[T]"	"1xOxidation [M14]"	"0.00346939"	"0.0007621"	"1"	"1"	"9"	"P62962"	"P62962 [92-108]"	""	"0"	"1698.83671"	"142.227"	"2.127"	"0.454924058924831"	"0.995674964380212"	"46.75"	"64.79"	"1.9"	"293.7"	"4.4"	"43.25"	"35.99"	"46.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002787"	"2.83"	"36.32"
"62559"	"False"	"High"	"[K].STGGAPTFNVTVTMTAK.[T]"	""	"0.00428144"	"0.0007621"	"1"	"1"	"2"	"P62962"	"P62962 [92-108]"	""	"0"	"1682.84180"	"1.177"	"1.972"	""	"0.995161625036163"	"59.06"	"51.47"	"78.4"	"84.2"	"137.5"	"35.27"	"40.25"	"41.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003376"	"2.73"	"42.33"
"62543"	"False"	"High"	"[K].STEVAKTFR.[K]"	"1xBiotin [K6]"	"0.0046399"	"0.0007621"	"1"	"1"	"14"	"Q61233"	"Q61233 [83-91]"	"Q61233 1xBiotin [K88]"	"1"	"1264.63543"	"0.027"	"0.853"	"5.09415307722964E-05"	"0.906515362333117"	"83.20"	"30.08"	"155.1"	"4.2"	"140.7"	"19.15"	"64.19"	"22.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003641"	"2.77"	"36.07"
"62912"	"False"	"High"	"[K].SVPSWFVR.[V]"	""	"0.0196762"	"0.0007621"	"1"	"1"	"10"	"Q8BU30"	"Q8BU30 [411-418]"	""	"0"	"977.52033"	"169.226"	"4.489"	"0.925138005747468"	"0.906515362333117"	"27.69"	"29.32"	"1.7"	"291.0"	"7.3"	"25.95"	"16.79"	"17.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0005902"	"0.001352"	"2.02"	"44.50"
"4644"	"False"	"High"	"[K].AWNAYPYCR.[T]"	"1xCarbamidomethyl [C8]"	"0.00515428"	"0.0007621"	"2"	"2"	"14"	"P53810; P53811"	"P53810 [88-96]; P53811 [87-95]"	""	"0"	"1200.52549"	"164.616"	"5.329"	"0.925138005747468"	"0.906515362333117"	"78.67"	"63.61"	"1.8"	"289.7"	"8.4"	"74.31"	"36.14"	"28.08"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004012"	"2.28"	"35.41"
"62497"	"False"	"High"	"[R].SSWYWGR.[L]"	""	"0.0229436"	"0.0007621"	"1"	"2"	"22"	"Q64010-1"	"Q64010-1 [11-17]"	""	"0"	"941.42643"	"132.566"	"4.099"	"0.925138005747468"	"0.906515362333117"	"81.72"	"85.86"	"2.5"	"285.9"	"11.7"	"112.73"	"50.46"	"62.87"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001557"	"2.12"	"41.01"
"6212"	"False"	"High"	"[K].CSWLVVQCLLR.[A]"	"2xCarbamidomethyl [C1; C8]"	"0.00428144"	"0.0007621"	"1"	"1"	"2"	"Q920E5"	"Q920E5 [267-277]"	""	"0"	"1433.73919"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003377"	"2.81"	""
"62443"	"False"	"High"	"[R].SSTLSQLPGDKSK.[A]"	"1xBiotin [K11]"	"0.00904624"	"0.0007621"	"1"	"6"	"3"	"Q58A65"	"Q58A65 [593-605]"	"Q58A65 1xBiotin [K603]"	"1"	"1573.78903"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006666"	"3.07"	""
"62385"	"False"	"High"	"[K].SSSIASFK.[D]"	""	"0.0280885"	"0.0007621"	"1"	"1"	"6"	"Q61233"	"Q61233 [535-542]"	""	"0"	"826.43051"	"184.668"	"5.958"	"0.514471575505833"	"0.906515362333117"	"86.89"	"81.15"	"1.4"	"289.1"	"9.4"	"64.85"	"50.39"	"16.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001884"	"1.81"	"24.86"
"62323"	"False"	"High"	"[K].SSPTVDKAQLK.[T]"	"1xBiotin [K7]"	"0.00893515"	"0.0007621"	"1"	"1"	"7"	"Q99LI2"	"Q99LI2 [497-507]"	"Q99LI2 1xBiotin [K503]"	"1"	"1399.72498"	"0.685"	"0.985"	"0.947989303413716"	"0.906515362333117"	"68.87"	"71.54"	"111.7"	"77.4"	"110.9"	"58.50"	"24.10"	"51.71"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006613"	"2.50"	"35.63"
"6631"	"False"	"High"	"[R].DAIILIFANK.[Q]"	""	"0.0193165"	"0.0007621"	"1"	"1"	"1"	"P62331"	"P62331 [114-123]"	""	"0"	"1117.66157"	"33.772"	"0.876"	"0.925138005747468"	""	"61.08"	"52.57"	"8.2"	"285.3"	"6.5"	"33.23"	"59.55"	"41.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001331"	"2.08"	"55.10"
"6739"	"False"	"High"	"[K].DAVNWLGYAYLYIR.[M]"	""	"0.00472679"	"0.0007621"	"1"	"1"	"2"	"Q6P4T2"	"Q6P4T2 [915-928]"	""	"0"	"1716.87442"	"1.956"	"1.221"	"0.925138005747468"	"0.906515362333117"	"96.81"	"72.31"	"77.8"	"118.8"	"103.4"	"49.53"	"141.21"	"46.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003694"	"2.42"	"66.25"
"4612"	"False"	"High"	"[K].AVYQGPGSSPVKS.[-]"	"1xBiotin [K12]"	"0.00270882"	"0.0007621"	"1"	"2"	"19"	"O88587-1"	"O88587-1 [253-265]"	"O88587-1 1xBiotin [K264]"	"1"	"1502.73079"	"0.034"	"0.833"	"5.71877297220621E-05"	"0.906515362333117"	"37.10"	"18.70"	"156.6"	"5.5"	"137.9"	"25.39"	"45.49"	"15.44"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000221"	"3.34"	"38.01"
"61597"	"False"	"High"	"[R].SPTLVIAYLMMR.[Q]"	"2xOxidation [M10; M11]"	"0.00664149"	"0.0007621"	"1"	"1"	"1"	"Q9D7X3"	"Q9D7X3 [131-142]"	""	"0"	"1426.74327"	"1.753"	"1.372"	"0.321473973677668"	""	"55.13"	"56.99"	"60.1"	"126.7"	"113.2"	"40.15"	"241.49"	"31.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005053"	"2.80"	"52.39"
"61596"	"False"	"High"	"[R].SPTLVIAYLMMR.[Q]"	"1xOxidation [M11]"	"0.0214446"	"0.0007621"	"1"	"1"	"1"	"Q9D7X3"	"Q9D7X3 [131-142]"	""	"0"	"1410.74835"	"1.314"	"1.013"	"0.964150902908502"	"0.906515362333117"	"78.54"	"37.55"	"98.8"	"108.7"	"92.5"	"34.28"	"173.32"	"31.16"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001457"	"2.43"	"60.25"
"7894"	"False"	"High"	"[K].DKDKALPSFWIPSLTPEAK.[A]"	"1xBiotin [K]"	"0.026098"	"0.0007621"	"1"	"2"	"2"	"Q9D6T0-1"	"Q9D6T0-1 [154-172]"	"Q9D6T0-1 1xBiotin [K]"	"2"	"2369.22098"	"1.235"	"1.671"	"0.925138005747468"	"0.936238272383155"	"48.65"	"57.31"	"71.8"	"109.4"	"118.8"	"39.78"	"30.84"	"58.98"	""	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0006427"	"0.001759"	"3.84"	"60.33"
"60656"	"False"	"High"	"[K].SIPEKFVVDK.[S]"	"1xBiotin [K5]"	"0.0253102"	"0.0007621"	"1"	"1"	"3"	"Q8R502"	"Q8R502 [215-224]"	"Q8R502 1xBiotin [K219]"	"1"	"1387.72900"	"0.192"	"0.879"	"0.925138005747468"	"0.906515362333117"	"70.51"	"51.38"	"133.1"	"29.0"	"137.9"	"58.75"	"46.10"	"47.08"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0006427"	"0.001701"	"2.04"	"45.83"
"8507"	"False"	"High"	"[R].DLSYCLSGMYDHR.[Y]"	"1xCarbamidomethyl [C5]"	"0.00239351"	"0.0007621"	"1"	"2"	"11"	"Q9Z2X1-1"	"Q9Z2X1-1 [263-275]"	""	"0"	"1616.68319"	"1.642"	"1.638"	"0.925138005747468"	"0.998316466510713"	"154.95"	"56.29"	"70.8"	"106.4"	"122.8"	"58.26"	"132.91"	"28.61"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000197"	"2.68"	"42.18"
"60626"	"False"	"High"	"[K].SINPLGGFVHYGEVTNDFIMLK.[G]"	"1xOxidation [M20]"	"0.00243836"	"0.0007621"	"1"	"1"	"6"	"P27659"	"P27659 [313-334]"	""	"0"	"2467.23261"	"103.821"	"1.388"	"0.434188231119637"	"0.906515362333117"	"78.33"	"107.10"	"2.7"	"292.3"	"5.0"	"52.48"	"67.80"	"86.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002008"	"3.67"	"59.52"
"60609"	"False"	"High"	"[K].SLNILTAFR.[K]"	""	"0.00458286"	"0.0007621"	"1"	"1"	"7"	"P57759"	"P57759 [245-253]"	""	"0"	"1034.59931"	"199.272"	"4.835"	"0.925138005747468"	"0.906515362333117"	"104.30"	"105.01"	"1.1"	"293.6"	"5.4"	"79.16"	"30.96"	"40.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003596"	"2.68"	"53.39"
"4567"	"False"	"High"	"[K].AVTLAGSWR.[V]"	""	"0.0205416"	"0.0007621"	"1"	"1"	"6"	"Q99ME2"	"Q99ME2 [353-361]"	""	"0"	"960.52614"	"194.131"	"5.129"	"0.925138005747468"	"0.906515362333117"	"47.82"	"43.60"	"1.6"	"290.8"	"7.7"	"36.12"	"33.96"	"33.54"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000628"	"0.001407"	"1.89"	"36.40"
"63095"	"False"	"High"	"[K].SYLYFTQFK.[A]"	""	"0.00466869"	"0.0007621"	"1"	"1"	"29"	"Q9CPT4"	"Q9CPT4 [94-102]"	""	"0"	"1196.59864"	"139.959"	"3.817"	"0.925138005747468"	"0.906515362333117"	"67.10"	"60.27"	"1.9"	"291.0"	"7.1"	"48.58"	"43.90"	"36.90"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003647"	"2.65"	"49.01"
"63138"	"False"	"High"	"[K].SYVITGSWNPK.[S]"	""	"0.0053823"	"0.0007621"	"1"	"2"	"2"	"A2AWA9"	"A2AWA9 [373-383]"	""	"0"	"1251.63681"	"66.779"	"1.350"	"0.481285487216449"	"0.906515362333117"	"59.34"	"34.78"	"4.4"	"290.7"	"4.9"	"16.60"	"68.98"	"42.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0004155"	"2.11"	"39.39"
"8546"	"False"	"High"	"[K].DLVKNMPFLK.[V]"	"1xBiotin [K4]; 1xOxidation [M6]"	"0.0025621"	"0.0007621"	"1"	"1"	"12"	"Q8R0X7"	"Q8R0X7 [98-107]"	"Q8R0X7 1xBiotin [K101]"	"1"	"1446.74835"	"0.070"	"0.631"	"0.00209043715235711"	"0.906515362333117"	"61.22"	"36.61"	"170.7"	"12.6"	"116.7"	"29.23"	"54.08"	"29.04"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002102"	"2.85"	"46.39"
"60525"	"False"	"High"	"[R].SLINSQAGFVTMILR.[C]"	""	"0.00472679"	"0.0007621"	"1"	"1"	"3"	"Q9JIK5"	"Q9JIK5 [700-714]"	""	"0"	"1649.90434"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003689"	"3.24"	""
"60483"	"False"	"High"	"[R].SIIGSKGLDR.[S]"	"1xBiotin [K6]"	"0.0053823"	"0.0007621"	"1"	"2"	"21"	"Q8R1A4"	"Q8R1A4 [917-926]"	"Q8R1A4 1xBiotin [K922]"	"1"	"1271.67763"	"0.015"	"0.728"	"1.66839201882489E-05"	"0.906515362333117"	"52.01"	"56.95"	"175.0"	"2.9"	"122.2"	"40.49"	"42.28"	"39.08"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004169"	"2.54"	"40.57"
"60480"	"False"	"High"	"[K].SLLGKDVLFLK.[D]"	"1xBiotin [K5]"	"0.0160588"	"0.0007621"	"1"	"1"	"2"	"P09411"	"P09411 [87-97]"	"P09411 1xBiotin [K91]"	"1"	"1458.83888"	"0.608"	"0.557"	"0.926317884229189"	"0.906515362333117"	"84.82"	"85.86"	"137.1"	"86.6"	"76.3"	"73.75"	"19.56"	"24.57"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005064"	"0.001122"	"1.96"	"60.17"
"60433"	"False"	"High"	"[R].SLKGPGK.[H]"	"1xBiotin [K3]"	"0.0347849"	"0.0007621"	"1"	"1"	"9"	"Q7TPN9"	"Q7TPN9 [187-193]"	"Q7TPN9 1xBiotin [K189]"	"1"	"912.49715"	"0.146"	"0.893"	"0.925138005747468"	"0.906515362333117"	"67.56"	"77.39"	"131.4"	"21.7"	"146.8"	"54.25"	"53.31"	"55.87"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.000686"	"0.002323"	"2.10"	"26.71"
"8687"	"False"	"High"	"[K].DMVAEIEWFGAKGIDK.[E]"	"1xBiotin [K12]; 1xOxidation [M2]"	"0.0186164"	"0.0007621"	"1"	"1"	"2"	"Q8VBT6"	"Q8VBT6 [222-237]"	"Q8VBT6 1xBiotin [K233]"	"1"	"2050.96126"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.00128"	"2.57"	""
"60424"	"False"	"High"	"[K].SIKDGFSFCIPVSADGFK.[F]"	"1xBiotin [K3]; 1xCarbamidomethyl [C9]"	"0.0211827"	"0.0007621"	"1"	"1"	"1"	"Q9ERU9"	"Q9ERU9 [1719-1736]"	"Q9ERU9 1xBiotin [K1721]"	"1"	"2201.04057"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001447"	"2.05"	""
"4566"	"False"	"High"	"[K].AVTKYTSSK.[-I]"	"1xBiotin [K4]"	"0.0148224"	"0.0007621"	"2"	"11"	"4"	"Q64525; Q6ZWY9"	"Q64525 [118-126]; Q6ZWY9 [118-126]"	"Q64525 1xBiotin [K121]; Q6ZWY9 1xBiotin [K121]"	"1"	"1210.61363"	"0.067"	"0.645"	"0.000339224084510144"	"0.906515362333117"	"53.91"	"73.63"	"190.9"	"13.6"	"95.6"	"52.56"	"31.67"	"51.12"	"NotUnique"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.001044"	"2.18"	"28.34"
"60406"	"False"	"High"	"[R].SLGWMVSR.[C]"	"1xOxidation [M5]"	"0.0270753"	"0.0007621"	"1"	"1"	"1"	"Q07797"	"Q07797 [105-112]"	""	"0"	"951.47166"	"209.176"	"2.853"	"0.925138005747468"	"0.906515362333117"	"104.91"	"70.87"	"1.3"	"295.1"	"3.6"	"24.16"	"89.00"	"58.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001823"	"1.76"	"34.21"
"4548"	"False"	"High"	"[K].AVSGALLSLHFLFVR.[R]"	""	"0.0223869"	"0.0007621"	"1"	"1"	"1"	"Q8K1X4"	"Q8K1X4 [200-214]"	""	"0"	"1629.94752"	"1.691"	"1.000"	"0.925138005747468"	""	"86.47"	"88.71"	"87.7"	"146.2"	"66.1"	"59.42"	"214.72"	"65.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001525"	"2.45"	"61.74"
"60359"	"False"	"High"	"[R].SLFGYFLSDLR.[C]"	""	"0.0148224"	"0.0007621"	"1"	"1"	"3"	"Q8BZA9"	"Q8BZA9 [204-214]"	""	"0"	"1317.68376"	"102.051"	"4.172"	"0.469419424533071"	"0.906515362333117"	"66.58"	"76.63"	"2.7"	"283.3"	"14.0"	"82.94"	"59.79"	"52.16"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.001041"	"2.61"	"64.63"
"60323"	"False"	"High"	"[K].SLEEIYLFSLPIK.[E]"	""	"0.0199197"	"0.0007621"	"1"	"1"	"1"	"P25444"	"P25444 [77-89]"	""	"0"	"1551.86687"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001368"	"2.67"	""
"60662"	"False"	"High"	"[R].SLPGNAPCLKHFPLDLR.[T]"	"1xBiotin [K10]; 1xCarbamidomethyl [C8]"	"0.00299069"	"0.0007621"	"1"	"1"	"17"	"Q9DBT5"	"Q9DBT5 [19-35]"	"Q9DBT5 1xBiotin [K28]"	"1"	"2161.10451"	"0.053"	"1.152"	"0.00357096351009506"	"0.937945192250145"	"40.43"	"53.01"	"132.4"	"7.1"	"160.5"	"57.64"	"38.43"	"33.90"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002418"	"2.47"	"53.21"
"57575"	"False"	"High"	"[R].RPQYRPPYR.[Q]"	""	"0.0135128"	"0.0007621"	"1"	"1"	"13"	"Q9JKB3-1"	"Q9JKB3-1 [217-225]"	""	"0"	"1232.66470"	"125.625"	"3.992"	"0.925138005747468"	"0.906515362333117"	"82.37"	"70.44"	"3.6"	"282.8"	"13.6"	"52.80"	"67.71"	"47.84"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.000961"	"2.90"	"18.98"
"8460"	"False"	"High"	"[R].DLSAAGIGLLAAATQSLSMPASLGR.[M]"	""	"0.00664149"	"0.0007621"	"1"	"1"	"2"	"Q8K310"	"Q8K310 [20-44]"	""	"0"	"2371.26497"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005033"	"4.05"	""
"4591"	"False"	"High"	"[R].AVVKEGSVSPK.[E]"	"1xBiotin [K4]"	"0.0185022"	"0.0007621"	"1"	"1"	"1"	"Q8C0L0"	"Q8C0L0 [296-306]"	"Q8C0L0 1xBiotin [K299]"	"1"	"1326.70860"	"0.377"	"0.346"	"0.368791716056276"	"0.906515362333117"	"88.27"	"99.85"	"194.8"	"65.4"	"39.8"	"48.70"	"237.10"	"68.40"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0005416"	"0.001275"	"2.75"	"29.71"
"61459"	"False"	"High"	"[K].SPNGISDYPKIR.[V]"	"1xBiotin [K10]"	"0.00672412"	"0.0007621"	"1"	"3"	"3"	"Q91ZX6"	"Q91ZX6 [124-135]"	"Q91ZX6 1xBiotin [K133]"	"1"	"1572.78389"	"0.149"	"0.800"	"0.925138005747468"	"0.906515362333117"	"46.94"	"78.28"	"146.1"	"23.8"	"130.1"	"42.81"	"40.73"	"78.36"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005103"	"3.18"	"40.27"
"7908"	"False"	"High"	"[K].DKEKAVYAK.[M]"	"1xBiotin [K4]"	"0.0147313"	"0.0007621"	"1"	"1"	"7"	"Q9CR16"	"Q9CR16 [359-367]"	"Q9CR16 1xBiotin [K362]"	"2"	"1277.65583"	"0.159"	"0.737"	"0.0895777432677132"	"0.906515362333117"	"37.37"	"48.40"	"149.3"	"25.0"	"125.7"	"31.59"	"27.41"	"37.09"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0003479"	"0.00104"	"2.48"	"26.12"
"61418"	"False"	"High"	"[R].SPLGGPDPAELLLMGSYLGKPGPPEPALR.[Q]"	"1xBiotin [K20]; 1xOxidation [M14]"	"0.00270882"	"0.0007621"	"1"	"1"	"4"	"Q8K3Z9"	"Q8K3Z9 [116-144]"	"Q8K3Z9 1xBiotin [K135]"	"0"	"3171.62170"	"0.613"	"1.847"	""	"0.99222742129649"	"71.86"	"50.48"	"102.8"	"49.7"	"147.6"	"44.61"	"50.77"	"33.86"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002208"	"4.17"	"63.89"
"7950"	"False"	"High"	"[K].DKLEFAPK.[A]"	"1xBiotin [K2]"	"0.00706501"	"0.0007621"	"1"	"1"	"20"	"Q78RX3"	"Q78RX3 [74-81]"	"Q78RX3 1xBiotin [K75]"	"1"	"1173.59726"	"0.019"	"0.763"	"2.73109196678932E-05"	"0.906515362333117"	"50.04"	"53.02"	"177.7"	"3.3"	"119.0"	"22.69"	"43.10"	"45.43"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005331"	"2.92"	"42.99"
"8027"	"False"	"High"	"[K].DKSTYIESSTK.[V]"	"1xBiotin [K2]"	"0.00334298"	"0.0007621"	"1"	"1"	"12"	"Q8VBZ3"	"Q8VBZ3 [459-469]"	"Q8VBZ3 1xBiotin [K460]"	"1"	"1484.69374"	"0.085"	"0.921"	"0.00418669126307917"	"0.906515362333117"	"71.98"	"33.75"	"154.0"	"12.3"	"133.7"	"26.15"	"55.08"	"25.54"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002679"	"2.22"	"37.11"
"61275"	"False"	"High"	"[K].SPASDTYIVFGEAKIEDLSQQAQLAAAEK.[F]"	""	"0.0194357"	"0.0007621"	"1"	"2"	"1"	"P70670"	"P70670 [2086-2114]"	""	"1"	"3080.54225"	"1.249"	"1.079"	"0.992871679916025"	""	"50.52"	"28.57"	"92.2"	"104.9"	"102.9"	"27.60"	"222.99"	"36.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001333"	"4.27"	"59.12"
"8057"	"False"	"High"	"[R].DKYSVFNFLTLPEPAPLPTAPVPSEK.[A]"	"1xBiotin [K2]"	"0.0222498"	"0.0007621"	"1"	"1"	"3"	"Q9DBM1"	"Q9DBM1 [643-668]"	"Q9DBM1 1xBiotin [K644]"	"1"	"3083.57982"	"0.889"	"1.073"	""	"0.906515362333117"	"42.31"	"100.89"	"102.0"	"84.9"	"113.0"	"31.33"	"40.17"	"80.84"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"0.0006427"	"0.001516"	"4.22"	"67.40"
"63028"	"False"	"High"	"[R].SWSIKSAAK.[E]"	"1xBiotin [K5]"	"0.0190803"	"0.0007621"	"1"	"2"	"3"	"Q3U1N2-1"	"Q3U1N2-1 [763-771]"	"Q3U1N2-1 1xBiotin [K767]"	"1"	"1203.61905"	"0.268"	"0.966"	"0.925138005747468"	"0.906515362333117"	"88.28"	"41.23"	"133.8"	"36.9"	"129.3"	"7.45"	"234.66"	"33.14"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0005416"	"0.00131"	"2.65"	"41.72"
"61237"	"False"	"High"	"[R].SNWQNYR.[Q]"	""	"0.029139"	"0.0007621"	"1"	"1"	"8"	"Q569Z6"	"Q569Z6 [109-115]"	""	"0"	"967.43805"	"174.820"	"5.554"	"0.925138005747468"	"0.906515362333117"	"79.20"	"84.28"	"1.6"	"289.6"	"8.8"	"60.99"	"43.51"	"47.24"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0006486"	"0.001956"	"1.75"	"25.87"
"63029"	"False"	"High"	"[R].SWSLVTFR.[T]"	""	"0.0238043"	"0.0007621"	"1"	"16"	"6"	"Q9QXS1-1"	"Q9QXS1-1 [1053-1060]"	""	"0"	"995.53089"	"128.524"	"3.409"	"0.933451859704016"	"0.906515362333117"	"60.13"	"51.87"	"2.3"	"290.9"	"6.8"	"52.34"	"27.91"	"24.08"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001613"	"1.64"	"49.51"
"8161"	"False"	"High"	"[K].DLELLYPFKEK.[V]"	"1xBiotin [K]"	"0.00866334"	"0.0007621"	"1"	"1"	"10"	"Q9D379"	"Q9D379 [278-288]"	"Q9D379 1xBiotin [K]"	"1"	"1620.83419"	"0.435"	"0.663"	"0.925138005747468"	"0.906515362333117"	"80.12"	"45.20"	"159.0"	"58.8"	"82.2"	"33.14"	"49.05"	"27.24"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006403"	"3.07"	"60.30"
"61116"	"False"	"High"	"[R].SNFAVGYR.[T]"	""	"0.0101101"	"0.0007621"	"1"	"1"	"8"	"Q60930"	"Q60930 [179-186]"	""	"0"	"913.45264"	"510.096"	"1.460"	"0.879255455794791"	"0.963994276545741"	"60.57"	"62.21"	"0.6"	"298.7"	"0.7"	"30.09"	"51.29"	"118.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007384"	"2.26"	"28.78"
"63056"	"False"	"High"	"[RK].SYELPDGQVITIGNER.[F]"	""	"0.0188469"	"0.0007621"	"1"	"7"	"2"	"P60710"	"P60710 [239-254]"	""	"0"	"1790.89192"	"1.385"	"0.860"	"0.994201151226993"	"0.906515362333117"	"66.27"	"42.52"	"93.7"	"125.3"	"81.0"	"19.40"	"149.45"	"47.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001299"	"2.84"	"48.75"
"60926"	"False"	"High"	"[K].SLYYYIQQDTK.[G]"	""	"0.0253102"	"0.0007621"	"1"	"1"	"2"	"P07356"	"P07356 [314-324]"	""	"0"	"1421.69472"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001703"	"2.36"	""
"60925"	"False"	"High"	"[K].SIYYITGESK.[E]"	""	"0.0254658"	"0.0007621"	"1"	"1"	"2"	"P11499"	"P11499 [482-491]"	""	"0"	"1160.58338"	"82.870"	"2.449"	"0.434853540501642"	"0.935866453494337"	"76.02"	"83.19"	"3.2"	"287.3"	"9.6"	"38.07"	"57.71"	"55.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0006427"	"0.001717"	"1.92"	"33.84"
"60902"	"False"	"High"	"[K].SLVSKGILVQTK.[G]"	"1xBiotin [K5]"	"0.00328151"	"0.0007621"	"1"	"1"	"2"	"P15864"	"P15864 [86-97]"	"P15864 1xBiotin [K90]"	"1"	"1498.86616"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002644"	"2.44"	""
"63058"	"False"	"High"	"[K].SYENLAFYWILK.[A]"	""	"0.0163584"	"0.0007621"	"1"	"1"	"3"	"Q920A5"	"Q920A5 [417-428]"	""	"0"	"1546.79404"	"1.885"	"0.770"	"0.925138005747468"	"0.906515362333117"	"96.51"	"81.96"	"104.0"	"138.7"	"57.3"	"50.00"	"155.18"	"54.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0005064"	"0.001144"	"2.11"	"63.77"
"8218"	"False"	"High"	"[K].DLGYIYFYQR.[V]"	""	"0.0069782"	"0.0007621"	"1"	"1"	"7"	"P56399"	"P56399 [846-855]"	""	"0"	"1337.65246"	"123.889"	"1.407"	"0.353802835979578"	"0.906515362333117"	"70.32"	"80.89"	"2.6"	"292.9"	"4.5"	"55.55"	"35.63"	"46.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005269"	"2.59"	"50.89"
"60858"	"False"	"High"	"[K].SLTYLSILR.[N]"	""	"0.0321326"	"0.0007621"	"1"	"1"	"3"	"P57784"	"P57784 [114-122]"	""	"0"	"1065.63027"	"102.055"	"1.669"	"0.435515251674893"	"0.928493834327639"	"52.33"	"93.28"	"2.7"	"294.5"	"2.8"	"50.87"	"25.31"	"90.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002155"	"1.69"	"51.39"
"60760"	"False"	"High"	"[R].SIRPGLSPYR.[A]"	""	"0.0131835"	"0.0007621"	"1"	"2"	"13"	"Q8BHN3"	"Q8BHN3 [52-61]"	""	"0"	"1145.64257"	"280.293"	"7.374"	"0.925138005747468"	"0.906515362333117"	"78.34"	"75.49"	"1.0"	"292.7"	"6.3"	"56.98"	"32.63"	"31.60"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009385"	"3.09"	"26.67"
"49230"	"False"	"High"	"[R].MYHKNPTIPIQK.[L]"	"1xBiotin [K4]"	"0.0100479"	"0.0007621"	"1"	"1"	"6"	"O70311"	"O70311 [110-121]"	"O70311 1xBiotin [K113]"	"1"	"1695.87093"	"0.144"	"0.855"	"0.925138005747468"	"0.906515362333117"	"60.05"	"49.08"	"148.1"	"24.1"	"127.7"	"35.84"	"48.76"	"10.17"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0007338"	"3.12"	"37.30"
"10691"	"False"	"High"	"[R].EATKGFYDK.[D]"	"1xBiotin [K4]"	"0.0101101"	"0.0007621"	"1"	"1"	"11"	"Q62167"	"Q62167 [47-55]"	"Q62167 1xBiotin [K50]"	"1"	"1284.59290"	"0.315"	"1.182"	"0.925138005747468"	"0.909223670800027"	"118.99"	"90.88"	"124.6"	"33.8"	"141.6"	"77.05"	"42.96"	"56.30"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007364"	"2.49"	"35.49"
"57549"	"False"	"High"	"[K].RPPKGNEILE.[-]"	"1xBiotin [K4]"	"0.0138503"	"0.0007621"	"1"	"1"	"7"	"O09005"	"O09005 [314-323]"	"O09005 1xBiotin [K317]"	"1"	"1378.71475"	"0.097"	"0.621"	"0.00472417018594241"	"0.906515362333117"	"52.94"	"36.01"	"177.1"	"16.5"	"106.4"	"28.49"	"52.04"	"33.39"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0009836"	"2.77"	"37.26"
"14276"	"False"	"High"	"[K].EMFGGFFKSVVK.[S]"	"1xBiotin [K8]"	"0.00353438"	"0.0007621"	"1"	"1"	"6"	"Q9D8U8"	"Q9D8U8 [181-192]"	"Q9D8U8 1xBiotin [K188]"	"1"	"1601.78547"	"1.487"	"0.933"	"0.929016530787821"	"0.906515362333117"	"93.44"	"85.60"	"84.9"	"126.2"	"88.9"	"105.38"	"25.80"	"55.69"	""	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002836"	"2.95"	"60.20"
"51148"	"False"	"High"	"[K].NPKYNTQR.[A]"	"1xBiotin [K3]"	"0.019198"	"0.0007621"	"1"	"1"	"5"	"P49769"	"P49769 [312-319]"	"P49769 1xBiotin [K314]"	"1"	"1246.59972"	"0.437"	"0.833"	"0.115509672968445"	"0.906515362333117"	"128.41"	"114.08"	"99.1"	"51.6"	"149.2"	"94.43"	"31.91"	"65.40"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0005416"	"0.001322"	"2.25"	"25.46"
"51096"	"False"	"High"	"[K].NPALKAQSGPVR.[S]"	"1xBiotin [K5]"	"0.00756207"	"0.0007621"	"1"	"1"	"1"	"P40124"	"P40124 [282-293]"	"P40124 1xBiotin [K286]"	"1"	"1463.77874"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005667"	"3.22"	""
"65836"	"False"	"High"	"[K].TSVDSKSINNFEVK.[T]"	"1xBiotin [K6]"	"0.0137652"	"0.0007621"	"1"	"1"	"1"	"P70677"	"P70677 [6-19]"	"P70677 1xBiotin [K11]"	"1"	"1793.87382"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009767"	"2.47"	""
"51064"	"False"	"High"	"[K].NNQPVNPKHSR.[R]"	"1xBiotin [K8]"	"0.0189632"	"0.0007621"	"1"	"1"	"1"	"Q3UUQ7-1"	"Q3UUQ7-1 [775-785]"	"Q3UUQ7-1 1xBiotin [K782]"	"1"	"1516.74375"	"0.294"	"0.218"	"0.925138005747468"	"0.906515362333117"	"40.99"	"48.68"	"195.7"	"59.5"	"44.8"	"32.73"	"41.10"	"38.16"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001304"	"2.18"	"23.07"
"51037"	"False"	"High"	"[K].NNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFR.[A]"	"1xBiotin [K32]; 2xCarbamidomethyl [C14; C31]; 1xOxidation [M19]"	"0.0248488"	"0.0007621"	"1"	"1"	"2"	"Q9D6K9"	"Q9D6K9 [366-405]"	"Q9D6K9 1xBiotin [K397]"	"1"	"4457.88089"	"0.922"	"1.670"	""	"0.998316466510713"	"66.58"	"59.31"	"73.8"	"86.8"	"139.5"	"46.31"	"47.09"	"110.64"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0006427"	"0.001675"	"4.54"	"40.56"
"51036"	"False"	"High"	"[K].NNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFR.[A]"	"1xBiotin [K32]; 2xCarbamidomethyl [C14; C31]"	"0.00980268"	"0.0007621"	"1"	"1"	"1"	"Q9D6K9"	"Q9D6K9 [366-405]"	"Q9D6K9 1xBiotin [K397]"	"1"	"4441.88598"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007195"	"3.17"	""
"65898"	"False"	"High"	"[R].TTGAFWQTWK.[D]"	""	"0.0217098"	"0.0007621"	"1"	"1"	"2"	"Q9DCD2"	"Q9DCD2 [699-708]"	""	"0"	"1225.60003"	"78.477"	"1.783"	"0.925138005747468"	"0.951842910559547"	"71.68"	"63.87"	"3.6"	"290.4"	"5.9"	"54.60"	"63.84"	"70.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.000628"	"0.001482"	"2.25"	"48.38"
"51361"	"False"	"High"	"[K].NQSQGYNQWQQGQFWGQKPWSQHYHQGYY.[-]"	""	"0.00680777"	"0.0007621"	"1"	"1"	"6"	"Q8VEK3"	"Q8VEK3 [772-800]"	""	"0"	"3658.60602"	"25.522"	"21.826"	"0.925138005747468"	"0.906515362333117"	"463.08"	"86.95"	"6.7"	"149.1"	"144.2"	"45.66"	"129.04"	"71.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005163"	"3.11"	"46.93"
"50973"	"False"	"High"	"[K].NMVKSADGVIVSGVK.[D]"	"1xBiotin [K4]"	"0.0033846"	"0.0007621"	"1"	"1"	"2"	"Q6P8X1"	"Q6P8X1 [190-204]"	"Q6P8X1 1xBiotin [K193]"	"1"	"1729.89754"	"0.701"	"1.184"	"0.98205256230001"	"0.923750342545975"	"72.23"	"74.49"	"103.9"	"76.8"	"119.3"	"144.12"	"44.25"	"34.05"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002722"	"2.28"	"44.05"
"14614"	"False"	"High"	"[K].ENKFCSFLQTSK.[V]"	"1xBiotin [K3]; 1xCarbamidomethyl [C5]"	"0.0307875"	"0.0007621"	"1"	"1"	"3"	"P28575"	"P28575 [268-279]"	"P28575 1xBiotin [K270]"	"1"	"1714.79274"	"0.431"	"0.932"	"0.925138005747468"	"0.906515362333117"	"71.00"	"44.35"	"129.8"	"49.1"	"121.1"	"46.94"	"43.66"	"19.78"	""	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006486"	"0.002066"	"2.25"	"52.37"
"14661"	"False"	"High"	"[R].ENIQKPGK.[L]"	"1xBiotin [K5]"	"0.0140222"	"0.0007621"	"1"	"1"	"9"	"Q9JL15"	"Q9JL15 [172-179]"	"Q9JL15 1xBiotin [K176]"	"0"	"1139.58775"	"0.227"	"0.894"	"0.925138005747468"	"0.906515362333117"	"61.72"	"59.98"	"135.9"	"24.4"	"139.7"	"45.00"	"59.78"	"38.93"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009932"	"2.33"	"29.86"
"50878"	"False"	"High"	"[K].NLYIISVK.[G]"	""	"0.0177219"	"0.0007621"	"1"	"1"	"8"	"P62830"	"P62830 [36-43]"	""	"0"	"949.57169"	"223.402"	"5.754"	"0.570562778194137"	"0.906515362333117"	"49.46"	"52.82"	"1.3"	"291.8"	"6.9"	"40.62"	"29.30"	"23.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001228"	"1.84"	"42.00"
"3489"	"False"	"High"	"[R].AQQMTGTKQASVVSFPVPPSRPLPPNPVPK.[K]"	"1xBiotin [K8]; 1xOxidation [M4]"	"0.0106222"	"0.0007621"	"1"	"1"	"3"	"O88839-1"	"O88839-1 [753-782]"	"O88839-1 1xBiotin [K760]"	"1"	"3397.77591"	"0.635"	"1.176"	"0.925138005747468"	"0.906515362333117"	"54.38"	"50.87"	"106.2"	"68.9"	"124.9"	"48.69"	"33.90"	"32.14"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0007718"	"3.75"	"46.73"
"50697"	"False"	"High"	"[R].NLPFDFTWK.[M]"	""	"0.00834803"	"0.0007621"	"1"	"2"	"5"	"Q9D0E1"	"Q9D0E1 [658-666]"	""	"0"	"1167.58332"	"71.577"	"2.115"	"0.473701528498292"	"0.933220350789086"	"101.24"	"54.89"	"4.2"	"286.3"	"9.5"	"39.32"	"75.57"	"42.37"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0002502"	"0.0006211"	"2.25"	"57.04"
"50676"	"False"	"High"	"[K].NLNLIFIVLETGR.[V]"	""	"0.00318156"	"0.0007621"	"1"	"1"	"5"	"Q8R2Y9"	"Q8R2Y9 [16-28]"	""	"0"	"1501.87369"	"1.103"	"0.875"	"0.925138005747468"	"0.906515362333117"	"96.51"	"67.32"	"117.4"	"93.3"	"89.3"	"43.42"	"156.97"	"43.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002564"	"2.93"	"67.32"
"3487"	"False"	"High"	"[R].AQQMTGTKAALADR.[S]"	"1xBiotin [K8]"	"0.00336372"	"0.0007621"	"1"	"1"	"2"	"O88839-2"	"O88839-2 [753-766]"	"O88839-2 1xBiotin [K760]"	"1"	"1687.82544"	"0.884"	"0.929"	"0.952589814133025"	"0.906515362333117"	"40.99"	"46.59"	"112.5"	"89.0"	"98.5"	"21.58"	"31.76"	"44.36"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002703"	"3.00"	"37.24"
"50650"	"False"	"High"	"[K].NLMFLVLR.[D]"	"1xOxidation [M3]"	"0.00839977"	"0.0007621"	"1"	"1"	"8"	"Q8BP47"	"Q8BP47 [154-161]"	""	"0"	"1021.58630"	"224.792"	"2.178"	"0.624680760389159"	"0.991421065300711"	"49.71"	"55.73"	"1.3"	"295.7"	"3.0"	"32.03"	"40.87"	"49.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006252"	"2.01"	"51.22"
"50958"	"False"	"High"	"[K].NMSKVDCK.[G]"	"1xBiotin [K4]; 1xCarbamidomethyl [C7]; 1xOxidation [M2]"	"0.00515428"	"0.0007621"	"1"	"1"	"10"	"Q91WE4"	"Q91WE4 [44-51]"	"Q91WE4 1xBiotin [K47]"	"1"	"1223.52173"	"0.105"	"0.793"	"0.00519003922615292"	"0.906515362333117"	"53.82"	"44.60"	"159.8"	"16.3"	"123.9"	"39.83"	"28.57"	"24.66"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003999"	"2.34"	"22.81"
"3549"	"False"	"High"	"[K].AQYEDIAQK.[S]"	""	"0.00362292"	"0.0007621"	"1"	"1"	"29"	"Q3UV17"	"Q3UV17 [343-351]"	""	"0"	"1065.52111"	"51.377"	"0.504"	"0.935194287285695"	"0.906515362333117"	"88.73"	"109.97"	"5.1"	"292.3"	"2.5"	"76.91"	"56.02"	"111.74"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002901"	"2.58"	"22.04"
"65744"	"False"	"High"	"[K].TSLSDSTTSAYPGDAGKTGGQLGLDHLR.[D]"	"1xBiotin [K17]"	"0.019198"	"0.0007621"	"1"	"1"	"8"	"Q80UJ7"	"Q80UJ7 [535-562]"	"Q80UJ7 1xBiotin [K551]"	"1"	"3031.44255"	"1.301"	"0.662"	"0.979807449139508"	"0.906515362333117"	"55.54"	"62.59"	"95.8"	"138.4"	"65.9"	"85.03"	"32.22"	"44.45"	""	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0005416"	"0.001318"	"3.76"	"44.79"
"51619"	"False"	"High"	"[K].NSQPVKTLPPAISAEPSITLSK.[G]"	"1xBiotin [K6]"	"0.00461129"	"0.0007621"	"1"	"1"	"4"	"Q80WJ7"	"Q80WJ7 [502-523]"	"Q80WJ7 1xBiotin [K507]"	"1"	"2504.34289"	"0.592"	"0.733"	"0.925138005747468"	"0.906515362333117"	"36.22"	"82.64"	"129.6"	"79.9"	"90.5"	"38.36"	"29.33"	"72.27"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003611"	"4.28"	"50.86"
"65396"	"False"	"High"	"[K].TPVTLKQR.[R]"	"1xBiotin [K6]"	"0.00558575"	"0.0007621"	"1"	"5"	"14"	"Q61029"	"Q61029 [207-214]"	"Q61029 1xBiotin [K212]"	"1"	"1168.65069"	"0.031"	"0.886"	"6.53424378561839E-05"	"0.906515362333117"	"64.41"	"55.25"	"152.8"	"4.9"	"142.3"	"32.23"	"49.24"	"43.29"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004318"	"2.32"	"33.58"
"51955"	"False"	"High"	"[R].NVMILTNPVAAKK.[N]"	"1xBiotin [K12]; 1xOxidation [M3]"	"0.00407474"	"0.0007621"	"1"	"2"	"1"	"P47226-1"	"P47226-1 [95-107]"	"P47226-1 1xBiotin [K106]"	"1"	"1640.88624"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000323"	"2.75"	""
"51954"	"False"	"High"	"[R].NVMILTNPVAAKK.[N]"	"1xBiotin [K13]"	"0.00998601"	"0.0007621"	"1"	"2"	"1"	"P47226-1"	"P47226-1 [95-107]"	"P47226-1 1xBiotin [K107]"	"1"	"1624.89133"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0007291"	"2.71"	""
"51931"	"False"	"High"	"[R].NVLLTSGHVAKIGDFGLAR.[D]"	"1xBiotin [K11]"	"0.0200426"	"0.0007621"	"1"	"1"	"2"	"P09581"	"P09581 [781-799]"	"P09581 1xBiotin [K791]"	"1"	"2194.18012"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001372"	"2.88"	""
"51912"	"False"	"High"	"[K].NVKFNVWDVGGQDK.[I]"	"1xBiotin [K3]"	"0.00680777"	"0.0007621"	"1"	"1"	"3"	"P62331"	"P62331 [56-69]"	"P62331 1xBiotin [K58]"	"1"	"1831.87958"	"0.323"	"0.703"	"0.925138005747468"	"0.906515362333117"	"73.05"	"103.19"	"155.1"	"55.1"	"89.8"	"58.96"	"46.61"	"77.26"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0005153"	"2.74"	"52.67"
"13655"	"False"	"High"	"[R].ELLEIVKK.[N]"	"1xBiotin [K]"	"0.00493592"	"0.0007621"	"1"	"1"	"5"	"Q3THS6"	"Q3THS6 [344-351]"	"Q3THS6 1xBiotin [K]"	"1"	"1197.69116"	"0.354"	"0.692"	"0.925138005747468"	"0.906515362333117"	"51.42"	"62.52"	"146.3"	"51.8"	"102.0"	"39.30"	"42.94"	"60.00"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003844"	"2.56"	"46.99"
"3826"	"False"	"High"	"[K].ASGPPVSELITKAVAASK.[E]"	"1xBiotin [K12]"	"0.00548308"	"0.0007621"	"2"	"2"	"8"	"P15864; P43277"	"P15864 [35-52]; P43277 [36-53]"	"P15864 1xBiotin [K46]; P43277 1xBiotin [K47]"	"1"	"1952.05212"	"0.734"	"1.174"	"0.925138005747468"	"0.906515362333117"	"60.85"	"77.34"	"114.9"	"82.5"	"102.6"	"42.67"	"49.17"	"59.63"	"NotUnique"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004245"	"2.84"	"61.19"
"65440"	"False"	"High"	"[R].TQGSAAPGSKDHLNEKPCAEAGSAR.[T]"	"1xBiotin [K10]; 1xCarbamidomethyl [C18]"	"0.00346939"	"0.0007621"	"1"	"1"	"1"	"Q8K1A5"	"Q8K1A5 [27-51]"	"Q8K1A5 1xBiotin [K36]"	"1"	"2765.27299"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0002783"	"3.83"	""
"13775"	"False"	"High"	"[R].ELMKTPSISK.[K]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.00845184"	"0.0007621"	"1"	"1"	"7"	"Q3TBD2-1"	"Q3TBD2-1 [8-17]"	"Q3TBD2-1 1xBiotin [K11]"	"1"	"1375.69598"	"0.280"	"0.556"	"0.925138005747468"	"0.906515362333117"	"57.81"	"80.63"	"159.0"	"52.2"	"88.8"	"42.58"	"44.15"	"52.29"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006266"	"2.66"	"34.71"
"51828"	"False"	"High"	"[R].NTWLYQALR.[E]"	""	"0.0269099"	"0.0007621"	"1"	"2"	"4"	"P56546-1"	"P56546-1 [149-157]"	""	"0"	"1164.61602"	"43.070"	"1.375"	"0.925138005747468"	"0.906515362333117"	"132.63"	"49.42"	"5.8"	"286.6"	"7.5"	"37.21"	"78.52"	"19.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006486"	"0.001811"	"2.10"	"47.77"
"65600"	"False"	"High"	"[R].TSAAAVSSKLMQAR.[V]"	"1xBiotin [K9]"	"0.00980268"	"0.0007621"	"1"	"2"	"1"	"Q8C147"	"Q8C147 [887-900]"	"Q8C147 1xBiotin [K895]"	"1"	"1646.83527"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0007176"	"3.00"	""
"65621"	"False"	"High"	"[K].TSATWFALSR.[I]"	""	"0.0125486"	"0.0007621"	"1"	"1"	"2"	"Q8VDN2"	"Q8VDN2 [414-423]"	""	"0"	"1139.58438"	"40.276"	"1.066"	"0.925138005747468"	"0.906515362333117"	"138.44"	"101.04"	"6.7"	"285.7"	"7.6"	"52.73"	"82.06"	"67.74"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0003479"	"0.0008959"	"2.13"	"45.68"
"51732"	"False"	"High"	"[R].NTKAFVSTSFHK.[C]"	"1xBiotin [K3]"	"0.00962271"	"0.0007621"	"1"	"1"	"4"	"Q8CJF7"	"Q8CJF7 [1254-1265]"	"Q8CJF7 1xBiotin [K1256]"	"1"	"1592.78897"	"0.153"	"0.501"	"0.402522714189559"	"0.906515362333117"	"47.01"	"85.02"	"174.9"	"28.9"	"96.2"	"40.05"	"27.88"	"74.40"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0007049"	"2.47"	"38.72"
"3796"	"False"	"High"	"[R].ASFSKPLFQTVAAICR.[L]"	"1xCarbamidomethyl [C15]"	"0.00433473"	"0.0007621"	"1"	"1"	"2"	"Q8K1B8"	"Q8K1B8 [114-129]"	""	"0"	"1795.95235"	"1.961"	"1.080"	"0.925138005747468"	"0.906515362333117"	"91.73"	"63.77"	"76.4"	"131.6"	"92.0"	"49.45"	"140.00"	"46.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.000341"	"3.55"	"47.83"
"13830"	"False"	"High"	"[K].EIPHNEKLLSLK.[Y]"	"1xBiotin [K7]"	"0.00478562"	"0.0007621"	"1"	"1"	"2"	"O70496"	"O70496 [80-91]"	"O70496 1xBiotin [K86]"	"1"	"1646.89344"	"0.454"	"1.315"	"0.925138005747468"	"0.935866453494337"	"82.38"	"81.52"	"117.0"	"46.7"	"136.3"	"62.81"	"29.36"	"50.18"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003747"	"2.78"	"43.16"
"65721"	"False"	"High"	"[K].TSLCLKEPSLLPVK.[D]"	"1xBiotin [K6]; 1xCarbamidomethyl [C4]"	"0.00579687"	"0.0007621"	"1"	"1"	"3"	"Q8VE11"	"Q8VE11 [562-575]"	"Q8VE11 1xBiotin [K567]"	"1"	"1810.98054"	"1.569"	"1.346"	"0.925138005747468"	"0.906515362333117"	"65.97"	"71.32"	"64.3"	"126.1"	"109.6"	"49.93"	"36.35"	"42.38"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.0004467"	"2.94"	"53.29"
"17959"	"False"	"High"	"[R].FIPSQHYVYMFLVK.[W]"	""	"0.0182758"	"0.0007621"	"1"	"1"	"3"	"Q09014"	"Q09014 [18-31]"	""	"0"	"1771.92401"	"3.117"	"3.454"	"0.925138005747468"	"0.906515362333117"	"194.19"	"84.50"	"38.8"	"125.1"	"136.0"	"85.89"	"139.48"	"62.72"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001264"	"3.04"	"54.51"
"51639"	"False"	"High"	"[R].NSSLTVPMFLSLFSR.[Y]"	""	"0.00248405"	"0.0007621"	"1"	"1"	"6"	"Q7TPV4"	"Q7TPV4 [985-999]"	""	"0"	"1698.88835"	"0.769"	"2.002"	""	"0.935866453494337"	"83.24"	"73.37"	"85.1"	"60.4"	"154.5"	"56.16"	"42.15"	"44.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002035"	"2.65"	"67.29"
"14048"	"False"	"High"	"[R].EISTDGLGGGDCLKKPGGAGEAR.[L]"	"1xBiotin [K14]; 1xCarbamidomethyl [C12]"	"0.00809403"	"0.0007621"	"1"	"1"	"2"	"O35083"	"O35083 [262-284]"	"O35083 1xBiotin [K275]"	"1"	"2471.16533"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006032"	"2.47"	""
"50636"	"False"	"High"	"[R].NLLSVAYK.[N]"	""	"0.0171846"	"0.0007621"	"1"	"9"	"20"	"P61982"	"P61982 [43-50]"	""	"0"	"907.52474"	"134.487"	"3.114"	"0.925138005747468"	"0.906515362333117"	"52.89"	"38.67"	"2.4"	"290.3"	"7.3"	"28.54"	"40.87"	"27.49"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.00119"	"2.18"	"38.14"
"13367"	"False"	"High"	"[K].EIEDAEKYSFMATVTK.[A]"	"1xBiotin [K7]"	"0.00441591"	"0.0007621"	"1"	"1"	"1"	"Q80SW1"	"Q80SW1 [21-36]"	"Q80SW1 1xBiotin [K27]"	"1"	"2087.96640"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0003472"	"2.65"	""
"50587"	"False"	"High"	"[R].NILGGTVFR.[E]"	""	"0.017505"	"0.0007621"	"2"	"2"	"6"	"O88844; P54071"	"O88844 [101-109]; P54071 [141-149]"	""	"0"	"976.55744"	"152.724"	"3.041"	"0.925138005747468"	"0.906515362333117"	"59.39"	"54.15"	"2.2"	"290.6"	"7.2"	"49.65"	"41.08"	"32.36"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001212"	"1.95"	"42.52"
"50502"	"False"	"High"	"[K].NIGKVLLVPGPEKET.[-]"	"1xBiotin [K4]"	"0.0265822"	"0.0007621"	"1"	"1"	"4"	"Q62465"	"Q62465 [392-406]"	"Q62465 1xBiotin [K395]"	"2"	"1819.99863"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001785"	"2.18"	""
"16062"	"False"	"High"	"[K].ESYSVYVYK.[V]"	""	"0.00490549"	"0.0007621"	"2"	"9"	"26"	"Q64525; Q6ZWY9"	"Q64525 [36-44]; Q6ZWY9 [36-44]"	""	"0"	"1137.54627"	"187.392"	"5.769"	"0.925138005747468"	"0.906515362333117"	"71.41"	"85.54"	"1.4"	"290.7"	"7.9"	"70.29"	"34.85"	"56.76"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003815"	"2.01"	"34.79"
"49920"	"False"	"High"	"[K].NFLYAWCGK.[R]"	"1xCarbamidomethyl [C7]"	"0.00950455"	"0.0007621"	"1"	"2"	"15"	"O70133"	"O70133 [6-14]"	""	"0"	"1158.54008"	"159.413"	"5.230"	"0.925138005747468"	"0.906515362333117"	"74.47"	"69.79"	"2.3"	"287.4"	"10.2"	"52.55"	"40.23"	"37.85"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000699"	"2.42"	"47.11"
"49917"	"False"	"High"	"[R].NFLSTPQFLYR.[W]"	""	"0.00433473"	"0.0007621"	"1"	"1"	"5"	"Q99J56"	"Q99J56 [198-208]"	""	"0"	"1385.72121"	"49.769"	"1.151"	"0.648384706721422"	"0.906515362333117"	"115.49"	"94.76"	"5.6"	"288.7"	"5.7"	"39.13"	"82.79"	"74.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0003423"	"2.45"	"52.27"
"49908"	"False"	"High"	"[K].NFLINYYNR.[I]"	""	"0.0100479"	"0.0007621"	"1"	"1"	"2"	"Q9D8U8"	"Q9D8U8 [214-222]"	""	"0"	"1216.61093"	"161.511"	"3.498"	"0.925138005747468"	"0.906515362333117"	"39.08"	"45.96"	"1.8"	"290.8"	"7.4"	"31.93"	"24.32"	"25.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0007346"	"2.14"	"44.26"
"49906"	"False"	"High"	"[R].NFLGEKYIR.[R]"	"1xBiotin [K6]"	"0.0118706"	"0.0007621"	"1"	"1"	"3"	"P51410"	"P51410 [116-124]"	"P51410 1xBiotin [K121]"	"1"	"1365.69837"	"0.146"	"0.656"	"0.488903359827608"	"0.906515362333117"	"32.73"	"34.41"	"169.5"	"22.8"	"107.7"	"41.74"	"18.01"	"13.77"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003095"	"0.0008519"	"2.23"	"48.42"
"49886"	"False"	"High"	"[K].NFGIWLR.[Y]"	""	"0.0217098"	"0.0007621"	"1"	"1"	"30"	"P62717"	"P62717 [77-83]"	""	"0"	"905.49920"	"113.475"	"3.450"	"0.925846386447223"	"0.906515362333117"	"73.55"	"81.98"	"2.6"	"290.6"	"6.8"	"58.79"	"30.17"	"49.32"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000628"	"0.001477"	"2.15"	"49.98"
"49880"	"False"	"High"	"[K].NFFEAKVQAINVSSR.[F]"	"1xBiotin [K6]"	"0.00655988"	"0.0007621"	"1"	"1"	"3"	"Q9D8Y0"	"Q9D8Y0 [192-206]"	"Q9D8Y0 1xBiotin [K197]"	"1"	"1935.97454"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0004995"	"2.23"	""
"16065"	"False"	"High"	"[K].ETADAISKEVKK.[A]"	"2xBiotin [K8; K11]"	"0.00316194"	"0.0007621"	"1"	"1"	"3"	"Q60870"	"Q60870 [161-172]"	"Q60870 2xBiotin [K168; K171]"	"2"	"1770.87647"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002556"	"3.36"	""
"16058"	"False"	"High"	"[K].ESYPVFYLFR.[D]"	""	"0.00968233"	"0.0007621"	"1"	"1"	"12"	"P57759"	"P57759 [115-124]"	""	"0"	"1320.66230"	"115.964"	"3.351"	"0.430383505746853"	"0.906515362333117"	"78.23"	"41.84"	"3.5"	"285.2"	"11.3"	"30.46"	"60.42"	"45.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007078"	"2.02"	"60.42"
"16190"	"False"	"High"	"[R].ETLEDGLPVHDGKGDIRK.[C]"	"1xBiotin [K]"	"0.0143724"	"0.0007621"	"1"	"1"	"4"	"O70252"	"O70252 [246-263]"	"O70252 1xBiotin [K]"	"2"	"2205.09684"	"0.232"	"1.790"	"0.925138005747468"	"0.946660454198708"	"85.47"	"62.78"	"109.4"	"21.3"	"169.4"	"60.03"	"48.09"	"29.61"	""	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.001015"	"2.12"	"38.40"
"49757"	"False"	"High"	"[R].NEFNLESKSTIGVEFATR.[S]"	"1xBiotin [K8]"	"0.0033846"	"0.0007621"	"1"	"2"	"9"	"P46638"	"P46638 [34-51]"	"P46638 1xBiotin [K41]"	"1"	"2268.09651"	"0.783"	"0.842"	"0.978173388550703"	"0.906515362333117"	"129.31"	"104.47"	"149.7"	"79.9"	"70.4"	"41.58"	"138.22"	"63.55"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002718"	"3.00"	"56.58"
"49682"	"False"	"High"	"[K].NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK.[F]"	"2xCarbamidomethyl [C33; C40]; 1xOxidation [M5]"	"0.026098"	"0.0007621"	"1"	"1"	"1"	"P10126"	"P10126 [331-371]"	""	"0"	"4401.12131"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001758"	"3.69"	""
"49500"	"False"	"High"	"[K].NATPYKDKQER.[I]"	"1xBiotin [K]"	"0.00447087"	"0.0007621"	"1"	"1"	"31"	"Q3U9G9"	"Q3U9G9 [152-162]"	"Q3U9G9 1xBiotin [K]"	"2"	"1575.75840"	"1.844"	"0.858"	"0.143143695025862"	"0.906515362333117"	"88.80"	"39.65"	"81.4"	"155.3"	"63.3"	"26.37"	"81.16"	"31.98"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003518"	"3.05"	"23.95"
"49499"	"False"	"High"	"[K].NATPYKDK.[Q]"	"1xBiotin [K]"	"0.0239508"	"0.0007621"	"1"	"1"	"19"	"Q3U9G9"	"Q3U9G9 [152-159]"	"Q3U9G9 1xBiotin [K]"	"1"	"1162.55612"	"0.019"	"0.870"	"2.91518035896675E-05"	"0.906515362333117"	"129.95"	"41.26"	"167.6"	"2.9"	"129.6"	"25.40"	"152.22"	"48.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001623"	"2.56"	"26.97"
"49427"	"False"	"High"	"[R].NALSSLWGK.[L]"	""	"0.00992453"	"0.0007621"	"1"	"1"	"4"	"P60229"	"P60229 [164-172]"	""	"0"	"975.52581"	"110.972"	"3.638"	"0.454798292534351"	"0.906515362333117"	"41.35"	"48.34"	"2.7"	"288.6"	"8.8"	"40.28"	"34.19"	"32.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0007241"	"2.60"	"45.44"
"49333"	"False"	"High"	"[K].NADPILISLKHGYIPGK.[N]"	"1xBiotin [K]"	"0.00308465"	"0.0007621"	"1"	"1"	"11"	"Q9WUM4"	"Q9WUM4 [382-398]"	"Q9WUM4 1xBiotin [K]"	"1"	"2062.11539"	"0.238"	"1.726"	"0.925138005747468"	"0.990231025792746"	"51.18"	"68.31"	"87.3"	"25.5"	"187.1"	"59.50"	"23.19"	"43.34"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002499"	"3.18"	"55.29"
"49315"	"False"	"High"	"[R].NAAFYSPHGHILVLAGFGNLR.[G]"	""	"0.00855693"	"0.0007621"	"1"	"2"	"3"	"Q8BJW6-1"	"Q8BJW6-1 [318-338]"	""	"0"	"2254.18798"	"23.518"	"1.625"	"0.847482300138199"	"0.963994276545741"	"142.56"	"84.04"	"10.3"	"266.5"	"23.2"	"48.82"	"101.38"	"56.83"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0006362"	"2.77"	"51.86"
"49293"	"False"	"High"	"[R].MYSSYSVEPKK.[L]"	"1xBiotin [K10]"	"0.0304135"	"0.0007621"	"1"	"1"	"4"	"Q8VCB1"	"Q8VCB1 [394-404]"	"Q8VCB1 1xBiotin [K403]"	"1"	"1544.71236"	"0.503"	"0.903"	"0.929016530787821"	"0.906515362333117"	"90.45"	"90.55"	"118.8"	"75.4"	"105.7"	"86.40"	"36.40"	"67.90"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.002034"	"3.03"	"36.76"
"49869"	"False"	"High"	"[K].NFAFLEFR.[S]"	""	"0.0135128"	"0.0007621"	"1"	"1"	"9"	"P26369"	"P26369 [196-203]"	""	"0"	"1043.53089"	"182.621"	"3.222"	"0.266254853379793"	"0.906515362333117"	"59.04"	"59.88"	"1.6"	"292.4"	"6.0"	"49.82"	"36.43"	"34.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009611"	"1.65"	"55.11"
"3439"	"False"	"High"	"[K].AQLSAAVLTLLIK.[Q]"	""	"0.0196762"	"0.0007621"	"1"	"1"	"3"	"Q8CGK3"	"Q8CGK3 [678-690]"	""	"0"	"1340.85116"	"9.325"	"1.167"	"0.975052343286225"	""	"143.97"	"62.32"	"31.7"	"235.0"	"33.3"	"47.01"	"108.14"	"40.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001352"	"2.57"	"62.02"
"49959"	"False"	"High"	"[K].NFYFNYK.[KR]"	""	"0.0270753"	"0.0007621"	"1"	"4"	"2"	"Q9WU42-1"	"Q9WU42-1 [647-653]"	""	"0"	"995.46214"	"115.150"	"3.091"	"0.443435163579647"	"0.906515362333117"	"47.05"	"55.24"	"2.5"	"288.5"	"9.0"	"36.04"	"28.48"	"40.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0006486"	"0.001816"	"1.44"	"40.54"
"66132"	"False"	"High"	"[K].TVLIMELINNVAK.[A]"	"1xOxidation [M5]"	"0.0183887"	"0.0007621"	"1"	"1"	"1"	"P56480"	"P56480 [213-225]"	""	"0"	"1473.83453"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.00127"	"2.37"	""
"3465"	"False"	"High"	"[K].AQNTWGCGSSLR.[T]"	"1xCarbamidomethyl [C7]"	"0.00444331"	"0.0007621"	"1"	"3"	"8"	"P48678-1"	"P48678-1 [516-527]"	""	"0"	"1336.60626"	"146.060"	"4.979"	"0.417698912084927"	"0.906515362333117"	"39.77"	"123.39"	"2.2"	"288.9"	"9.0"	"34.94"	"25.73"	"87.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003491"	"2.88"	"28.67"
"15095"	"False"	"High"	"[K].EPSSTVNTEVYPKNSTLR.[T]"	"1xBiotin [K13]"	"0.00272563"	"0.0007621"	"1"	"1"	"8"	"Q9ERB0"	"Q9ERB0 [181-198]"	"Q9ERB0 1xBiotin [K193]"	"1"	"2248.09142"	"0.551"	"0.947"	"0.925138005747468"	"0.906515362333117"	"73.39"	"98.02"	"133.5"	"73.6"	"92.9"	"59.89"	"33.61"	"77.41"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002227"	"2.94"	"39.92"
"3448"	"False"	"High"	"[K].AQLVVIAHDVDPIELVVFLPALCR.[K]"	"1xCarbamidomethyl [C23]"	"0.014914"	"0.0007621"	"1"	"1"	"2"	"P12970"	"P12970 [152-175]"	""	"0"	"2687.49530"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0003479"	"0.00105"	"3.69"	""
"15218"	"False"	"High"	"[K].EQGFLSFWR.[G]"	""	"0.00371368"	"0.0007621"	"1"	"1"	"22"	"P48962"	"P48962 [64-72]"	""	"0"	"1169.57382"	"185.750"	"3.791"	"0.925138005747468"	"0.906515362333117"	"54.59"	"24.17"	"1.7"	"292.1"	"6.3"	"13.49"	"51.87"	"38.18"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002957"	"2.47"	"56.78"
"50389"	"False"	"High"	"[K].NKVVIAEK.[E]"	"1xBiotin [K2]"	"0.019198"	"0.0007621"	"1"	"1"	"3"	"Q78ZA7"	"Q78ZA7 [139-146]"	"Q78ZA7 1xBiotin [K140]"	"1"	"1126.62889"	"0.226"	"0.556"	"0.925138005747468"	"0.906515362333117"	"36.27"	"88.75"	"170.1"	"35.3"	"94.6"	"74.31"	"15.72"	"65.10"	""	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001317"	"2.21"	"33.67"
"50386"	"False"	"High"	"[R].NKVSEEHDILK.[K]"	"1xBiotin [K2]"	"0.0144613"	"0.0007621"	"1"	"1"	"1"	"P49710"	"P49710 [59-69]"	"P49710 1xBiotin [K60]"	"1"	"1537.76790"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.001022"	"2.68"	""
"50357"	"False"	"High"	"[K].NKSAQTSGLK.[Q]"	"1xBiotin [K2]"	"0.0171846"	"0.0007621"	"1"	"1"	"6"	"Q9QYC7"	"Q9QYC7 [20-29]"	"Q9QYC7 1xBiotin [K21]"	"1"	"1259.64125"	"24.455"	"0.619"	"0.925138005747468"	"0.906515362333117"	"46.28"	"37.00"	"12.2"	"280.2"	"7.6"	"36.64"	"28.46"	"27.63"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001196"	"2.36"	"25.98"
"15416"	"False"	"High"	"[R].EQWWLNLR.[L]"	""	"0.0256224"	"0.0007621"	"1"	"1"	"1"	"P12382"	"P12382 [738-745]"	""	"0"	"1144.58980"	"175.074"	"1.596"	"0.339059940944193"	""	"91.83"	"29.97"	"1.8"	"295.6"	"2.6"	"24.34"	"82.95"	"17.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001722"	"2.04"	"53.57"
"50292"	"False"	"High"	"[K].NKIENKIESIGLK.[R]"	"1xBiotin [K6]"	"0.0128621"	"0.0007621"	"1"	"1"	"1"	"Q9JIG8"	"Q9JIG8 [147-159]"	"Q9JIG8 1xBiotin [K152]"	"2"	"1711.94112"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.000915"	"2.97"	""
"66042"	"False"	"High"	"[K].TVDGPSGKLWR.[D]"	"1xBiotin [K8]"	"0.002659"	"0.0007621"	"1"	"1"	"12"	"P16858"	"P16858 [185-195]"	"P16858 1xBiotin [K192]"	"1"	"1441.72564"	"0.199"	"0.847"	"0.925138005747468"	"0.906515362333117"	"55.78"	"43.76"	"138.1"	"32.6"	"129.3"	"44.45"	"37.97"	"27.07"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002172"	"2.87"	"43.98"
"15690"	"False"	"High"	"[R].ESEASTKR.[A]"	"1xBiotin [K7]"	"0.00728677"	"0.0007621"	"1"	"1"	"22"	"Q8VD58"	"Q8VD58 [260-267]"	"Q8VD58 1xBiotin [K266]"	"1"	"1133.52555"	"0.122"	"0.881"	"0.00377588650983478"	"0.906515362333117"	"117.51"	"36.59"	"145.4"	"17.0"	"137.7"	"23.11"	"149.48"	"26.66"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005494"	"2.39"	"19.48"
"66071"	"False"	"High"	"[R].TVFFWAPIMK.[W]"	"1xOxidation [M9]"	"0.00512251"	"0.0007621"	"1"	"1"	"5"	"Q9D023"	"Q9D023 [40-49]"	""	"0"	"1255.65438"	"97.213"	"0.945"	"0.497492915698976"	"0.906515362333117"	"63.30"	"41.36"	"4.3"	"291.8"	"3.9"	"38.84"	"45.94"	"35.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.0003977"	"2.08"	"54.71"
"50230"	"False"	"High"	"[R].NKALGVAVGGGADGSRDELFR.[R]"	"1xBiotin [K2]"	"0.0160588"	"0.0007621"	"1"	"3"	"10"	"Q8VDS8-1"	"Q8VDS8-1 [20-40]"	"Q8VDS8-1 1xBiotin [K21]"	"2"	"2315.15609"	"0.131"	"0.778"	"0.681817099592576"	"0.906515362333117"	"62.39"	"48.99"	"158.8"	"19.2"	"121.9"	"32.47"	"48.05"	"39.06"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001122"	"3.06"	"45.93"
"15870"	"False"	"High"	"[K].ESNFSDTTTNWSSKYTR.[A]"	"1xBiotin [K14]"	"0.00496654"	"0.0007621"	"1"	"3"	"2"	"Q8C561-1"	"Q8C561-1 [622-638]"	"Q8C561-1 1xBiotin [K635]"	"1"	"2249.97679"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003859"	"2.80"	""
"15881"	"False"	"High"	"[K].ESNSFAENGCKGK.[K]"	"1xBiotin [K11]; 1xCarbamidomethyl [C10]"	"0.00555131"	"0.0007621"	"1"	"1"	"3"	"O88822"	"O88822 [276-288]"	"O88822 1xBiotin [K286]"	"1"	"1653.69957"	"0.352"	"0.817"	"0.925138005747468"	"0.906515362333117"	"87.21"	"107.49"	"142.2"	"56.4"	"101.4"	"72.10"	"41.92"	"81.96"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0004272"	"2.65"	"29.39"
"50159"	"False"	"High"	"[R].NGYGFINR.[N]"	""	"0.0214446"	"0.0007621"	"2"	"5"	"3"	"Q9JKB3-1; P62960"	"Q9JKB3-1 [94-101]; P62960 [68-75]"	""	"0"	"940.46354"	"259.035"	"5.652"	"0.925138005747468"	"0.906515362333117"	"72.97"	"86.99"	"1.0"	"293.1"	"5.9"	"73.26"	"38.30"	"55.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001457"	"1.85"	"32.07"
"15991"	"False"	"High"	"[K].ESSPSGSKSQR.[Y]"	"1xBiotin [K8]"	"0.0160588"	"0.0007621"	"1"	"1"	"5"	"Q9CRB9"	"Q9CRB9 [38-48]"	"Q9CRB9 1xBiotin [K45]"	"1"	"1375.62705"	"0.554"	"0.622"	"0.925138005747468"	"0.906515362333117"	"41.06"	"59.80"	"149.2"	"82.4"	"68.4"	"31.66"	"33.07"	"42.39"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001119"	"2.43"	"19.93"
"66131"	"False"	"High"	"[K].TVLIMELINNVAK.[A]"	""	"0.0115098"	"0.0007621"	"1"	"1"	"5"	"P56480"	"P56480 [213-225]"	""	"0"	"1457.83961"	"0.883"	"0.877"	"0.925138005747468"	"0.906515362333117"	"84.40"	"76.89"	"122.0"	"89.8"	"88.2"	"38.15"	"196.65"	"66.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008315"	"3.11"	"64.50"
"50042"	"False"	"High"	"[R].NGHITMKQLIAK.[K]"	"1xBiotin [K7]"	"0.0176131"	"0.0007621"	"1"	"1"	"4"	"Q61263"	"Q61263 [29-40]"	"Q61263 1xBiotin [K35]"	"1"	"1579.84471"	"0.090"	"0.738"	"0.00718796842879403"	"0.906515362333117"	"74.34"	"57.09"	"156.5"	"11.7"	"131.8"	"34.19"	"46.40"	"79.05"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001217"	"2.92"	"42.48"
"65932"	"False"	"High"	"[R].TTLLYFYQQLR.[N]"	""	"0.00269211"	"0.0007621"	"1"	"1"	"9"	"Q9QVP9"	"Q9QVP9 [149-159]"	""	"0"	"1445.77873"	"55.318"	"1.326"	"0.925138005747468"	"0.906515362333117"	"59.69"	"61.12"	"5.3"	"288.9"	"5.9"	"34.02"	"43.94"	"47.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002197"	"2.56"	"55.92"
"65395"	"False"	"High"	"[R].TPVSPPELPEKNFQYR.[Q]"	"1xBiotin [K11]"	"0.00850422"	"0.0007621"	"1"	"3"	"1"	"Q80Z60"	"Q80Z60 [6-21]"	"Q80Z60 1xBiotin [K16]"	"1"	"2128.05319"	"0.597"	"0.968"	"0.925138005747468"	"0.906515362333117"	"55.01"	"49.27"	"124.0"	"69.1"	"106.9"	"38.68"	"41.75"	"43.54"	""	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006312"	"3.10"	"48.71"
"13220"	"False"	"High"	"[K].ELAALPKATVLDLSCNK.[L]"	"1xBiotin [K7]; 1xCarbamidomethyl [C15]"	"0.00274255"	"0.0007621"	"1"	"1"	"4"	"Q922Q8"	"Q922Q8 [34-50]"	"Q922Q8 1xBiotin [K40]"	"1"	"2069.07696"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002236"	"2.57"	""
"13213"	"False"	"High"	"[K].EKYIDQEELNK.[T]"	"1xBiotin [K2]"	"0.00274255"	"0.0007621"	"2"	"2"	"4"	"P07901; P11499"	"P07901 [283-293]; P11499 [274-284]"	"P07901 1xBiotin [K284]; P11499 1xBiotin [K275]"	"1"	"1634.77305"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002238"	"2.40"	""
"4081"	"False"	"High"	"[R].ASVVSLMTWKPSKSTLLADDLEVK.[L]"	"1xBiotin [K13]; 1xOxidation [M7]"	"0.0345735"	"0.0007621"	"1"	"1"	"2"	"Q8VD58"	"Q8VD58 [268-291]"	"Q8VD58 1xBiotin [K280]"	"1"	"2860.48348"	"1.022"	"1.443"	""	"0.906515362333117"	"48.02"	"73.60"	"82.3"	"98.9"	"118.8"	"40.28"	"41.05"	"62.63"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.000686"	"0.00231"	"3.74"	"56.63"
"56625"	"False"	"High"	"[R].RGVMLAVDAVIAELKK.[Q]"	""	"0.00371368"	"0.0007621"	"1"	"1"	"2"	"P63038-1"	"P63038-1 [142-157]"	""	"2"	"1713.00914"	"1.069"	"1.831"	"0.925138005747468"	"0.990231025792746"	"76.46"	"91.77"	"73.6"	"75.1"	"151.3"	"40.74"	"194.60"	"63.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002967"	"3.38"	"59.32"
"64665"	"False"	"High"	"[K].TLLILFKPLISFK.[F]"	""	"0.0228031"	"0.0007621"	"1"	"1"	"2"	"Q5FWK3"	"Q5FWK3 [169-181]"	""	"0"	"1532.98145"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001548"	"1.78"	""
"56572"	"False"	"High"	"[R].RGQILWFR.[G]"	""	"0.0277467"	"0.0007621"	"1"	"2"	"4"	"G5E829"	"G5E829 [1102-1109]"	""	"1"	"1075.61596"	"44.564"	"1.176"	"0.925138005747468"	"0.911771194994466"	"54.30"	"65.18"	"6.2"	"286.3"	"7.5"	"86.39"	"33.13"	"47.95"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001863"	"2.02"	"43.36"
"56539"	"False"	"High"	"[K].RGNLSWLR.[E]"	""	"0.0333312"	"0.0007621"	"1"	"1"	"3"	"Q62422"	"Q62422 [83-90]"	""	"1"	"1001.56392"	"129.251"	"0.747"	"0.925138005747468"	"0.906515362333117"	"147.84"	"72.78"	"1.9"	"296.7"	"1.4"	"104.74"	"117.85"	"42.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002224"	"2.62"	"34.46"
"56537"	"False"	"High"	"[R].RGNDVAFHFNPR.[F]"	""	"0.0124714"	"0.0007621"	"1"	"1"	"4"	"P16110"	"P16110 [165-176]"	""	"1"	"1429.70836"	"92.330"	"2.436"	"0.415908366695644"	"0.929117268927915"	"63.55"	"64.26"	"3.3"	"289.9"	"6.8"	"35.21"	"60.72"	"64.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0008943"	"3.00"	"30.30"
"64845"	"False"	"High"	"[R].TLSKDDVNYR.[M]"	"1xBiotin [K4]"	"0.00248405"	"0.0007621"	"1"	"1"	"11"	"Q99LH2"	"Q99LH2 [9-18]"	"Q99LH2 1xBiotin [K12]"	"1"	"1436.68384"	"0.146"	"0.794"	"0.00656101443062286"	"0.906515362333117"	"71.49"	"49.59"	"154.7"	"22.6"	"122.8"	"51.93"	"42.96"	"50.82"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002041"	"2.16"	"37.10"
"56471"	"False"	"High"	"[K].RGGFNTFR.[D]"	""	"0.0239508"	"0.0007621"	"1"	"1"	"9"	"Q61656"	"Q61656 [502-509]"	""	"1"	"954.49042"	"127.007"	"2.400"	"0.925138005747468"	"0.919063063983313"	"89.75"	"98.48"	"2.7"	"289.9"	"7.4"	"95.69"	"49.40"	"28.52"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006427"	"0.001616"	"2.33"	"23.29"
"64546"	"False"	"High"	"[K].TLGILGLGR.[I]"	""	"0.0082966"	"0.0007621"	"1"	"1"	"10"	"Q61753"	"Q61753 [147-155]"	""	"0"	"899.56728"	"145.505"	"3.986"	"0.925138005747468"	"0.906515362333117"	"38.54"	"44.33"	"2.0"	"290.3"	"7.7"	"36.89"	"31.96"	"17.78"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006156"	"2.39"	"46.38"
"56468"	"False"	"High"	"[R].RGFVFITFK.[E]"	""	"0.0222498"	"0.0007621"	"1"	"1"	"38"	"Q99020"	"Q99020 [200-208]"	""	"1"	"1114.64078"	"85.386"	"1.300"	"0.974870467986275"	"0.99132745460363"	"71.87"	"63.91"	"4.1"	"290.2"	"5.7"	"54.57"	"91.24"	"39.00"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001508"	"2.81"	"48.23"
"56462"	"False"	"High"	"[R].RGFCFITFK.[E]"	"1xCarbamidomethyl [C4]"	"0.00643934"	"0.0007621"	"1"	"4"	"24"	"Q60668-1"	"Q60668-1 [223-231]"	""	"1"	"1175.60301"	"77.761"	"2.332"	"0.992056044454452"	"0.906515362333117"	"63.72"	"76.63"	"3.4"	"285.5"	"11.1"	"65.56"	"42.91"	"54.76"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000491"	"2.72"	"46.23"
"56457"	"False"	"High"	"[K].RGEIIAKQGGGGAGGSVPGIER.[M]"	"1xBiotin [K7]"	"0.00469765"	"0.0007621"	"1"	"2"	"4"	"Q9D0E1"	"Q9D0E1 [381-402]"	"Q9D0E1 1xBiotin [K387]"	"2"	"2292.18772"	"0.198"	"0.782"	"0.925138005747468"	"0.906515362333117"	"73.99"	"64.22"	"145.1"	"32.0"	"123.0"	"55.78"	"30.62"	"27.61"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003668"	"4.24"	"38.72"
"56391"	"False"	"High"	"[R].RFPPYYMR.[R]"	"1xOxidation [M7]"	"0.0186164"	"0.0007621"	"1"	"1"	"148"	"P62960"	"P62960 [190-197]"	""	"1"	"1145.55606"	"179.574"	"2.968"	"0.925138005747468"	"0.906515362333117"	"54.24"	"50.75"	"1.9"	"293.3"	"4.8"	"38.47"	"41.72"	"41.82"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001282"	"2.28"	"32.87"
"56359"	"False"	"High"	"[R].RFELYFR.[G]"	""	"0.0254658"	"0.0007621"	"1"	"1"	"5"	"Q61881"	"Q61881 [133-139]"	""	"1"	"1030.54688"	"416.485"	"5.909"	"0.799063063249231"	"0.906515362333117"	"79.59"	"60.01"	"0.6"	"296.9"	"2.5"	"47.86"	"53.94"	"52.55"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001711"	"2.79"	"41.58"
"64869"	"False"	"High"	"[R].TISVILFLNK.[Q]"	""	"0.0309763"	"0.0007621"	"1"	"5"	"1"	"P63094"	"P63094 [284-293]"	""	"0"	"1147.70852"	"30.493"	"0.796"	"0.925138005747468"	""	"66.29"	"35.87"	"8.3"	"284.7"	"7.0"	"29.30"	"58.00"	"16.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002067"	"1.81"	"56.01"
"56187"	"False"	"High"	"[R].RDYLHYIR.[K]"	""	"0.00676582"	"0.0007621"	"1"	"1"	"12"	"P62281"	"P62281 [90-97]"	""	"1"	"1135.60070"	"210.989"	"4.534"	"0.925138005747468"	"0.906515362333117"	"100.31"	"86.15"	"1.2"	"293.7"	"5.1"	"74.48"	"61.08"	"29.80"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000512"	"3.57"	"30.82"
"55757"	"False"	"High"	"[R].QYWVVFK.[D]"	""	"0.0214446"	"0.0007621"	"1"	"1"	"7"	"Q8K1B8"	"Q8K1B8 [371-377]"	""	"0"	"969.51926"	"186.006"	"5.543"	"0.925138005747468"	"0.906515362333117"	"42.22"	"38.15"	"1.6"	"289.1"	"9.3"	"23.45"	"36.01"	"41.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.000628"	"0.001457"	"2.01"	"47.24"
"55724"	"False"	"High"	"[K].QYGFFSYLR.[E]"	""	"0.0242465"	"0.0007621"	"1"	"2"	"1"	"Q8CG46-1"	"Q8CG46-1 [559-567]"	""	"0"	"1180.57857"	"53.024"	"0.566"	"0.528768931692346"	""	"143.68"	"68.15"	"5.6"	"291.6"	"2.8"	"27.85"	"115.09"	"54.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001634"	"1.61"	"53.54"
"56463"	"False"	"High"	"[K].RGFGFGGFAISAGK.[K]"	""	"0.00299069"	"0.0007621"	"1"	"1"	"9"	"Q810A7-1"	"Q810A7-1 [12-25]"	""	"1"	"1371.71680"	"157.186"	"3.051"	"0.925138005747468"	"0.906515362333117"	"64.64"	"62.47"	"2.0"	"291.4"	"6.6"	"56.96"	"34.94"	"39.89"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002416"	"3.84"	"46.46"
"12030"	"False"	"High"	"[K].EFLFKHPK.[R]"	"1xBiotin [K5]"	"0.00845184"	"0.0007621"	"1"	"1"	"12"	"O55003"	"O55003 [124-131]"	"O55003 1xBiotin [K128]"	"1"	"1271.66053"	"0.107"	"0.742"	"0.00328607201053361"	"0.906515362333117"	"51.78"	"56.60"	"169.5"	"16.2"	"114.3"	"40.47"	"34.28"	"31.95"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006287"	"2.64"	"41.85"
"4138"	"False"	"High"	"[K].ATEDGTPHDPYKALWFER.[K]"	"1xBiotin [K12]"	"0.012018"	"0.0007621"	"1"	"2"	"7"	"Q3B7Z2"	"Q3B7Z2 [755-772]"	"Q3B7Z2 1xBiotin [K766]"	"1"	"2359.08119"	"0.794"	"0.899"	"0.928611703535518"	"0.906515362333117"	"58.38"	"78.91"	"106.2"	"92.0"	"101.8"	"68.49"	"30.40"	"60.51"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0003095"	"0.0008632"	"3.04"	"52.74"
"57031"	"False"	"High"	"[R].RILNIFGVIK.[G]"	""	"0.0194357"	"0.0007621"	"1"	"1"	"4"	"Q62351"	"Q62351 [387-396]"	""	"1"	"1172.75139"	"160.982"	"3.666"	"0.925138005747468"	"0.906515362333117"	"55.80"	"57.38"	"2.0"	"290.7"	"7.3"	"47.42"	"27.18"	"25.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0005902"	"0.001336"	"3.02"	"50.78"
"10763"	"False"	"High"	"[R].EAYYWLR.[H]"	""	"0.0296787"	"0.0007621"	"1"	"1"	"5"	"P46978"	"P46978 [507-513]"	""	"0"	"1000.48869"	"69.670"	"1.616"	"0.486690115660178"	"0.952728074834293"	"50.47"	"105.03"	"4.9"	"288.5"	"6.6"	"41.40"	"37.23"	"102.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001992"	"1.56"	"43.02"
"57525"	"False"	"High"	"[K].RPMSAYMLWLNASR.[E]"	""	"0.0027767"	"0.0007621"	"1"	"2"	"5"	"Q08943"	"Q08943 [549-562]"	""	"0"	"1695.84578"	"0.351"	"2.994"	"0.925138005747468"	"0.906515362333117"	"45.78"	"59.64"	"70.8"	"22.1"	"207.0"	"29.78"	"237.11"	"66.18"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002256"	"3.10"	"50.87"
"4238"	"False"	"High"	"[K].ATQKGDPVAILK.[R]"	"1xBiotin [K4]"	"0.00689246"	"0.0007621"	"1"	"1"	"8"	"Q99PL5-1"	"Q99PL5-1 [891-902]"	"Q99PL5-1 1xBiotin [K894]"	"1"	"1466.80356"	"0.159"	"0.753"	"0.925138005747468"	"0.906515362333117"	"60.43"	"71.99"	"167.4"	"26.6"	"106.0"	"48.76"	"35.94"	"39.73"	""	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005204"	"2.42"	"43.49"
"64440"	"False"	"High"	"[K].TIAFLLPMFR.[H]"	""	"0.0038541"	"0.0007621"	"1"	"2"	"10"	"Q569Z5-1"	"Q569Z5-1 [423-432]"	""	"0"	"1208.68601"	"46.161"	"2.510"	"0.575188894795983"	"0.935866453494337"	"99.27"	"77.89"	"5.7"	"279.4"	"14.9"	"39.78"	"72.93"	"58.64"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003057"	"2.41"	"64.21"
"57499"	"False"	"High"	"[R].RPLILQLIFSK.[T]"	""	"0.0077994"	"0.0007621"	"1"	"2"	"7"	"P39054-1"	"P39054-1 [67-77]"	""	"0"	"1327.84602"	"166.516"	"3.163"	"0.387780109525614"	"0.906515362333117"	"59.36"	"80.44"	"1.6"	"291.1"	"7.3"	"59.05"	"27.19"	"75.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.000585"	"2.46"	"60.54"
"4207"	"False"	"High"	"[K].ATLWYVPLSLK.[N]"	""	"0.0161581"	"0.0007621"	"1"	"4"	"5"	"Q91V12-1"	"Q91V12-1 [159-169]"	""	"0"	"1290.74564"	"101.515"	"2.500"	"0.478573781684308"	"0.935866453494337"	"32.11"	"66.60"	"2.9"	"290.2"	"6.9"	"27.78"	"27.56"	"52.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0005064"	"0.001126"	"2.12"	"57.71"
"57473"	"False"	"High"	"[K].RPGYGAYDAFK.[H]"	""	"0.00291759"	"0.0007621"	"1"	"1"	"7"	"Q6ZWX6"	"Q6ZWX6 [144-154]"	""	"0"	"1244.60585"	"386.781"	"6.136"	"0.925138005747468"	"0.906515362333117"	"56.96"	"85.96"	"1.0"	"292.9"	"6.1"	"57.92"	"39.14"	"63.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002374"	"3.20"	"30.55"
"64449"	"False"	"High"	"[R].TLAHFRPIEDNEKSK.[D]"	"1xBiotin [K]"	"0.00845184"	"0.0007621"	"1"	"1"	"10"	"P61022"	"P61022 [86-100]"	"P61022 1xBiotin [K]"	"1"	"2011.00657"	"0.185"	"1.933"	"0.0115308515058962"	"0.960534684757037"	"49.92"	"44.59"	"94.8"	"17.7"	"187.5"	"56.18"	"226.29"	"15.32"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006272"	"2.86"	"34.80"
"57454"	"False"	"High"	"[K].RPGGQHGGDWSWR.[V]"	""	"0.0147313"	"0.0007621"	"1"	"1"	"5"	"Q80UM7"	"Q80UM7 [174-186]"	""	"0"	"1495.69377"	"78.929"	"6.677"	"0.434853540501642"	"0.906515362333117"	"145.90"	"76.79"	"3.3"	"280.2"	"16.5"	"45.33"	"85.34"	"64.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0003479"	"0.001037"	"2.40"	"27.38"
"57446"	"False"	"High"	"[K].RPFWPWK.[G]"	""	"0.0166635"	"0.0007621"	"1"	"4"	"10"	"Q99J72"	"Q99J72 [384-390]"	""	"0"	"1016.54648"	"62.701"	"1.426"	"0.975052343286225"	"0.946660454198708"	"55.72"	"52.50"	"4.3"	"289.8"	"6.0"	"40.86"	"33.24"	"42.13"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001161"	"2.43"	"44.81"
"57444"	"False"	"High"	"[R].RPFPRPHGWK.[K]"	""	"0.00452652"	"0.0007621"	"1"	"1"	"8"	"Q99P91"	"Q99P91 [160-169]"	""	"0"	"1277.70142"	"59.113"	"1.491"	"0.958614650351576"	"0.960422171904683"	"50.36"	"37.08"	"4.9"	"287.6"	"7.5"	"47.53"	"46.20"	"26.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003559"	"2.18"	"24.12"
"11912"	"False"	"High"	"[R].EETPGALKR.[D]"	"1xBiotin [K8]"	"0.00728677"	"0.0007621"	"1"	"1"	"12"	"Q8BMG7"	"Q8BMG7 [27-35]"	"Q8BMG7 1xBiotin [K34]"	"1"	"1226.61978"	"0.123"	"0.852"	"0.00762583624176486"	"0.906515362333117"	"64.71"	"26.07"	"154.0"	"18.0"	"128.0"	"21.19"	"46.28"	"18.19"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005472"	"2.35"	"32.31"
"57415"	"False"	"High"	"[R].RPDQQLQGDGKLIDR.[R]"	"1xBiotin [K11]"	"0.0202906"	"0.0007621"	"1"	"4"	"2"	"Q9CY58"	"Q9CY58 [112-126]"	"Q9CY58 1xBiotin [K122]"	"1"	"1964.99707"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001385"	"3.15"	""
"64510"	"False"	"High"	"[R].TLEPHNGKCK.[E]"	"1xBiotin [K]; 1xCarbamidomethyl [C9]"	"0.01116"	"0.0007621"	"1"	"1"	"33"	"P35821"	"P35821 [316-325]"	"P35821 1xBiotin [K]"	"1"	"1409.66642"	"0.016"	"0.735"	"2.02065471673078E-05"	"0.906515362333117"	"37.32"	"45.03"	"175.8"	"3.2"	"121.0"	"23.80"	"31.96"	"47.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008054"	"2.44"	"22.35"
"57339"	"False"	"High"	"[R].RNLPTKIPLPTTLASGSK.[S]"	"1xBiotin [K6]"	"0.0294977"	"0.0007621"	"1"	"1"	"8"	"O70472"	"O70472 [1496-1513]"	"O70472 1xBiotin [K1501]"	"2"	"2120.18962"	"0.268"	"0.603"	"0.925138005747468"	"0.906515362333117"	"56.19"	"57.09"	"150.2"	"46.5"	"103.3"	"41.98"	"43.23"	"41.43"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001976"	"3.07"	"48.14"
"57231"	"False"	"High"	"[R].RMFGGSGTSSRPSSNR.[S]"	"1xOxidation [M2]"	"0.0280885"	"0.0007621"	"1"	"1"	"2"	"P20152"	"P20152 [13-28]"	""	"1"	"1699.79289"	"82.759"	"1.766"	"0.435515251674893"	"0.997638395713937"	"130.44"	"34.15"	"3.6"	"290.2"	"6.2"	"37.36"	"74.08"	"28.21"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001888"	"2.48"	"12.64"
"64519"	"False"	"High"	"[K].TIFAYFSGSK.[D]"	""	"0.00458286"	"0.0007621"	"1"	"1"	"12"	"Q9CQM5"	"Q9CQM5 [26-35]"	""	"0"	"1120.56734"	"223.791"	"5.182"	"0.925138005747468"	"0.906515362333117"	"56.26"	"48.26"	"1.3"	"291.4"	"7.3"	"48.71"	"36.11"	"25.75"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003596"	"2.63"	"48.09"
"4159"	"False"	"High"	"[R].ATFYLNVLQQR.[Q]"	""	"0.0069782"	"0.0007621"	"1"	"2"	"6"	"Q9QXK3"	"Q9QXK3 [528-538]"	""	"0"	"1352.73211"	"34.784"	"1.008"	"0.925138005747468"	"0.906515362333117"	"87.54"	"56.06"	"8.3"	"282.6"	"9.1"	"25.99"	"80.86"	"44.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"0.0002502"	"0.0005286"	"2.77"	"49.33"
"57057"	"False"	"High"	"[R].RILVATNLFGR.[G]"	""	"0.0131835"	"0.0007621"	"2"	"3"	"1"	"Q9Z1N5; Q8VDW0-1"	"Q9Z1N5 [339-349]; Q8VDW0-1 [338-348]"	""	"1"	"1259.75827"	"133.385"	"3.703"	"0.925138005747468"	"0.906515362333117"	"27.83"	"32.89"	"2.2"	"290.5"	"7.3"	"26.29"	"18.94"	"58.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009383"	"2.79"	"43.38"
"55721"	"False"	"High"	"[K].QYFGYVLYR.[T]"	""	"0.00871703"	"0.0007621"	"1"	"1"	"4"	"P23780"	"P23780 [412-420]"	""	"0"	"1208.60987"	"117.912"	"2.742"	"0.554858470469817"	"0.916215054610739"	"50.32"	"49.95"	"2.6"	"289.5"	"7.9"	"46.14"	"33.33"	"19.57"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0006447"	"2.08"	"46.56"
"64872"	"False"	"High"	"[K].TLSYLLPAIVHINHQPFLER.[G]"	""	"0.00850422"	"0.0007621"	"1"	"1"	"1"	"Q61656"	"Q61656 [145-164]"	""	"0"	"2361.30776"	"2.660"	"2.775"	"0.925138005747468"	"0.906515362333117"	"109.50"	"132.87"	"54.3"	"95.2"	"150.6"	"60.41"	"151.34"	"98.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006306"	"2.42"	"56.20"
"55703"	"False"	"High"	"[R].QWYESHYALPLGR.[K]"	""	"0.00438868"	"0.0007621"	"1"	"1"	"4"	"P62242"	"P62242 [111-123]"	""	"0"	"1619.79650"	"106.000"	"2.759"	"0.382153176583616"	"0.916215054610739"	"53.10"	"68.40"	"2.6"	"289.5"	"7.9"	"37.18"	"41.53"	"41.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003461"	"2.24"	"43.61"
"55669"	"False"	"High"	"[R].QWKPQLGFNR.[D]"	""	"0.0189632"	"0.0007621"	"1"	"2"	"8"	"Q9DBR1"	"Q9DBR1 [794-803]"	""	"0"	"1273.68002"	"140.737"	"2.782"	"0.925138005747468"	"0.906515362333117"	"80.27"	"96.34"	"2.3"	"289.9"	"7.7"	"44.85"	"133.98"	"63.06"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0005416"	"0.001308"	"1.87"	"36.83"
"53390"	"False"	"High"	"[R].QGVLLGTKSADNSLENPFSK.[G]"	"1xBiotin [K8]"	"0.0248488"	"0.0007621"	"1"	"3"	"1"	"P98078"	"P98078 [719-738]"	"P98078 1xBiotin [K726]"	"1"	"2331.16492"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006427"	"0.001681"	"2.86"	""
"13091"	"False"	"High"	"[K].EKPFVFNLDDENIR.[T]"	"1xBiotin [K2]"	"0.00251498"	"0.0007621"	"1"	"1"	"15"	"Q9ERS5"	"Q9ERS5 [408-421]"	"Q9ERS5 1xBiotin [K409]"	"0"	"1961.94257"	"0.080"	"0.748"	"0.0070650609928628"	"0.906515362333117"	"53.02"	"43.80"	"165.3"	"13.0"	"121.7"	"30.15"	"53.31"	"23.00"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002059"	"2.74"	"56.91"
"53382"	"False"	"High"	"[K].QGTYGGYFR.[D]"	""	"0.00893515"	"0.0007621"	"1"	"1"	"12"	"Q8R1B4"	"Q8R1B4 [876-884]"	""	"0"	"1048.48467"	"495.363"	"17.381"	"0.925138005747468"	"0.906515362333117"	"53.59"	"55.84"	"0.6"	"289.8"	"9.7"	"43.53"	"35.32"	"36.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006603"	"2.21"	"32.45"
"53237"	"False"	"High"	"[R].QGKIPDEELR.[Q]"	"1xBiotin [K3]"	"0.0337404"	"0.0007621"	"1"	"2"	"7"	"Q62419"	"Q62419 [175-184]"	"Q62419 1xBiotin [K177]"	"1"	"1410.70457"	"0.239"	"0.718"	"0.925138005747468"	"0.906515362333117"	"92.31"	"82.28"	"137.7"	"30.8"	"131.5"	"62.83"	"28.91"	"55.79"	""	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.000686"	"0.002263"	"1.90"	"39.00"
"53093"	"False"	"High"	"[R].QFVFKEPQLVVR.[A]"	"1xBiotin [K5]"	"0.00417681"	"0.0007621"	"1"	"1"	"11"	"Q8K1E6"	"Q8K1E6 [53-64]"	"Q8K1E6 1xBiotin [K57]"	"1"	"1715.93016"	"0.540"	"0.575"	"0.925138005747468"	"0.906515362333117"	"90.48"	"95.08"	"125.5"	"107.8"	"66.7"	"69.94"	"44.55"	"77.47"	""	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003308"	"3.11"	"54.42"
"65100"	"False"	"High"	"[R].TNRPPLSLSR.[M]"	""	"0.00420273"	"0.0007621"	"1"	"1"	"12"	"P35980"	"P35980 [56-65]"	""	"0"	"1140.64838"	"289.420"	"7.351"	"0.925138005747468"	"0.906515362333117"	"51.03"	"49.38"	"1.1"	"291.2"	"7.7"	"49.30"	"47.26"	"30.54"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003316"	"2.67"	"25.31"
"53048"	"False"	"High"	"[K].QFLPFLQR.[A]"	""	"0.00458286"	"0.0007621"	"1"	"1"	"6"	"Q78PY7"	"Q78PY7 [516-523]"	""	"0"	"1048.59383"	"97.577"	"3.255"	"0.53012019938047"	"0.906515362333117"	"44.78"	"61.69"	"3.0"	"288.6"	"8.4"	"35.51"	"33.18"	"54.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003601"	"2.34"	"51.82"
"65182"	"False"	"High"	"[K].TPFLLVGTQIDLR.[D]"	""	"0.00534912"	"0.0007621"	"1"	"2"	"1"	"P60766-1"	"P60766-1 [108-120]"	""	"0"	"1472.84714"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004147"	"2.68"	""
"52802"	"False"	"High"	"[K].QEKACSLK.[T]"	"1xBiotin [K3]; 1xCarbamidomethyl [C5]"	"0.00576114"	"0.0007621"	"1"	"1"	"15"	"Q80WJ7"	"Q80WJ7 [481-488]"	"Q80WJ7 1xBiotin [K483]"	"1"	"1189.57039"	"0.035"	"0.934"	"8.56512242246183E-05"	"0.906515362333117"	"31.28"	"28.14"	"154.0"	"5.7"	"140.3"	"17.83"	"30.62"	"31.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004424"	"2.47"	"27.44"
"13205"	"False"	"High"	"[R].EKVVPLYGR.[G]"	"1xBiotin [K2]"	"0.0115811"	"0.0007621"	"1"	"1"	"11"	"O35445"	"O35445 [74-82]"	"O35445 1xBiotin [K75]"	"1"	"1286.69255"	"0.061"	"0.774"	"0.00368538989630705"	"0.906515362333117"	"80.10"	"33.12"	"152.9"	"13.7"	"133.4"	"48.84"	"62.47"	"45.63"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000836"	"2.37"	"42.40"
"65184"	"False"	"High"	"[K].TPFSLVGNVFELNFK.[N]"	""	"0.0131835"	"0.0007621"	"1"	"1"	"6"	"Q9DBG6"	"Q9DBG6 [323-337]"	""	"0"	"1711.90538"	"2.085"	"1.684"	"0.925138005747468"	"0.998099211977233"	"73.75"	"66.21"	"62.5"	"114.5"	"123.0"	"53.02"	"166.24"	"33.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009393"	"3.17"	"64.59"
"52283"	"False"	"High"	"[R].QALLKKPK.[K]"	"1xBiotin [K]"	"0.0154759"	"0.0007621"	"1"	"1"	"7"	"Q99JY1"	"Q99JY1 [27-34]"	"Q99JY1 1xBiotin [K]"	"1"	"1151.69691"	"0.017"	"0.703"	"2.16367531555344E-05"	"0.906515362333117"	"45.06"	"40.89"	"165.4"	"3.6"	"131.0"	"31.35"	"32.80"	"26.32"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.000459"	"0.001087"	"2.22"	"28.37"
"52223"	"False"	"High"	"[K].QAGGFLGPPPPSGKFS.[-]"	"1xBiotin [K14]"	"0.00267551"	"0.0007621"	"1"	"1"	"32"	"Q921L3"	"Q921L3 [173-188]"	"Q921L3 1xBiotin [K186]"	"1"	"1769.86795"	"0.050"	"0.513"	"0.000245138735353669"	"0.906515362333117"	"77.21"	"54.78"	"196.8"	"9.7"	"93.5"	"38.86"	"57.54"	"20.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002179"	"3.98"	"53.02"
"52172"	"False"	"High"	"[K].QADVNLVNAKLLVK.[E]"	"1xBiotin [K]"	"0.00267551"	"0.0007621"	"1"	"1"	"4"	"Q61753"	"Q61753 [385-398]"	"Q61753 1xBiotin [K]"	"1"	"1750.98840"	"0.797"	"0.551"	"0.982626859977453"	"0.906515362333117"	"61.43"	"53.11"	"120.2"	"107.5"	"72.3"	"50.61"	"35.82"	"40.73"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002181"	"2.91"	"53.31"
"13210"	"False"	"High"	"[K].EKYDYVGR.[L]"	"1xBiotin [K2]"	"0.0102992"	"0.0007621"	"1"	"1"	"12"	"Q80UU9"	"Q80UU9 [186-193]"	"Q80UU9 1xBiotin [K187]"	"1"	"1255.57758"	"0.176"	"0.933"	"0.0127254043708158"	"0.906515362333117"	"95.67"	"46.70"	"147.7"	"20.7"	"131.6"	"48.16"	"52.45"	"60.81"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.00075"	"2.32"	"36.00"
"52108"	"False"	"High"	"[R].NYYGYQGYR.[-]"	""	"0.0135964"	"0.0007621"	"1"	"1"	"15"	"Q00PI9"	"Q00PI9 [737-745]"	""	"0"	"1183.51670"	"177.287"	"4.996"	"0.925138005747468"	"0.906515362333117"	"77.92"	"79.47"	"1.7"	"289.7"	"8.6"	"68.16"	"40.64"	"33.13"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009656"	"2.06"	"30.43"
"52106"	"False"	"High"	"[R].NYYEQWGK.[L]"	""	"0.0195556"	"0.0007621"	"1"	"3"	"9"	"O88569"	"O88569 [39-46]"	""	"0"	"1087.48434"	"201.200"	"5.799"	"0.925138005747468"	"0.906515362333117"	"53.69"	"65.61"	"1.6"	"290.2"	"8.2"	"26.49"	"49.74"	"50.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0005902"	"0.001346"	"1.69"	"32.82"
"52086"	"False"	"High"	"[R].NYMPLAFSDKYSLGTR.[L]"	"1xBiotin [K10]; 1xOxidation [M3]"	"0.0110913"	"0.0007621"	"1"	"1"	"2"	"Q8CBY8-2"	"Q8CBY8-2 [172-187]"	"Q8CBY8-2 1xBiotin [K181]"	"1"	"2104.98306"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0008019"	"3.04"	""
"52085"	"False"	"High"	"[R].NYMPLAFSDKYSLGTR.[L]"	"1xBiotin [K10]"	"0.0024535"	"0.0007621"	"1"	"1"	"5"	"Q8CBY8-2"	"Q8CBY8-2 [172-187]"	"Q8CBY8-2 1xBiotin [K181]"	"1"	"2088.98814"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.000202"	"3.50"	""
"13081"	"False"	"High"	"[K].EKNLVSWESQTQPQVQVQDEEITEDDLR.[L]"	"1xBiotin [K2]"	"0.0159602"	"0.0007621"	"1"	"1"	"1"	"O70439"	"O70439 [139-166]"	"O70439 1xBiotin [K140]"	"1"	"3569.67005"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0005064"	"0.001115"	"3.53"	""
"10729"	"False"	"High"	"[K].EAVQCVQELASPSLLFIFVR.[L]"	"1xCarbamidomethyl [C5]"	"0.00609082"	"0.0007621"	"1"	"2"	"1"	"Q6NZJ6"	"Q6NZJ6 [1261-1280]"	""	"0"	"2306.22131"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.000465"	"3.66"	""
"53410"	"False"	"High"	"[K].QGYVIYR.[I]"	""	"0.0311661"	"0.0007621"	"1"	"1"	"12"	"Q9CZM2"	"Q9CZM2 [57-63]"	""	"0"	"898.47813"	"107.288"	"3.783"	"0.950160478206936"	"0.906515362333117"	"72.08"	"74.80"	"1.9"	"287.9"	"10.2"	"62.31"	"30.21"	"34.13"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002086"	"2.41"	"29.73"
"53533"	"False"	"High"	"[R].QKGLDYR.[L]"	"1xBiotin [K2]"	"0.0275773"	"0.0007621"	"1"	"1"	"24"	"Q99LI2"	"Q99LI2 [382-388]"	"Q99LI2 1xBiotin [K383]"	"1"	"1105.54589"	"0.002"	"0.856"	"1.85638341632099E-07"	"0.906515362333117"	"47.56"	"54.65"	"173.3"	"0.3"	"126.4"	"29.48"	"42.32"	"49.77"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001855"	"2.09"	"34.10"
"55662"	"False"	"High"	"[K].QWGWTQGR.[W]"	""	"0.0106879"	"0.0007621"	"1"	"1"	"19"	"Q9CPR4"	"Q9CPR4 [75-82]"	""	"0"	"1018.48534"	"136.246"	"5.288"	"0.925138005747468"	"0.906515362333117"	"56.94"	"74.52"	"2.0"	"287.6"	"10.5"	"37.59"	"33.77"	"96.32"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007751"	"2.33"	"35.91"
"55647"	"False"	"High"	"[R].QVWGLNFGSK.[E]"	""	"0.00420273"	"0.0007621"	"1"	"1"	"9"	"P70460"	"P70460 [87-96]"	""	"0"	"1135.58947"	"163.232"	"4.710"	"0.925138005747468"	"0.906515362333117"	"74.89"	"79.37"	"1.9"	"287.9"	"10.2"	"67.53"	"45.83"	"32.66"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003322"	"2.50"	"46.42"
"64876"	"False"	"High"	"[R].TLTAVHDAILEDLVFPSEIVGK.[R]"	""	"0.00814421"	"0.0007621"	"1"	"1"	"3"	"P62082"	"P62082 [121-142]"	""	"0"	"2367.28060"	"2.032"	"3.289"	"0.925138005747468"	"0.906515362333117"	"110.33"	"72.09"	"52.4"	"101.3"	"146.3"	"51.92"	"154.90"	"54.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0006078"	"4.16"	"62.53"
"64879"	"False"	"High"	"[K].TITGKTFSSR.[-]"	"1xBiotin [K5]"	"0.00609082"	"0.0007621"	"1"	"1"	"9"	"Q9CVB6"	"Q9CVB6 [291-300]"	"Q9CVB6 1xBiotin [K295]"	"1"	"1323.67255"	"0.167"	"0.770"	"0.925138005747468"	"0.906515362333117"	"61.97"	"97.13"	"151.3"	"28.3"	"120.4"	"82.91"	"34.53"	"72.44"	""	"High"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002312"	"0.0004657"	"2.17"	"36.77"
"12438"	"False"	"High"	"[R].EGMKGQLTEASSATSK.[A]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.0286091"	"0.0007621"	"1"	"3"	"2"	"Q9Z329-1"	"Q9Z329-1 [1861-1876]"	"Q9Z329-1 1xBiotin [K1864]"	"1"	"1866.85719"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0006486"	"0.001914"	"2.81"	""
"4079"	"False"	"High"	"[R].ASVVSLMTWKPSK.[S]"	"1xBiotin [K10]"	"0.0218436"	"0.0007621"	"1"	"1"	"1"	"Q8VD58"	"Q8VD58 [268-280]"	"Q8VD58 1xBiotin [K277]"	"0"	"1659.85970"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.000628"	"0.001484"	"2.59"	""
"55239"	"False"	"High"	"[R].QSVEADINGLR.[R]"	""	"0.00428144"	"0.0007621"	"1"	"5"	"1"	"P02535-1"	"P02535-1 [244-254]"	""	"0"	"1201.61714"	"11.736"	"1.249"	"0.925138005747468"	"0.906515362333117"	"265.85"	"76.17"	"22.6"	"246.4"	"31.0"	"48.17"	"178.94"	"64.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003378"	"3.26"	"36.15"
"55144"	"False"	"High"	"[K].QSNAMEYKK.[T]"	"1xBiotin [K8]; 1xOxidation [M5]"	"0.00583283"	"0.0007621"	"1"	"1"	"10"	"P35564"	"P35564 [509-517]"	"P35564 1xBiotin [K516]"	"1"	"1340.59733"	"0.170"	"0.888"	"0.925138005747468"	"0.906777072223237"	"57.42"	"46.06"	"152.6"	"23.1"	"124.3"	"24.83"	"42.00"	"34.09"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004473"	"2.53"	"25.33"
"55143"	"False"	"High"	"[K].QSNAMEYKK.[T]"	"1xBiotin [K8]"	"0.00351258"	"0.0007621"	"1"	"1"	"10"	"P35564"	"P35564 [509-517]"	"P35564 1xBiotin [K516]"	"1"	"1324.60242"	"0.104"	"1.031"	"0.00675040799284876"	"0.906515362333117"	"35.87"	"40.30"	"135.9"	"12.7"	"151.4"	"26.28"	"33.73"	"35.29"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002808"	"3.21"	"31.06"
"55062"	"False"	"High"	"[K].QSEASNKLDTK.[G]"	"1xBiotin [K7]"	"0.0029357"	"0.0007621"	"1"	"2"	"4"	"A2AKQ0"	"A2AKQ0 [340-350]"	"A2AKQ0 1xBiotin [K346]"	"1"	"1446.68932"	"1.565"	"1.334"	"0.939160161221265"	"0.907108336447894"	"119.59"	"87.87"	"86.3"	"108.9"	"104.7"	"61.15"	"164.87"	"59.04"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002377"	"3.01"	"30.50"
"54503"	"False"	"High"	"[K].QNRPIPQWIR.[M]"	""	"0.0082966"	"0.0007621"	"1"	"1"	"12"	"P62892"	"P62892 [19-28]"	""	"0"	"1307.73311"	"158.580"	"4.277"	"0.925138005747468"	"0.906515362333117"	"66.88"	"57.68"	"1.9"	"290.3"	"7.8"	"6.39"	"55.05"	"67.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006183"	"2.49"	"35.93"
"54487"	"False"	"High"	"[K].QNPFWWTHQR.[H]"	""	"0.00458286"	"0.0007621"	"1"	"1"	"15"	"Q99PV0"	"Q99PV0 [1450-1459]"	""	"0"	"1399.66543"	"104.504"	"3.012"	"0.964150902908502"	"0.906515362333117"	"37.28"	"37.51"	"2.8"	"288.9"	"8.3"	"44.07"	"17.30"	"19.38"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003591"	"3.03"	"42.67"
"12975"	"False"	"High"	"[R].EKLCFLDKVEPQATISEIK.[T]"	"2xBiotin [K2; K8]; 1xCarbamidomethyl [C4]"	"0.00576114"	"0.0007621"	"1"	"1"	"4"	"Q9CY27"	"Q9CY27 [15-33]"	"Q9CY27 2xBiotin [K16; K22]"	"2"	"2700.34454"	"0.634"	"1.860"	"0.944967096116098"	"0.990231025792746"	"60.88"	"98.08"	"74.4"	"57.9"	"167.6"	"50.75"	"31.28"	"74.04"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0002312"	"0.0004432"	"2.83"	"60.78"
"12983"	"False"	"High"	"[K].EKLEDFFK.[N]"	"1xBiotin [K2]"	"0.0218436"	"0.0007621"	"1"	"1"	"10"	"Q6P8X1"	"Q6P8X1 [182-189]"	"Q6P8X1 1xBiotin [K183]"	"1"	"1281.61839"	"0.140"	"0.731"	"0.579707986777774"	"0.906515362333117"	"55.00"	"47.42"	"162.4"	"24.3"	"113.2"	"53.22"	"32.82"	"30.25"	""	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.000628"	"0.001486"	"1.98"	"52.98"
"64884"	"False"	"High"	"[K].TITLEVEPSDTIENVK.[A]"	""	"0.00428144"	"0.0007621"	"1"	"4"	"1"	"P62984"	"P62984 [12-27]"	""	"0"	"1787.92730"	"1.251"	"1.149"	"0.995331863866992"	""	"86.71"	"52.49"	"85.2"	"106.6"	"108.2"	"45.08"	"179.14"	"28.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003367"	"3.50"	"44.09"
"64890"	"False"	"High"	"[R].TITSSYYR.[G]"	""	"0.0289613"	"0.0007621"	"1"	"2"	"9"	"P62821"	"P62821 [75-82]"	""	"0"	"990.48909"	"68.625"	"3.033"	"0.925138005747468"	"0.906515362333117"	"145.85"	"101.48"	"4.1"	"282.8"	"13.1"	"39.47"	"113.23"	"69.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001944"	"1.94"	"25.42"
"64904"	"False"	"High"	"[K].TLVLLMGK.[E]"	""	"0.0352115"	"0.0007621"	"1"	"1"	"7"	"P62962"	"P62962 [109-116]"	""	"0"	"874.54304"	"37.893"	"4.097"	"0.695663262369178"	"0.906515362333117"	"141.97"	"58.32"	"6.9"	"263.7"	"29.4"	"66.84"	"82.96"	"35.01"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002356"	"1.79"	"44.20"
"13017"	"False"	"High"	"[K].EKLQCLK.[D]"	"1xBiotin [K2]; 1xCarbamidomethyl [C5]"	"0.012783"	"0.0007621"	"1"	"1"	"14"	"O35316"	"O35316 [5-11]"	"O35316 1xBiotin [K6]"	"1"	"1144.58531"	"0.023"	"0.839"	"3.77289611927905E-05"	"0.906515362333117"	"22.41"	"48.56"	"165.5"	"3.6"	"130.9"	"19.97"	"19.42"	"44.81"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009149"	"2.66"	"35.20"
"13064"	"False"	"High"	"[K].EKMVGGIAQIIAAQEEMLR.[K]"	"1xBiotin [K2]; 1xOxidation [M]"	"0.0352115"	"0.0007621"	"1"	"1"	"2"	"P26039"	"P26039 [2492-2510]"	"P26039 1xBiotin [K2493]"	"1"	"2329.17127"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.000686"	"0.002356"	"2.72"	""
"65022"	"False"	"High"	"[K].TNAWSWGILK.[M]"	""	"0.0294977"	"0.0007621"	"1"	"1"	"3"	"O35601"	"O35601 [635-644]"	""	"0"	"1175.62077"	"38.572"	"1.723"	"0.925138005747468"	"0.936238272383155"	"141.24"	"71.22"	"5.6"	"285.7"	"8.7"	"54.95"	"79.42"	"49.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.001979"	"2.12"	"53.03"
"47364"	"False"	"High"	"[K].MSATFIGNSTAIQELFK.[R]"	"1xOxidation [M1]"	"0.0152863"	"0.0007621"	"1"	"3"	"4"	"Q7TMM9"	"Q7TMM9 [363-379]"	""	"0"	"1873.93643"	"17.018"	"0.665"	"0.929016530787821"	""	"139.33"	"69.26"	"16.6"	"273.4"	"10.0"	"38.80"	"97.27"	"57.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0004044"	"0.001075"	"2.77"	"57.98"
"18097"	"False"	"High"	"[R].FLYMWPNAR.[I]"	"1xOxidation [M4]"	"0.026098"	"0.0007621"	"1"	"1"	"3"	"Q3ULD5"	"Q3ULD5 [461-469]"	""	"0"	"1213.58228"	"50.752"	"0.877"	"0.925138005747468"	"0.906515362333117"	"66.15"	"29.09"	"5.2"	"289.8"	"5.0"	"28.61"	"62.15"	"32.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0006427"	"0.001759"	"2.36"	"45.21"
"38608"	"False"	"High"	"[R].ITGAQTLPKHVSTSSDEGSPSASTPMINK.[T]"	"1xBiotin [K9]"	"0.00871703"	"0.0007621"	"1"	"1"	"4"	"Q8BGR2"	"Q8BGR2 [229-257]"	"Q8BGR2 1xBiotin [K237]"	"1"	"3167.53474"	"0.854"	"1.439"	"0.962122454074805"	"0.96247554139247"	"78.44"	"74.95"	"81.8"	"91.7"	"126.4"	"104.40"	"44.98"	"38.51"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006451"	"2.41"	"38.72"
"29455"	"False"	"High"	"[R].KRVDVEESEASSSVSISHSASATGNVCIEEIDVDGK.[F]"	"1xBiotin [K1]; 1xCarbamidomethyl [C27]"	"0.00558575"	"0.0007621"	"1"	"1"	"2"	"P14733"	"P14733 [418-453]"	"P14733 1xBiotin [K418]"	"2"	"4017.86519"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004316"	"3.35"	""
"29423"	"False"	"High"	"[R].KRPTSASSSPEPPEFSTFR.[A]"	"1xBiotin [K1]"	"0.0121673"	"0.0007621"	"1"	"2"	"5"	"Q75VT8"	"Q75VT8 [201-219]"	"Q75VT8 1xBiotin [K201]"	"1"	"2334.11831"	"0.543"	"1.028"	"0.925138005747468"	"0.906515362333117"	"63.04"	"76.88"	"110.2"	"59.4"	"130.4"	"45.50"	"47.16"	"55.48"	""	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0003095"	"0.0008749"	"2.85"	"39.89"
"20476"	"False"	"High"	"[R].GFLTTSFWR.[S]"	""	"0.00551709"	"0.0007621"	"1"	"1"	"21"	"Q8R322"	"Q8R322 [690-698]"	""	"0"	"1114.56801"	"86.623"	"2.340"	"0.975052343286225"	"0.923750342545975"	"68.10"	"69.79"	"3.0"	"289.8"	"7.1"	"57.28"	"42.55"	"20.95"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000427"	"2.80"	"53.82"
"29408"	"False"	"High"	"[R].KRPDEVPDDDEPAGPMKTNSTNNHK.[D]"	"1xBiotin [K]; 1xOxidation [M16]"	"0.00515428"	"0.0007621"	"1"	"3"	"2"	"P97300"	"P97300 [363-387]"	"P97300 1xBiotin [K]"	"2"	"3034.36292"	"0.371"	"1.313"	"0.925138005747468"	"0.937720487136796"	"77.74"	"83.74"	"107.0"	"42.0"	"151.0"	"76.85"	"32.17"	"45.63"	""	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0004009"	"3.56"	"26.10"
"71344"	"False"	"High"	"[K].YFLWVVK.[F]"	""	"0.0219782"	"0.0007621"	"1"	"2"	"19"	"Q60631"	"Q60631 [118-124]"	""	"0"	"954.54475"	"137.494"	"3.938"	"0.925138005747468"	"0.906515362333117"	"106.25"	"114.25"	"2.4"	"289.9"	"7.7"	"89.39"	"38.64"	"70.49"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001497"	"1.67"	"53.55"
"29337"	"False"	"High"	"[K].KQVNDEELLQPSLTR.[S]"	"1xBiotin [K1]"	"0.0243957"	"0.0007621"	"1"	"1"	"2"	"Q9D0I4"	"Q9D0I4 [118-132]"	"Q9D0I4 1xBiotin [K118]"	"1"	"1996.01680"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001646"	"3.03"	""
"29331"	"False"	"High"	"[K].KQVFTNNIPK.[A]"	"1xBiotin [K1]"	"0.00472679"	"0.0007621"	"1"	"2"	"10"	"Q4FZC9-1"	"Q4FZC9-1 [765-774]"	"Q4FZC9-1 1xBiotin [K765]"	"1"	"1414.75113"	"0.354"	"0.658"	"0.925138005747468"	"0.906515362333117"	"106.20"	"108.04"	"170.4"	"45.2"	"84.4"	"66.49"	"45.72"	"63.93"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003698"	"2.54"	"39.96"
"71359"	"False"	"High"	"[K].YFPYYGK.[K]"	""	"0.0287847"	"0.0007621"	"1"	"1"	"76"	"P97370"	"P97370 [213-219]"	""	"0"	"937.44543"	"120.927"	"3.351"	"0.925138005747468"	"0.906515362333117"	"46.28"	"54.60"	"2.2"	"290.1"	"7.8"	"22.05"	"37.54"	"43.75"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001935"	"1.65"	"35.98"
"29255"	"False"	"High"	"[K].KQIQFADDMQEFTK.[F]"	"1xBiotin [K1]; 1xOxidation [M9]"	"0.00291759"	"0.0007621"	"1"	"1"	"3"	"Q80SW1"	"Q80SW1 [40-53]"	"Q80SW1 1xBiotin [K40]"	"1"	"1970.89866"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0001583"	"0.0002367"	"2.19"	""
"1069"	"False"	"High"	"[R].AFGYYGPLR.[S]"	""	"0.00968233"	"0.0007621"	"1"	"2"	"39"	"P84104-1"	"P84104-1 [29-37]"	""	"0"	"1043.53089"	"174.738"	"4.404"	"0.925138005747468"	"0.906515362333117"	"83.30"	"90.85"	"1.7"	"288.6"	"9.7"	"76.38"	"69.75"	"39.20"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007113"	"2.52"	"41.07"
"71388"	"False"	"High"	"[K].YFVTFPYPYMNGR.[L]"	"1xOxidation [M10]"	"0.00502835"	"0.0007621"	"1"	"1"	"10"	"Q8BMJ2"	"Q8BMJ2 [48-60]"	""	"0"	"1670.76718"	"158.857"	"2.158"	"0.373166622677887"	"0.936849549154937"	"53.41"	"76.50"	"1.7"	"294.9"	"3.4"	"34.54"	"37.31"	"64.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003906"	"2.07"	"51.66"
"29195"	"False"	"High"	"[K].KQGGLGPMNIPLISDPK.[R]"	"1xBiotin [K1]"	"0.00765613"	"0.0007621"	"1"	"1"	"3"	"P35700"	"P35700 [93-109]"	"P35700 1xBiotin [K93]"	"1"	"1991.04526"	"0.180"	"0.991"	"0.925138005747468"	"0.906515362333117"	"61.12"	"49.66"	"135.2"	"26.2"	"138.7"	"45.96"	"36.58"	"39.86"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.000575"	"3.93"	"54.73"
"71390"	"False"	"High"	"[R].YFWLALLPR.[K]"	""	"0.00643934"	"0.0007621"	"1"	"1"	"9"	"Q504P2"	"Q504P2 [187-195]"	""	"0"	"1178.67208"	"69.347"	"2.305"	"0.478573781684308"	"0.950055801575781"	"79.05"	"59.87"	"4.4"	"286.5"	"9.1"	"51.63"	"39.71"	"48.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004897"	"1.67"	"64.58"
"29025"	"False"	"High"	"[R].KPQQQYAKK.[T]"	"1xBiotin [K]"	"0.00715289"	"0.0007621"	"1"	"1"	"15"	"Q8VBT0"	"Q8VBT0 [213-221]"	"Q8VBT0 1xBiotin [K]"	"1"	"1344.70927"	"0.046"	"0.725"	"0.00022233067292899"	"0.906515362333117"	"50.45"	"41.35"	"172.6"	"8.0"	"119.4"	"28.65"	"40.43"	"49.66"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005391"	"3.10"	"20.26"
"28999"	"False"	"High"	"[K].KPPKPQLMANYYNK.[V]"	"1xOxidation [M8]"	"0.0251555"	"0.0007621"	"1"	"1"	"11"	"P23116"	"P23116 [265-278]"	""	"0"	"1707.88869"	"206.637"	"3.884"	"0.925138005747468"	"0.906515362333117"	"63.69"	"55.59"	"1.8"	"292.7"	"5.5"	"44.95"	"37.07"	"46.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001694"	"3.29"	"23.38"
"1067"	"False"	"High"	"[R].AFGWYPHLGR.[L]"	""	"0.0279171"	"0.0007621"	"1"	"2"	"1"	"P21956-1"	"P21956-1 [337-346]"	""	"0"	"1203.60579"	"94.249"	"3.175"	"0.975052343286225"	"0.906515362333117"	"44.14"	"40.64"	"2.6"	"288.0"	"9.4"	"37.72"	"32.27"	"25.74"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001868"	"1.49"	"44.62"
"71396"	"False"	"High"	"[R].YFYLFPNR.[L]"	""	"0.00799461"	"0.0007621"	"1"	"2"	"15"	"Q99MK8"	"Q99MK8 [580-587]"	""	"0"	"1119.56219"	"148.065"	"2.944"	"0.925138005747468"	"0.906515362333117"	"58.65"	"62.53"	"2.2"	"290.8"	"6.9"	"54.35"	"49.70"	"36.18"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005966"	"2.02"	"50.39"
"20530"	"False"	"High"	"[R].GFSSGSAVVSGGSR.[R]"	""	"0.00562039"	"0.0007621"	"1"	"1"	"4"	"Q3TTY5"	"Q3TTY5 [23-36]"	""	"0"	"1254.60730"	"84.796"	"1.230"	"0.989440770281069"	"0.919235111389825"	"144.87"	"73.27"	"3.0"	"293.1"	"3.9"	"193.15"	"231.12"	"39.93"	"MandatoryModificationMissing"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004342"	"3.66"	"24.56"
"20535"	"False"	"High"	"[R].GFSWWPGR.[I]"	""	"0.0171846"	"0.0007621"	"1"	"2"	"21"	"O88508-1"	"O88508-1 [298-305]"	""	"0"	"992.47371"	"94.053"	"2.491"	"0.966090293805027"	"0.937072062058245"	"55.00"	"76.66"	"3.1"	"288.9"	"8.1"	"73.74"	"27.54"	"46.23"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001192"	"2.03"	"51.09"
"20469"	"False"	"High"	"[R].GFILTVTELTVPQHVSLLPGQVIR.[L]"	""	"0.00518626"	"0.0007621"	"1"	"1"	"2"	"Q9JM90-1"	"Q9JM90-1 [114-137]"	""	"0"	"2617.50758"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004027"	"2.57"	""
"28824"	"False"	"High"	"[K].KPFYLYTGR.[G]"	""	"0.0131024"	"0.0007621"	"1"	"2"	"19"	"P32921"	"P32921 [158-166]"	""	"0"	"1144.61496"	"143.254"	"6.211"	"0.925138005747468"	"0.906515362333117"	"44.80"	"86.66"	"2.0"	"287.5"	"10.5"	"57.06"	"18.05"	"65.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009323"	"2.28"	"34.82"
"71327"	"False"	"High"	"[K].YFIHYSGWNK.[NK]"	""	"0.00647927"	"0.0007621"	"1"	"2"	"10"	"P60762"	"P60762 [42-51]"	""	"0"	"1314.62658"	"82.614"	"2.094"	"0.992871679916025"	"0.929117268927915"	"53.67"	"42.47"	"3.5"	"289.3"	"7.2"	"56.80"	"34.78"	"14.58"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0004935"	"2.11"	"39.07"
"29567"	"False"	"High"	"[K].KSGELWLDAYLHK.[-]"	"1xBiotin [K13]"	"0.02337"	"0.0007621"	"1"	"1"	"2"	"Q9Z0R9"	"Q9Z0R9 [432-444]"	"Q9Z0R9 1xBiotin [K444]"	"1"	"1785.89925"	"0.786"	"0.814"	"0.934972688423062"	"0.906515362333117"	"41.18"	"58.48"	"118.3"	"83.6"	"98.1"	"24.39"	"38.22"	"133.88"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001579"	"2.32"	"56.12"
"70972"	"False"	"High"	"[K].YAPLADVKSEK.[T]"	"1xBiotin [K8]"	"0.00357838"	"0.0007621"	"1"	"4"	"12"	"Q61029"	"Q61029 [393-403]"	"Q61029 1xBiotin [K400]"	"1"	"1446.72973"	"0.123"	"0.817"	"0.0311386934390948"	"0.906515362333117"	"59.73"	"72.60"	"147.4"	"21.4"	"131.3"	"61.61"	"27.27"	"53.10"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002868"	"2.59"	"41.53"
"20418"	"False"	"High"	"[R].GFGFILFK.[D]"	""	"0.0202906"	"0.0007621"	"1"	"1"	"53"	"Q99020"	"Q99020 [117-124]"	""	"0"	"928.52910"	"116.980"	"2.719"	"0.925138005747468"	"0.906515362333117"	"62.35"	"59.03"	"2.5"	"290.3"	"7.2"	"44.50"	"45.07"	"28.22"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000628"	"0.001389"	"2.11"	"58.26"
"30114"	"False"	"High"	"[R].KTVYFFSPWR.[G]"	""	"0.0205416"	"0.0007621"	"1"	"1"	"1"	"P09581"	"P09581 [151-160]"	""	"1"	"1330.69427"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001405"	"3.11"	""
"20422"	"False"	"High"	"[R].GFGFVLFK.[ED]"	""	"0.0201662"	"0.0007621"	"1"	"5"	"40"	"Q60668-1"	"Q60668-1 [139-146]"	""	"0"	"914.51345"	"137.365"	"2.883"	"0.925138005747468"	"0.906515362333117"	"67.22"	"74.50"	"2.4"	"289.8"	"7.8"	"46.84"	"31.84"	"56.55"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000628"	"0.001379"	"2.05"	"56.15"
"71000"	"False"	"High"	"[R].YAYVLFYR.[R]"	""	"0.0309763"	"0.0007621"	"1"	"2"	"4"	"Q3UJD6"	"Q3UJD6 [1247-1254]"	""	"0"	"1094.56694"	"105.524"	"2.202"	"0.925138005747468"	"0.982339048472816"	"18.54"	"47.94"	"2.9"	"291.0"	"6.1"	"13.36"	"69.30"	"63.03"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002074"	"1.94"	"48.31"
"20423"	"False"	"High"	"[K].GFGFVSFER.[H]"	""	"0.0182758"	"0.0007621"	"1"	"1"	"19"	"P29341"	"P29341 [232-240]"	""	"0"	"1045.51016"	"157.907"	"4.137"	"0.925138005747468"	"0.906515362333117"	"72.26"	"73.77"	"2.0"	"291.0"	"7.1"	"57.89"	"36.33"	"48.95"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001264"	"2.13"	"48.52"
"20425"	"False"	"High"	"[R].GFGFVYFQSHDAADK.[A]"	""	"0.00845184"	"0.0007621"	"1"	"1"	"4"	"Q9CX86"	"Q9CX86 [140-154]"	""	"0"	"1688.77035"	"122.372"	"3.936"	"0.427089858136149"	"0.906515362333117"	"73.72"	"77.72"	"2.0"	"289.1"	"8.9"	"46.81"	"52.99"	"59.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0006265"	"3.08"	"45.52"
"71015"	"False"	"High"	"[K].YCFPNYVGRPK.[H]"	"1xCarbamidomethyl [C2]"	"0.00668268"	"0.0007621"	"1"	"2"	"11"	"P61164"	"P61164 [33-43]"	""	"0"	"1400.67797"	"317.476"	"11.170"	"0.925138005747468"	"0.906515362333117"	"75.76"	"90.00"	"0.9"	"287.8"	"11.3"	"106.93"	"42.83"	"72.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005085"	"2.80"	"35.50"
"30030"	"False"	"High"	"[R].KTPSQATSSQAKEK.[L]"	"1xBiotin [K12]"	"0.0078964"	"0.0007621"	"1"	"1"	"3"	"Q8CHK3"	"Q8CHK3 [456-469]"	"Q8CHK3 1xBiotin [K467]"	"2"	"1716.85851"	"0.672"	"0.807"	"0.944306739641203"	"0.906515362333117"	"50.61"	"50.15"	"117.9"	"83.1"	"99.0"	"70.57"	"29.28"	"31.10"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005904"	"3.35"	"18.85"
"20427"	"False"	"High"	"[K].GFGGIGGILR.[Y]"	""	"0.0128621"	"0.0007621"	"1"	"1"	"20"	"Q8BWY3"	"Q8BWY3 [405-414]"	""	"0"	"946.54688"	"160.322"	"4.573"	"0.925138005747468"	"0.906515362333117"	"74.81"	"67.01"	"2.1"	"289.6"	"8.3"	"51.29"	"72.02"	"45.58"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009199"	"2.21"	"46.14"
"20428"	"False"	"High"	"[K].GFGGIYGVGK.[A]"	""	"0.00689246"	"0.0007621"	"1"	"1"	"1"	"Q6NSR8"	"Q6NSR8 [224-233]"	""	"0"	"954.50434"	"145.700"	"2.503"	"0.375951049148488"	"0.935866453494337"	"57.95"	"44.21"	"2.2"	"292.8"	"5.0"	"33.17"	"46.65"	"26.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005209"	"2.20"	"37.16"
"20429"	"False"	"High"	"[K].GFGGQYGIQK.[D]"	""	"0.00534912"	"0.0007621"	"1"	"1"	"12"	"P49710"	"P49710 [193-202]"	""	"0"	"1054.53162"	"197.408"	"4.654"	"0.925138005747468"	"0.906515362333117"	"87.96"	"95.69"	"1.9"	"289.6"	"8.5"	"87.89"	"34.85"	"36.74"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004145"	"2.42"	"29.90"
"71201"	"False"	"High"	"[R].YEGFFSLWK.[G]"	""	"0.00415106"	"0.0007621"	"1"	"1"	"11"	"Q9CR62"	"Q9CR62 [272-280]"	""	"0"	"1176.57242"	"133.354"	"2.324"	"0.461130412942887"	"0.936238272383155"	"53.73"	"104.21"	"1.9"	"292.6"	"5.5"	"45.74"	"29.62"	"72.06"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"0.0001583"	"0.0003279"	"1.99"	"59.46"
"20430"	"False"	"High"	"[K].GFGGQYGIQKDR.[V]"	"1xBiotin [K10]"	"0.00308465"	"0.0007621"	"1"	"1"	"9"	"P49710"	"P49710 [193-204]"	"P49710 1xBiotin [K202]"	"1"	"1551.73727"	"0.477"	"0.825"	"0.925138005747468"	"0.906515362333117"	"58.44"	"66.74"	"112.6"	"54.2"	"133.2"	"44.54"	"31.67"	"40.33"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002488"	"2.59"	"40.31"
"29895"	"False"	"High"	"[R].KTDLSSHSQTSGILLSSMPSTSKMG.[-]"	"1xBiotin [K23]"	"0.0335352"	"0.0007621"	"1"	"1"	"6"	"Q61549"	"Q61549 [907-931]"	"Q61549 1xBiotin [K929]"	"2"	"2806.34198"	"0.522"	"1.462"	"0.925138005747468"	"0.998316466510713"	"54.69"	"86.78"	"99.2"	"54.2"	"146.6"	"61.35"	"8.36"	"60.96"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.002248"	"4.20"	"48.04"
"20439"	"False"	"High"	"[K].GFGYKGSSFHR.[I]"	""	"0.00655988"	"0.0007621"	"1"	"1"	"14"	"P17742"	"P17742 [45-55]"	""	"1"	"1242.60143"	"135.242"	"1.397"	"0.925138005747468"	"0.954461348772941"	"115.33"	"95.69"	"2.0"	"296.0"	"2.0"	"92.07"	"67.53"	"108.81"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004999"	"2.34"	"24.36"
"29785"	"False"	"High"	"[R].KSSTPEEVK.[K]"	"1xBiotin [K1]"	"0.0135964"	"0.0007621"	"1"	"1"	"6"	"P18760"	"P18760 [22-30]"	"P18760 1xBiotin [K22]"	"1"	"1230.60346"	"0.180"	"1.022"	"0.557903440355138"	"0.906515362333117"	"114.76"	"119.59"	"172.8"	"30.5"	"96.7"	"76.27"	"33.99"	"94.49"	""	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.0003479"	"0.0009658"	"1.94"	"24.70"
"71323"	"False"	"High"	"[R].YFLCLQLR.[Q]"	"1xCarbamidomethyl [C4]"	"0.0115811"	"0.0007621"	"1"	"1"	"6"	"O70318"	"O70318 [304-311]"	""	"0"	"1112.59211"	"156.825"	"3.042"	"0.390217367865002"	"0.906515362333117"	"71.73"	"41.55"	"1.9"	"292.3"	"5.8"	"40.18"	"56.20"	"28.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0008349"	"1.84"	"51.46"
"29588"	"False"	"High"	"[R].KSGSISSSPSR.[R]"	"1xBiotin [K1]"	"0.00860997"	"0.0007621"	"1"	"1"	"8"	"Q3U9G9"	"Q3U9G9 [64-74]"	"Q3U9G9 1xBiotin [K64]"	"1"	"1318.64197"	"0.235"	"0.747"	"0.925138005747468"	"0.906515362333117"	"35.13"	"24.72"	"154.6"	"38.8"	"106.7"	"21.68"	"26.32"	"14.84"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006384"	"2.08"	"24.27"
"29566"	"False"	"High"	"[K].KSGCPEER.[R]"	"1xBiotin [K1]; 1xCarbamidomethyl [C4]"	"0.00605328"	"0.0007621"	"1"	"1"	"11"	"Q80UJ7"	"Q80UJ7 [916-923]"	"Q80UJ7 1xBiotin [K916]"	"1"	"1188.51360"	"0.021"	"0.764"	"3.20489687901977E-05"	"0.906515362333117"	"64.81"	"36.30"	"167.9"	"3.5"	"128.6"	"14.45"	"61.02"	"28.58"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004646"	"2.48"	"20.79"
"71442"	"False"	"High"	"[K].YGFYTHVFR.[L]"	""	"0.00472679"	"0.0007621"	"1"	"1"	"21"	"P19221"	"P19221 [597-605]"	""	"0"	"1189.57890"	"102.062"	"2.352"	"0.941947881189768"	"0.906515362333117"	"74.60"	"75.45"	"3.1"	"290.1"	"6.8"	"54.60"	"53.75"	"55.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003701"	"2.40"	"39.55"
"28815"	"False"	"High"	"[K].KPEVSGSDILGEAGSHISLKLSFPSR.[A]"	"1xBiotin [K20]"	"0.00558575"	"0.0007621"	"1"	"1"	"1"	"P28867-2"	"P28867-2 [317-342]"	"P28867-2 1xBiotin [K336]"	"1"	"2937.51387"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0004308"	"4.18"	""
"20546"	"False"	"High"	"[R].GFVFITFK.[E]"	""	"0.0124714"	"0.0007621"	"1"	"1"	"32"	"Q99020"	"Q99020 [201-208]"	""	"0"	"958.53967"	"133.484"	"3.687"	"0.925138005747468"	"0.906515362333117"	"86.88"	"77.02"	"1.6"	"291.9"	"6.5"	"81.79"	"34.21"	"25.99"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0008903"	"2.04"	"54.36"
"20564"	"False"	"High"	"[R].GFYFNTVLSLAR.[S]"	""	"0.00724187"	"0.0007621"	"1"	"1"	"2"	"E9Q3L2"	"E9Q3L2 [32-43]"	""	"0"	"1387.73686"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005462"	"1.79"	""
"71488"	"False"	"High"	"[K].YGLIYHASLVGQSSPK.[H]"	""	"0.0264198"	"0.0007621"	"1"	"1"	"3"	"Q6DFW4"	"Q6DFW4 [338-353]"	""	"0"	"1719.90645"	"1.111"	"0.960"	"0.925138005747468"	""	"57.92"	"35.07"	"98.1"	"101.9"	"100.1"	"23.51"	"148.85"	"24.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006427"	"0.001775"	"3.07"	"38.47"
"28202"	"False"	"High"	"[R].KLTWLYQLSK.[G]"	""	"0.00664149"	"0.0007621"	"1"	"1"	"1"	"Q9WTX6"	"Q9WTX6 [578-587]"	""	"1"	"1279.74088"	"30.209"	"0.843"	"0.925138005747468"	""	"102.52"	"47.61"	"9.2"	"283.2"	"7.6"	"30.05"	"76.05"	"34.97"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005042"	"1.87"	"46.38"
"28154"	"False"	"High"	"[K].KLSSAEETAFQTPKPSQTPSVPPLVKTSLFSPK.[L]"	"2xBiotin [K14; K26]"	"0.0028996"	"0.0007621"	"1"	"1"	"2"	"Q8VCB1"	"Q8VCB1 [404-436]"	"Q8VCB1 2xBiotin [K417; K429]"	"2"	"3980.05477"	"0.983"	"2.921"	""	"0.913565512658592"	"49.03"	"120.24"	"64.6"	"60.6"	"174.8"	"35.74"	"25.28"	"89.76"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002355"	"4.59"	"58.72"
"71496"	"False"	"High"	"[R].YGLSSMQGWR.[V]"	""	"0.00620485"	"0.0007621"	"1"	"6"	"1"	"P36993-1"	"P36993-1 [24-33]"	""	"0"	"1184.55170"	"10.776"	"7.511"	"0.925138005747468"	"0.906515362333117"	"346.60"	"50.84"	"19.5"	"149.8"	"130.6"	"36.25"	"131.09"	"32.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002312"	"0.0004752"	"2.41"	"41.82"
"71497"	"False"	"High"	"[R].YGLSSMQGWR.[V]"	"1xOxidation [M6]"	"0.00397516"	"0.0007621"	"1"	"6"	"9"	"P36993-1"	"P36993-1 [24-33]"	""	"0"	"1200.54662"	"318.095"	"5.114"	"0.925138005747468"	"0.906515362333117"	"33.26"	"35.78"	"0.9"	"294.6"	"4.5"	"34.09"	"26.65"	"25.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003153"	"2.66"	"33.82"
"28113"	"False"	"High"	"[R].KLSEADNR.[K]"	"1xBiotin [K1]"	"0.00715289"	"0.0007621"	"1"	"2"	"8"	"Q9DCF9-1"	"Q9DCF9-1 [103-110]"	"Q9DCF9-1 1xBiotin [K103]"	"1"	"1158.55718"	"0.106"	"0.578"	"0.0101555592956455"	"0.906515362333117"	"64.59"	"51.37"	"187.8"	"15.6"	"96.6"	"31.23"	"48.10"	"32.78"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005407"	"2.35"	"24.39"
"71513"	"False"	"High"	"[K].YGNANVWK.[Y]"	""	"0.0225248"	"0.0007621"	"1"	"2"	"8"	"P62715"	"P62715 [137-144]"	""	"0"	"951.46829"	"167.343"	"5.235"	"0.75370100116895"	"0.906515362333117"	"40.10"	"45.22"	"1.8"	"289.5"	"8.6"	"32.79"	"26.28"	"29.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001531"	"1.95"	"27.31"
"71521"	"False"	"High"	"[R].YGPIVDVYVPLDFYTR.[R]"	""	"0.00425504"	"0.0007621"	"1"	"3"	"1"	"Q9R0U0-1"	"Q9R0U0-1 [33-48]"	""	"0"	"1916.97928"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003354"	"2.37"	""
"20589"	"False"	"High"	"[R].GGAGYWNSLFR.[F]"	""	"0.0069782"	"0.0007621"	"1"	"8"	"4"	"P11881-1"	"P11881-1 [294-304]"	""	"0"	"1227.59053"	"64.833"	"1.254"	"0.925138005747468"	"0.906515362333117"	"30.07"	"46.16"	"4.2"	"290.0"	"5.8"	"18.95"	"53.33"	"41.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005287"	"2.56"	"51.31"
"851"	"False"	"High"	"[R].AEKRPILSVQR.[R]"	"1xBiotin [K3]"	"0.00888012"	"0.0007621"	"1"	"1"	"4"	"Q3TB48"	"Q3TB48 [107-117]"	"Q3TB48 1xBiotin [K109]"	"1"	"1522.85224"	"0.234"	"0.928"	"0.925138005747468"	"0.906515362333117"	"68.79"	"31.94"	"130.8"	"35.6"	"133.6"	"33.19"	"201.19"	"29.32"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006548"	"2.41"	"36.22"
"71567"	"False"	"High"	"[K].YGVSGYPTLK.[I]"	""	"0.00351258"	"0.0007621"	"1"	"1"	"10"	"P27773"	"P27773 [95-104]"	""	"0"	"1084.56734"	"169.002"	"5.174"	"0.925138005747468"	"0.906515362333117"	"56.29"	"52.30"	"1.8"	"289.9"	"8.4"	"52.31"	"43.55"	"31.10"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002816"	"2.42"	"35.19"
"27741"	"False"	"High"	"[K].KLFYIPWR.[H]"	""	"0.0207957"	"0.0007621"	"1"	"1"	"8"	"P56477"	"P56477 [41-48]"	""	"1"	"1122.64586"	"61.972"	"1.588"	"0.925138005747468"	"0.946660454198708"	"69.15"	"88.45"	"4.2"	"290.1"	"5.7"	"87.61"	"30.25"	"61.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001421"	"1.97"	"48.74"
"27713"	"False"	"High"	"[K].KIFEYETQR.[R]"	"1xBiotin [K1]"	"0.0347849"	"0.0007621"	"1"	"1"	"3"	"O08579"	"O08579 [37-45]"	"O08579 1xBiotin [K37]"	"1"	"1439.69876"	"0.011"	"0.765"	"9.58177570709534E-06"	"0.906515362333117"	"60.36"	"39.75"	"170.3"	"1.9"	"127.8"	"49.70"	"226.67"	"39.49"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002331"	"1.89"	"40.59"
"27705"	"False"	"High"	"[R].KLESSESR.[S]"	"1xBiotin [K1]"	"0.02578"	"0.0007621"	"1"	"3"	"10"	"P48678-1"	"P48678-1 [420-427]"	"P48678-1 1xBiotin [K420]"	"1"	"1161.55685"	"0.131"	"0.633"	"0.477067253044389"	"0.906515362333117"	"67.47"	"46.37"	"163.8"	"22.0"	"114.2"	"29.91"	"55.77"	"52.29"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001739"	"1.39"	"22.88"
"27679"	"False"	"High"	"[K].KLEKSIVLLSQCTAR.[V]"	"1xBiotin [K]; 1xCarbamidomethyl [C12]"	"0.0110913"	"0.0007621"	"1"	"1"	"4"	"Q60664"	"Q60664 [260-274]"	"Q60664 1xBiotin [K]"	"2"	"1972.07181"	"0.490"	"0.522"	"0.925138005747468"	"0.906515362333117"	"66.93"	"86.70"	"157.0"	"70.7"	"72.3"	"35.55"	"58.98"	"62.78"	""	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0008037"	"2.96"	"46.40"
"71597"	"False"	"High"	"[R].YHFFLYK.[H]"	""	"0.0106222"	"0.0007621"	"1"	"3"	"27"	"Q9Z0P5"	"Q9Z0P5 [236-242]"	""	"0"	"1017.51926"	"106.966"	"3.051"	"0.932172616415912"	"0.906515362333117"	"49.90"	"54.09"	"2.6"	"289.4"	"8.0"	"63.76"	"83.57"	"30.46"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007713"	"2.83"	"42.25"
"71621"	"False"	"High"	"[K].YHPGYFGK.[V]"	""	"0.0226635"	"0.0007621"	"1"	"1"	"27"	"P14115"	"P14115 [48-55]"	""	"0"	"968.46248"	"134.581"	"3.717"	"0.925138005747468"	"0.906515362333117"	"52.52"	"51.31"	"2.2"	"288.3"	"9.5"	"41.31"	"34.14"	"26.83"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.00154"	"2.61"	"23.95"
"71626"	"False"	"High"	"[R].YHSLAPMYYR.[G]"	""	"0.00475612"	"0.0007621"	"1"	"3"	"11"	"P35278"	"P35278 [83-92]"	""	"0"	"1300.61430"	"36.746"	"4.170"	"0.925138005747468"	"0.906515362333117"	"147.93"	"46.07"	"7.1"	"265.5"	"27.3"	"42.75"	"96.82"	"33.59"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003711"	"2.68"	"33.87"
"28245"	"False"	"High"	"[K].KLVWVPSSK.[N]"	""	"0.0245458"	"0.0007621"	"1"	"1"	"4"	"Q8VDD5"	"Q8VDD5 [30-38]"	""	"1"	"1043.62479"	"236.611"	"6.714"	"0.925138005747468"	"0.906515362333117"	"58.99"	"60.50"	"1.5"	"289.7"	"8.8"	"40.99"	"47.09"	"42.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001655"	"2.74"	"32.41"
"28258"	"False"	"High"	"[K].KLYCIYVAIGQK.[R]"	"1xCarbamidomethyl [C4]"	"0.00933004"	"0.0007621"	"1"	"1"	"1"	"Q03265"	"Q03265 [241-252]"	""	"1"	"1455.80283"	"2.923"	"1.379"	"0.925138005747468"	"0.906515362333117"	"95.83"	"62.81"	"60.4"	"137.9"	"101.6"	"53.57"	"169.73"	"31.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.000687"	"2.70"	"41.13"
"28295"	"False"	"High"	"[R].KMCLFAGFQR.[K]"	"1xCarbamidomethyl [C3]"	"0.00950455"	"0.0007621"	"1"	"2"	"11"	"Q8VEK3"	"Q8VEK3 [568-577]"	""	"1"	"1257.62309"	"28.568"	"2.802"	"0.925138005747468"	"0.906515362333117"	"104.10"	"89.63"	"8.6"	"263.0"	"28.3"	"73.54"	"79.25"	"39.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006982"	"2.63"	"42.74"
"28296"	"False"	"High"	"[R].KMCLFAGFQR.[K]"	"1xCarbamidomethyl [C3]; 1xOxidation [M2]"	"0.00724187"	"0.0007621"	"1"	"2"	"33"	"Q8VEK3"	"Q8VEK3 [568-577]"	""	"1"	"1273.61801"	"222.294"	"4.198"	"0.925138005747468"	"0.906515362333117"	"90.96"	"69.38"	"1.4"	"293.0"	"5.6"	"57.59"	"56.97"	"37.48"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005446"	"2.29"	"37.00"
"28774"	"False"	"High"	"[K].KPDDGKMK.[G]"	"1xBiotin [K6]"	"0.00689246"	"0.0007621"	"1"	"1"	"29"	"Q9CPU0"	"Q9CPU0 [152-159]"	"Q9CPU0 1xBiotin [K157]"	"1"	"1144.54893"	"0.043"	"0.797"	"0.00148380987885406"	"0.906515362333117"	"55.32"	"43.39"	"152.4"	"7.3"	"140.3"	"28.79"	"40.97"	"59.72"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005206"	"2.76"	"21.30"
"28768"	"False"	"High"	"[R].KPCPYEQALGGDGPEEQ.[-]"	"1xBiotin [K1]; 1xCarbamidomethyl [C3]"	"0.0286091"	"0.0007621"	"1"	"2"	"9"	"Q8VCW4"	"Q8VCW4 [582-598]"	"Q8VCW4 1xBiotin [K582]"	"0"	"2100.90012"	"0.101"	"0.578"	"0.0925132030233288"	"0.906515362333117"	"44.97"	"52.89"	"171.5"	"18.9"	"109.6"	"31.43"	"30.34"	"47.86"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001917"	"2.38"	"43.52"
"71459"	"False"	"High"	"[K].YGGPYHIGGSPFK.[A]"	""	"0.0207957"	"0.0007621"	"1"	"1"	"2"	"Q8BTM8"	"Q8BTM8 [2501-2513]"	""	"0"	"1379.67426"	"66.511"	"1.439"	"0.91600845929028"	"0.924306229746472"	"62.92"	"81.26"	"3.6"	"291.5"	"4.9"	"32.86"	"56.36"	"76.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.000628"	"0.001422"	"2.83"	"36.34"
"28725"	"False"	"High"	"[R].KPAAGLSAAPVPPAAAPLLDFSSDSVPPAPR.[G]"	"1xBiotin [K1]"	"0.00334298"	"0.0007621"	"1"	"1"	"7"	"Q99P72-2"	"Q99P72-2 [59-89]"	"Q99P72-2 1xBiotin [K59]"	"0"	"3193.67143"	"0.429"	"1.672"	"0.925138005747468"	"0.983025330649738"	"66.52"	"67.95"	"81.9"	"45.3"	"172.8"	"50.05"	"42.47"	"37.18"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002692"	"3.88"	"59.59"
"28722"	"False"	"High"	"[K].KPAAAAVTK.[K]"	"1xBiotin [K1]"	"0.0311661"	"0.0007621"	"1"	"1"	"2"	"P15864"	"P15864 [160-168]"	"P15864 1xBiotin [K160]"	"0"	"1082.60268"	"0.324"	"0.597"	"0.925138005747468"	"0.906515362333117"	"70.36"	"65.38"	"146.4"	"67.5"	"86.1"	"39.57"	"51.54"	"59.00"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.00209"	"2.08"	"26.31"
"28720"	"False"	"High"	"[K].KPAAAAGAK.[K]"	"1xBiotin [K1]"	"0.00499735"	"0.0007621"	"1"	"2"	"2"	"P43277"	"P43277 [161-169]"	"P43277 1xBiotin [K161]"	"0"	"1010.54516"	"0.167"	"0.745"	"0.925138005747468"	"0.906515362333117"	"56.36"	"53.41"	"140.3"	"26.4"	"133.3"	"37.93"	"43.17"	"37.46"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003888"	"2.22"	"21.10"
"28714"	"False"	"High"	"[K].KNVSINTVTYEWAPPVQNQALAR.[Q]"	"1xBiotin [K1]"	"0.00291759"	"0.0007621"	"1"	"2"	"2"	"P47226-1"	"P47226-1 [107-129]"	"P47226-1 1xBiotin [K107]"	"1"	"2825.44031"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002364"	"3.69"	""
"28677"	"False"	"High"	"[K].KNSDWIWDWSSRPENIPPK.[E]"	"1xBiotin [K1]"	"0.00893515"	"0.0007621"	"1"	"1"	"1"	"O55003"	"O55003 [105-123]"	"O55003 1xBiotin [K105]"	"1"	"2581.22925"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0006582"	"3.14"	""
"28661"	"False"	"High"	"[R].KNPTDPKLAHLK.[T]"	"1xBiotin [K7]"	"0.0154759"	"0.0007621"	"1"	"1"	"3"	"Q3U9G9"	"Q3U9G9 [524-535]"	"Q3U9G9 1xBiotin [K530]"	"2"	"1587.86756"	"0.417"	"0.541"	"0.925138005747468"	"0.906515362333117"	"80.63"	"77.42"	"145.0"	"58.8"	"96.2"	"58.16"	"42.90"	"50.44"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.000459"	"0.001084"	"2.33"	"32.09"
"70969"	"False"	"High"	"[R].YANNSNYKNDVMIR.[K]"	"1xBiotin [K8]"	"0.00980268"	"0.0007621"	"1"	"2"	"1"	"Q9CQL1"	"Q9CQL1 [34-47]"	"Q9CQL1 1xBiotin [K41]"	"1"	"1927.87893"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007161"	"2.73"	""
"20555"	"False"	"High"	"[R].GFWLSQWK.[K]"	""	"0.0125486"	"0.0007621"	"1"	"1"	"27"	"Q9DCS3"	"Q9DCS3 [309-316]"	""	"0"	"1051.53598"	"95.093"	"2.671"	"0.949662611758987"	"0.906515362333117"	"73.30"	"74.40"	"2.2"	"291.3"	"6.5"	"59.82"	"29.47"	"35.46"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.000898"	"2.48"	"53.07"
"28612"	"False"	"High"	"[K].KNLSPGAVESDVR.[G]"	"1xBiotin [K1]"	"0.00355631"	"0.0007621"	"1"	"1"	"11"	"Q8CIE6"	"Q8CIE6 [170-182]"	"Q8CIE6 1xBiotin [K170]"	"1"	"1597.80027"	"0.216"	"0.975"	"0.925138005747468"	"0.906515362333117"	"51.99"	"55.40"	"139.3"	"30.8"	"129.9"	"22.84"	"39.97"	"41.83"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002852"	"2.78"	"39.81"
"28580"	"False"	"High"	"[R].KNKMLFSHLEGPESPR.[Y]"	"1xBiotin [K1]; 1xOxidation [M4]"	"0.00765613"	"0.0007621"	"1"	"1"	"1"	"Q9JHL0-1"	"Q9JHL0-1 [82-97]"	"Q9JHL0-1 1xBiotin [K82]"	"2"	"2112.03649"	"0.310"	"0.428"	"0.925138005747468"	"0.906515362333117"	"43.96"	"49.34"	"173.5"	"52.9"	"73.6"	"37.64"	"28.70"	"45.34"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005736"	"2.85"	"39.48"
"28551"	"False"	"High"	"[R].KNGFVVLK.[G]"	""	"0.0267456"	"0.0007621"	"1"	"2"	"7"	"P63242"	"P63242 [27-34]"	""	"1"	"904.56146"	"249.698"	"7.754"	"0.925138005747468"	"0.906515362333117"	"81.94"	"74.71"	"0.9"	"290.4"	"8.7"	"105.71"	"53.49"	"29.01"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001801"	"2.34"	"27.46"
"28542"	"False"	"High"	"[K].KNFESLSEAFSVASAAAALSQNR.[Y]"	""	"0.00302793"	"0.0007621"	"1"	"1"	"3"	"Q9DBG6"	"Q9DBG6 [244-266]"	""	"1"	"2398.19973"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002453"	"2.94"	""
"28540"	"False"	"High"	"[R].KNFATSLYSMIK.[G]"	"1xOxidation [M10]"	"0.00251498"	"0.0007621"	"1"	"1"	"13"	"P48036"	"P48036 [288-299]"	""	"1"	"1418.73481"	"359.618"	"2.558"	"0.925138005747468"	"0.916215054610739"	"49.65"	"81.08"	"0.9"	"297.3"	"1.8"	"41.32"	"26.12"	"70.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.000206"	"3.60"	"40.70"
"28503"	"False"	"High"	"[R].KNASCGTR.[S]"	"1xBiotin [K1]; 1xCarbamidomethyl [C5]"	"0.012783"	"0.0007621"	"1"	"1"	"19"	"Q9CQS8"	"Q9CQS8 [35-42]"	"Q9CQS8 1xBiotin [K35]"	"1"	"1119.50337"	"0.017"	"0.871"	"2.16367531555344E-05"	"0.906515362333117"	"35.67"	"30.13"	"164.6"	"2.6"	"132.8"	"15.78"	"40.25"	"27.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009119"	"2.46"	"17.49"
"28385"	"False"	"High"	"[R].KMLGNPSR.[L]"	"1xBiotin [K1]; 1xOxidation [M2]"	"0.0243957"	"0.0007621"	"1"	"2"	"12"	"O35465-1"	"O35465-1 [356-363]"	"O35465-1 1xBiotin [K356]"	"1"	"1144.56016"	"0.017"	"0.705"	"2.16367531555344E-05"	"0.906515362333117"	"34.52"	"21.99"	"171.9"	"3.0"	"125.1"	"26.74"	"31.96"	"10.79"	""	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001646"	"1.66"	"28.38"
"28384"	"False"	"High"	"[R].KMLGNPSR.[L]"	"1xBiotin [K1]"	"0.00555131"	"0.0007621"	"1"	"2"	"18"	"O35465-1"	"O35465-1 [356-363]"	"O35465-1 1xBiotin [K356]"	"1"	"1128.56524"	"0.028"	"0.959"	"5.45859577523876E-05"	"0.90875862466505"	"42.16"	"24.85"	"151.7"	"5.0"	"143.3"	"21.85"	"37.85"	"14.69"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004284"	"2.23"	"32.18"
"28297"	"False"	"High"	"[R].KMCLFAGFQRK.[A]"	"1xCarbamidomethyl [C3]; 1xOxidation [M2]"	"0.012783"	"0.0007621"	"1"	"2"	"3"	"Q8VEK3"	"Q8VEK3 [568-578]"	""	"2"	"1401.71297"	"129.503"	"1.301"	"0.932902630098326"	"0.992082519751165"	"147.74"	"71.46"	"2.1"	"295.3"	"2.6"	"78.00"	"99.21"	"49.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.00091"	"3.07"	"31.36"
"28638"	"False"	"High"	"[K].KNNLPFLTHVTLPR.[F]"	"1xBiotin [K1]"	"0.0128621"	"0.0007621"	"1"	"1"	"2"	"Q91YX5"	"Q91YX5 [201-214]"	"Q91YX5 1xBiotin [K201]"	"1"	"1876.02618"	"0.726"	"1.882"	"0.949662611758987"	"0.976703217224475"	"70.02"	"60.51"	"84.6"	"65.9"	"149.4"	"52.78"	"44.89"	"36.54"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.000919"	"2.23"	"52.67"
"70964"	"False"	"High"	"[K].YAMEQSIKSVLVK.[Q]"	"1xBiotin [K]"	"0.00814421"	"0.0007621"	"1"	"3"	"2"	"Q3UEB3-1"	"Q3UEB3-1 [78-90]"	"Q3UEB3-1 1xBiotin [K]"	"1"	"1721.89647"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006084"	"2.64"	""
"20416"	"False"	"High"	"[R].GFGFGGFAISAGK.[K]"	""	"0.0025621"	"0.0007621"	"1"	"1"	"2"	"Q810A7-1"	"Q810A7-1 [13-25]"	""	"0"	"1215.61568"	"160.899"	"4.153"	"0.925138005747468"	"0.906515362333117"	"56.37"	"94.99"	"1.7"	"290.4"	"7.9"	"45.88"	"41.19"	"73.02"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002102"	"2.63"	"51.67"
"30305"	"False"	"High"	"[K].KVLSGQDTEDR.[S]"	"1xBiotin [K1]"	"0.00724187"	"0.0007621"	"1"	"1"	"5"	"Q8VD57"	"Q8VD57 [6-16]"	"Q8VD57 1xBiotin [K6]"	"1"	"1473.70022"	"0.316"	"0.568"	"0.925138005747468"	"0.906515362333117"	"80.36"	"107.16"	"173.2"	"54.2"	"72.6"	"66.85"	"20.48"	"82.79"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005457"	"2.08"	"30.01"
"32286"	"False"	"High"	"[R].IESKSISAPVIFDR.[S]"	"1xBiotin [K4]"	"0.00555131"	"0.0007621"	"1"	"1"	"9"	"Q9CWK8"	"Q9CWK8 [113-126]"	"Q9CWK8 1xBiotin [K116]"	"1"	"1787.93603"	"0.133"	"0.767"	"0.925138005747468"	"0.906515362333117"	"54.54"	"42.77"	"159.5"	"21.2"	"119.3"	"33.59"	"61.13"	"22.31"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0004285"	"1.80"	"51.31"
"19602"	"False"	"High"	"[R].GAWDWSMLWK.[R]"	""	"0.00660056"	"0.0007621"	"1"	"3"	"6"	"Q80VA0"	"Q80VA0 [354-363]"	""	"0"	"1279.59284"	"1.596"	"2.377"	"0.981653263460989"	"0.916215054610739"	"42.87"	"53.62"	"66.2"	"93.2"	"140.6"	"27.91"	"219.97"	"40.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000501"	"2.46"	"62.59"
"19607"	"False"	"High"	"[K].GAWSNVLR.[G]"	""	"0.0339468"	"0.0007621"	"2"	"2"	"32"	"P48962; P51881"	"P48962 [273-280]; P51881 [273-280]"	""	"0"	"902.48428"	"161.480"	"4.296"	"0.925138005747468"	"0.906515362333117"	"45.75"	"37.30"	"1.6"	"291.4"	"7.0"	"21.45"	"31.01"	"38.35"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002266"	"2.22"	"37.89"
"32169"	"False"	"High"	"[R].LENEIQTYR.[S]"	""	"0.0130218"	"0.0007621"	"1"	"3"	"1"	"P02535-1"	"P02535-1 [440-448]"	""	"0"	"1165.58478"	"1.436"	"1.504"	"0.100075296238178"	""	"72.67"	"67.23"	"75.4"	"93.8"	"130.8"	"56.31"	"243.39"	"26.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009269"	"2.87"	"27.90"
"19613"	"False"	"High"	"[K].GAYIYNTLMEFIR.[S]"	""	"0.0032013"	"0.0007621"	"1"	"1"	"7"	"Q9D0R2"	"Q9D0R2 [348-360]"	""	"0"	"1590.79848"	"1.328"	"2.314"	"0.925138005747468"	"0.906515362333117"	"66.12"	"41.92"	"62.3"	"88.2"	"149.5"	"29.16"	"199.78"	"30.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002584"	"2.75"	"65.49"
"70575"	"False"	"High"	"[R].WMSYTYLYVR.[M]"	"1xOxidation [M2]"	"0.0129417"	"0.0007621"	"1"	"1"	"2"	"E9PZJ8-1"	"E9PZJ8-1 [917-926]"	""	"0"	"1397.65583"	"43.371"	"0.975"	"0.709657575970404"	""	"116.15"	"50.11"	"8.2"	"284.1"	"7.7"	"43.33"	"70.41"	"40.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009231"	"2.25"	"46.55"
"19614"	"False"	"High"	"[K].GAYIYNTLMEFIR.[S]"	"1xOxidation [M9]"	"0.0140222"	"0.0007621"	"1"	"1"	"1"	"Q9D0R2"	"Q9D0R2 [348-360]"	""	"0"	"1606.79339"	"1.596"	"0.919"	"0.925138005747468"	""	"62.85"	"40.50"	"85.9"	"137.1"	"77.0"	"17.88"	"147.57"	"39.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009898"	"2.10"	"61.41"
"19629"	"False"	"High"	"[K].GCCFVTFYTR.[K]"	"2xCarbamidomethyl [C2; C3]"	"0.00461129"	"0.0007621"	"1"	"13"	"5"	"Q9Z0H4-1"	"Q9Z0H4-1 [84-93]"	""	"0"	"1310.56564"	"141.972"	"4.519"	"0.477067253044389"	"0.906515362333117"	"55.00"	"41.64"	"1.8"	"289.9"	"8.3"	"41.80"	"25.72"	"21.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003618"	"2.40"	"43.79"
"31932"	"False"	"High"	"[K].LEEDMLCLLYGKNR.[G]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]; 1xOxidation [M5]"	"0.00357838"	"0.0007621"	"1"	"2"	"8"	"Q3TNL8-1"	"Q3TNL8-1 [261-274]"	"Q3TNL8-1 1xBiotin [K272]"	"1"	"1995.93367"	"0.428"	"0.877"	"0.928611703535518"	"0.906515362333117"	"107.41"	"88.34"	"119.6"	"55.9"	"124.5"	"87.80"	"61.82"	"83.19"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002863"	"2.71"	"51.10"
"1172"	"False"	"High"	"[R].AFVGPLSPSKAEDFRK.[L]"	"1xBiotin [K]"	"0.0265822"	"0.0007621"	"1"	"3"	"9"	"Q6P1H6-1"	"Q6P1H6-1 [529-544]"	"Q6P1H6-1 1xBiotin [K]"	"2"	"1975.01059"	"0.193"	"0.642"	"0.925138005747468"	"0.906515362333117"	"52.19"	"53.90"	"162.7"	"31.8"	"105.5"	"39.35"	"22.62"	"35.32"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0006427"	"0.001783"	"2.73"	"45.87"
"31676"	"False"	"High"	"[K].LDMSAKTTR.[H]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.0151924"	"0.0007621"	"1"	"1"	"9"	"Q01965"	"Q01965 [516-524]"	"Q01965 1xBiotin [K521]"	"1"	"1264.60242"	"0.189"	"0.656"	"0.925138005747468"	"0.906515362333117"	"37.56"	"38.84"	"170.8"	"30.4"	"98.8"	"34.23"	"25.70"	"40.34"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0004044"	"0.001067"	"1.81"	"25.96"
"31675"	"False"	"High"	"[K].LDMSAKTTR.[H]"	"1xBiotin [K6]"	"0.00809403"	"0.0007621"	"1"	"1"	"11"	"Q01965"	"Q01965 [516-524]"	"Q01965 1xBiotin [K521]"	"1"	"1248.60750"	"0.130"	"1.134"	"0.478597253695619"	"0.909223670800027"	"47.26"	"34.95"	"126.5"	"17.7"	"155.8"	"30.35"	"38.71"	"24.76"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006042"	"2.56"	"35.14"
"31666"	"False"	"High"	"[R].LDIVFYLLR.[I]"	""	"0.0131835"	"0.0007621"	"1"	"1"	"3"	"Q99JI4"	"Q99JI4 [138-146]"	""	"0"	"1151.68231"	"68.855"	"1.491"	"0.925138005747468"	"0.916215054610739"	"62.97"	"84.78"	"4.3"	"289.6"	"6.1"	"49.69"	"31.54"	"51.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.0009385"	"1.81"	"64.17"
"38626"	"False"	"High"	"[K].LTGMAFR.[V]"	""	"0.0294977"	"0.0007621"	"1"	"2"	"25"	"P16858"	"P16858 [226-232]"	""	"0"	"795.41817"	"28.299"	"3.543"	"0.925138005747468"	"0.906515362333117"	"55.88"	"29.87"	"8.5"	"260.1"	"31.4"	"18.67"	"77.82"	"31.17"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001975"	"2.06"	"31.74"
"70677"	"False"	"High"	"[K].WQKVLYER.[Q]"	"1xBiotin [K3]"	"0.00282872"	"0.0007621"	"1"	"1"	"5"	"Q9CXR4"	"Q9CXR4 [14-21]"	"Q9CXR4 1xBiotin [K16]"	"1"	"1347.68780"	"0.192"	"0.710"	"0.925138005747468"	"0.906515362333117"	"42.31"	"51.60"	"162.2"	"28.2"	"109.6"	"34.15"	"22.74"	"43.84"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002303"	"2.63"	"44.24"
"31448"	"False"	"High"	"[K].LCQGLFFR.[V]"	"1xCarbamidomethyl [C2]"	"0.00962271"	"0.0007621"	"1"	"1"	"10"	"Q9JKR6"	"Q9JKR6 [804-811]"	""	"0"	"1040.53460"	"136.942"	"3.872"	"0.925138005747468"	"0.906515362333117"	"76.97"	"66.99"	"2.4"	"288.4"	"9.2"	"55.65"	"33.46"	"53.62"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007042"	"2.21"	"44.58"
"19750"	"False"	"High"	"[K].GDFVTSFYWPWQTK.[A]"	""	"0.00562039"	"0.0007621"	"1"	"2"	"2"	"Q8VDQ1-1"	"Q8VDQ1-1 [93-106]"	""	"0"	"1761.82713"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0004321"	"2.46"	""
"31333"	"False"	"High"	"[K].LCAPPMNTQTSLLSSEKSLALLTVEK.[T]"	"1xBiotin [K17]; 1xCarbamidomethyl [C2]"	"0.00724187"	"0.0007621"	"1"	"2"	"2"	"Q3UJD6"	"Q3UJD6 [247-272]"	"Q3UJD6 1xBiotin [K263]"	"1"	"3057.56689"	"0.928"	"0.735"	""	"0.906515362333117"	"27.97"	"103.20"	"122.0"	"109.8"	"68.2"	"35.48"	"17.06"	"94.96"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005466"	"4.27"	"63.24"
"70687"	"False"	"High"	"[K].WQNNLLPSR.[Q]"	""	"0.00715289"	"0.0007621"	"1"	"1"	"12"	"P62245"	"P62245 [89-97]"	""	"0"	"1127.59562"	"125.999"	"4.388"	"0.936509618400951"	"0.906515362333117"	"77.40"	"55.83"	"2.2"	"287.1"	"10.6"	"71.05"	"50.79"	"24.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005391"	"2.70"	"37.53"
"70568"	"False"	"High"	"[K].WMPGVSQWK.[V]"	"1xOxidation [M2]"	"0.00974232"	"0.0007621"	"1"	"2"	"12"	"Q1HFZ0-1"	"Q1HFZ0-1 [357-365]"	""	"0"	"1134.54008"	"231.407"	"4.139"	"0.925138005747468"	"0.906515362333117"	"50.95"	"41.56"	"1.3"	"293.3"	"5.4"	"31.67"	"35.62"	"18.93"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0007142"	"2.29"	"37.44"
"70567"	"False"	"High"	"[K].WMPGVSQWK.[V]"	""	"0.0104272"	"0.0007621"	"1"	"2"	"9"	"Q1HFZ0-1"	"Q1HFZ0-1 [357-365]"	""	"0"	"1118.54516"	"43.990"	"6.359"	"0.788829801895385"	"0.906515362333117"	"90.39"	"79.45"	"7.7"	"242.9"	"49.4"	"58.34"	"105.77"	"46.87"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007594"	"1.76"	"43.07"
"32395"	"False"	"High"	"[R].LFAYDVFWLR.[F]"	""	"0.00346939"	"0.0007621"	"1"	"1"	"9"	"Q3UDE2"	"Q3UDE2 [480-489]"	""	"0"	"1329.69902"	"109.366"	"4.604"	"0.386257319295821"	"0.906515362333117"	"26.78"	"31.66"	"2.8"	"285.6"	"11.6"	"23.97"	"29.51"	"35.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002777"	"2.71"	"63.35"
"32400"	"False"	"High"	"[R].LFCVGFTK.[K]"	"1xCarbamidomethyl [C3]"	"0.00860997"	"0.0007621"	"1"	"1"	"12"	"P97351"	"P97351 [137-144]"	""	"0"	"971.50190"	"107.805"	"4.390"	"0.930511068991592"	"0.906515362333117"	"60.27"	"61.89"	"2.2"	"287.1"	"10.7"	"50.16"	"35.69"	"19.27"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000638"	"2.09"	"41.82"
"32542"	"False"	"High"	"[R].LFMVLWLK.[G]"	""	"0.00420273"	"0.0007621"	"1"	"1"	"11"	"Q9Z1Q5"	"Q9Z1Q5 [30-37]"	""	"0"	"1049.62162"	"49.523"	"1.884"	"0.929016530787821"	"0.916215054610739"	"71.70"	"77.45"	"5.7"	"282.2"	"12.1"	"56.04"	"49.44"	"46.24"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003321"	"2.15"	"62.69"
"32537"	"False"	"High"	"[R].LFMILWLK.[G]"	"1xOxidation [M3]"	"0.00369078"	"0.0007621"	"1"	"3"	"18"	"Q9QYB1"	"Q9QYB1 [41-48]"	""	"0"	"1079.63219"	"151.026"	"2.500"	"0.925138005747468"	"0.906515362333117"	"69.87"	"65.94"	"1.9"	"293.2"	"4.9"	"49.74"	"55.74"	"51.08"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002941"	"2.26"	"61.00"
"32536"	"False"	"High"	"[R].LFMILWLK.[G]"	""	"0.00487524"	"0.0007621"	"1"	"3"	"11"	"Q9QYB1"	"Q9QYB1 [41-48]"	""	"0"	"1063.63727"	"43.711"	"2.066"	"0.606683863879429"	"0.963994276545741"	"99.11"	"107.00"	"4.9"	"281.6"	"13.6"	"100.11"	"54.87"	"48.93"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003802"	"1.99"	"64.61"
"32531"	"False"	"High"	"[K].LFIYNPSSGEFLGR.[T]"	""	"0.0166635"	"0.0007621"	"1"	"1"	"2"	"P97370"	"P97370 [18-31]"	""	"0"	"1599.81657"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0005064"	"0.00116"	"3.18"	""
"32530"	"False"	"High"	"[R].LFIWVLR.[E]"	""	"0.0129417"	"0.0007621"	"1"	"1"	"9"	"P23591"	"P23591 [226-232]"	""	"0"	"946.58728"	"90.905"	"1.890"	"0.979301999091092"	"0.990945572526033"	"80.54"	"44.96"	"3.8"	"289.2"	"7.0"	"36.17"	"67.01"	"28.60"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009235"	"2.12"	"59.01"
"70425"	"False"	"High"	"[K].WLAVWFK.[M]"	""	"0.0197976"	"0.0007621"	"1"	"1"	"17"	"Q9QZI9"	"Q9QZI9 [439-445]"	""	"0"	"949.52944"	"54.942"	"1.396"	"0.953254752288654"	"0.936238272383155"	"55.96"	"45.12"	"4.9"	"288.5"	"6.6"	"46.07"	"20.16"	"33.02"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0005902"	"0.001355"	"1.84"	"56.32"
"32511"	"False"	"High"	"[K].IFLINKLHSVYEEEGR.[S]"	"1xBiotin [K6]"	"0.00373673"	"0.0007621"	"1"	"3"	"2"	"Q7TN60"	"Q7TN60 [764-779]"	"Q7TN60 1xBiotin [K769]"	"1"	"2173.11104"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0002985"	"3.79"	""
"70457"	"False"	"High"	"[R].WLGANSFR.[T]"	""	"0.013936"	"0.0007621"	"1"	"1"	"26"	"P12265"	"P12265 [371-378]"	""	"0"	"950.48428"	"120.151"	"4.540"	"0.925138005747468"	"0.906515362333117"	"67.62"	"83.55"	"2.5"	"280.9"	"16.6"	"58.35"	"62.29"	"52.17"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009839"	"2.10"	"39.25"
"32468"	"False"	"High"	"[KR].IFHVNWFR.[KR]"	""	"0.0120924"	"0.0007621"	"1"	"2"	"19"	"Q9Z2V4"	"Q9Z2V4 [511-518]"	""	"0"	"1118.58941"	"83.536"	"2.199"	"0.988282201872393"	"0.969054191468458"	"58.97"	"69.70"	"3.6"	"287.7"	"8.8"	"75.08"	"43.78"	"28.04"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003095"	"0.0008689"	"1.90"	"46.74"
"70783"	"False"	"High"	"[K].WSPALQIR.[T]"	""	"0.0211827"	"0.0007621"	"1"	"1"	"4"	"P61089"	"P61089 [95-102]"	""	"0"	"970.54688"	"238.507"	"4.980"	"0.925138005747468"	"0.906515362333117"	"80.17"	"58.92"	"1.4"	"292.4"	"6.2"	"34.82"	"61.64"	"83.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001444"	"1.91"	"40.11"
"1214"	"False"	"High"	"[R].AGASSMKLPLNK.[F]"	"1xBiotin [K7]; 1xOxidation [M6]"	"0.00509093"	"0.0007621"	"1"	"1"	"1"	"Q91VH2"	"Q91VH2 [196-207]"	"Q91VH2 1xBiotin [K202]"	"1"	"1458.74433"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003958"	"3.16"	""
"32456"	"False"	"High"	"[K].LFGPYVWGR.[Y]"	""	"0.00597889"	"0.0007621"	"1"	"1"	"6"	"Q8VCT3"	"Q8VCT3 [277-285]"	""	"0"	"1094.57818"	"168.569"	"4.403"	"0.925138005747468"	"0.906515362333117"	"58.76"	"58.88"	"1.7"	"290.6"	"7.7"	"49.22"	"7.01"	"22.97"	"MandatoryModificationMissing"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002312"	"0.0004574"	"2.05"	"50.07"
"32454"	"False"	"High"	"[R].IFGPIWNR.[D]"	""	"0.0148224"	"0.0007621"	"1"	"1"	"21"	"Q00612"	"Q00612 [220-227]"	""	"0"	"1002.55196"	"126.605"	"3.767"	"0.925138005747468"	"0.906515362333117"	"53.74"	"57.00"	"2.3"	"288.9"	"8.7"	"38.21"	"46.97"	"41.87"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001045"	"2.07"	"46.07"
"1179"	"False"	"High"	"[K].AFVSTSFHKCGLPAETEWMK.[T]"	"1xBiotin [K9]; 1xCarbamidomethyl [C10]; 1xOxidation [M19]"	"0.00334298"	"0.0007621"	"1"	"1"	"6"	"Q8CJF7"	"Q8CJF7 [1257-1276]"	"Q8CJF7 1xBiotin [K1265]"	"1"	"2568.17200"	"0.526"	"2.058"	"0.929016530787821"	"0.924306229746472"	"70.15"	"74.08"	"91.1"	"50.7"	"158.2"	"57.58"	"36.49"	"47.08"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001583"	"0.0002693"	"3.33"	"48.59"
"70534"	"False"	"High"	"[K].WLWYWR.[N]"	""	"0.0352115"	"0.0007621"	"1"	"2"	"4"	"Q3UPF5-1"	"Q3UPF5-1 [697-702]"	""	"0"	"1009.50428"	"51.832"	"0.849"	"0.928611703535518"	"0.906515362333117"	"47.29"	"83.25"	"5.3"	"290.0"	"4.7"	"28.02"	"32.07"	"73.07"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.000686"	"0.002358"	"1.93"	"58.55"
"32441"	"False"	"High"	"[R].IFGGFLMR.[K]"	""	"0.0104272"	"0.0007621"	"1"	"2"	"9"	"Q32MW3"	"Q32MW3 [310-317]"	""	"0"	"940.50732"	"63.648"	"4.446"	"0.484565749895235"	"0.906515362333117"	"98.10"	"66.87"	"4.8"	"271.5"	"23.7"	"59.65"	"75.48"	"26.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007593"	"2.53"	"51.06"
"70548"	"False"	"High"	"[K].WMGIAFR.[I]"	""	"0.0343633"	"0.0007621"	"1"	"2"	"9"	"Q8VDM6"	"Q8VDM6 [352-358]"	""	"0"	"880.44980"	"22.377"	"3.365"	"0.925138005747468"	"0.906515362333117"	"92.19"	"96.31"	"10.6"	"242.7"	"46.7"	"68.57"	"119.82"	"36.44"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000686"	"0.002295"	"1.56"	"48.00"
"70553"	"False"	"High"	"[R].WMKNEGPGR.[L]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.00664149"	"0.0007621"	"1"	"2"	"10"	"A2ALW5"	"A2ALW5 [343-351]"	"A2ALW5 1xBiotin [K345]"	"1"	"1316.58744"	"0.239"	"0.786"	"0.925138005747468"	"0.906515362333117"	"42.65"	"37.54"	"142.9"	"40.6"	"116.5"	"40.97"	"27.50"	"43.18"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005051"	"2.43"	"32.08"
"32410"	"False"	"High"	"[K].LFDIFSQQVATVIQSR.[Q]"	""	"0.0159602"	"0.0007621"	"1"	"1"	"1"	"Q9EQH3"	"Q9EQH3 [324-339]"	""	"0"	"1851.99632"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0005064"	"0.001113"	"2.44"	""
"32401"	"False"	"High"	"[R].LFCWIVTR.[I]"	"1xCarbamidomethyl [C3]"	"0.0280885"	"0.0007621"	"1"	"2"	"2"	"Q5SYD0"	"Q5SYD0 [351-358]"	""	"0"	"1094.58155"	"45.733"	"1.360"	"0.925138005747468"	"0.910227350242735"	"108.28"	"34.94"	"5.8"	"286.4"	"7.8"	"30.68"	"82.62"	"32.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001879"	"1.82"	"51.55"
"1182"	"False"	"High"	"[K].AFWQTMIR.[E]"	""	"0.0272416"	"0.0007621"	"1"	"3"	"5"	"P56183-1"	"P56183-1 [98-105]"	""	"0"	"1052.53460"	"58.303"	"6.183"	"0.837024075063163"	"0.906515362333117"	"108.17"	"70.45"	"4.3"	"263.5"	"32.2"	"57.97"	"93.97"	"52.57"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0006486"	"0.001834"	"1.86"	"49.64"
"27601"	"False"	"High"	"[R].KLAVNMVPFPR.[L]"	""	"0.00660056"	"0.0007621"	"4"	"8"	"11"	"Q7TMM9; Q9D6F9; Q9ERD7; P99024"	"Q7TMM9 [252-262]; Q9D6F9 [252-262]; Q9ERD7 [252-262]; P99024 [252-262]"	""	"1"	"1271.72927"	"109.099"	"9.222"	"0.815838330309288"	"0.906515362333117"	"102.15"	"64.57"	"2.3"	"273.0"	"24.8"	"39.52"	"86.67"	"55.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005004"	"2.61"	"42.27"
"70793"	"False"	"High"	"[K].WTAISALEYGMPVTLIGEAVFAR.[C]"	"1xOxidation [M11]"	"0.0102358"	"0.0007621"	"1"	"1"	"1"	"Q9DCD0"	"Q9DCD0 [266-288]"	""	"0"	"2511.29521"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007453"	"3.28"	""
"19827"	"False"	"High"	"[R].GDLTTEPFLPKSVLVK.[-]"	"1xBiotin [K11]"	"0.00624333"	"0.0007621"	"1"	"1"	"7"	"Q9R0M8"	"Q9R0M8 [375-390]"	"Q9R0M8 1xBiotin [K385]"	"1"	"1970.06671"	"0.197"	"0.415"	"0.925138005747468"	"0.906515362333117"	"74.72"	"93.71"	"163.1"	"40.0"	"96.9"	"70.90"	"42.61"	"68.11"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004776"	"3.20"	"57.86"
"30839"	"False"	"High"	"[R].LAGGDWFTSR.[T]"	""	"0.00452652"	"0.0007621"	"1"	"1"	"9"	"Q76MZ3"	"Q76MZ3 [135-144]"	""	"0"	"1109.53743"	"135.448"	"4.808"	"0.373622282101816"	"0.906515362333117"	"54.44"	"62.84"	"2.2"	"287.4"	"10.4"	"49.76"	"38.66"	"21.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.000356"	"2.65"	"42.10"
"20381"	"False"	"High"	"[R].GFAFVYFER.[I]"	""	"0.0101101"	"0.0007621"	"1"	"1"	"14"	"Q6PFR5"	"Q6PFR5 [159-167]"	""	"0"	"1135.55711"	"157.395"	"2.329"	"0.925138005747468"	"0.929688265682494"	"63.06"	"89.94"	"1.6"	"293.2"	"5.2"	"55.04"	"41.07"	"54.71"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007373"	"2.52"	"53.33"
"30815"	"False"	"High"	"[R].LAFLMHSWK.[D]"	"1xOxidation [M5]"	"0.0069782"	"0.0007621"	"1"	"2"	"13"	"Q9ER72"	"Q9ER72 [514-522]"	""	"0"	"1148.59211"	"186.560"	"2.825"	"0.925138005747468"	"0.906515362333117"	"80.14"	"77.84"	"2.1"	"293.1"	"4.8"	"54.66"	"61.86"	"69.05"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0005261"	"2.94"	"40.37"
"70896"	"False"	"High"	"[R].WYLGGSAK.[G]"	""	"0.0143724"	"0.0007621"	"1"	"1"	"12"	"Q04646-2"	"Q04646-2 [4-11]"	""	"0"	"881.45158"	"246.405"	"8.720"	"0.925138005747468"	"0.906515362333117"	"77.94"	"58.00"	"1.4"	"287.6"	"11.0"	"47.89"	"60.86"	"40.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001015"	"2.13"	"33.73"
"30800"	"False"	"High"	"[K].LAETLAKTQVAGGQLSFK.[G]"	"1xBiotin [K7]"	"0.00760895"	"0.0007621"	"1"	"1"	"6"	"P46061"	"P46061 [9-26]"	"P46061 1xBiotin [K15]"	"1"	"2088.11579"	"0.284"	"0.585"	"0.925138005747468"	"0.906515362333117"	"39.96"	"50.40"	"162.4"	"45.8"	"91.8"	"17.10"	"39.14"	"48.06"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0005713"	"3.09"	"49.30"
"30700"	"False"	"High"	"[R].IAAYLFK.[G]"	""	"0.0265822"	"0.0007621"	"1"	"1"	"8"	"Q68FD5"	"Q68FD5 [1510-1516]"	""	"0"	"825.48690"	"157.195"	"4.034"	"0.925138005747468"	"0.906515362333117"	"72.16"	"72.55"	"1.9"	"291.5"	"6.6"	"59.08"	"25.33"	"26.80"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.00179"	"2.19"	"39.47"
"30651"	"False"	"High"	"[R].KYVSQYYPK.[L]"	""	"0.00962271"	"0.0007621"	"1"	"3"	"9"	"Q3TEA8-1"	"Q3TEA8-1 [283-291]"	""	"1"	"1175.60954"	"97.651"	"2.448"	"0.521587196119286"	"0.927892136092816"	"63.33"	"49.56"	"3.3"	"288.5"	"8.2"	"42.78"	"52.05"	"30.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007041"	"2.55"	"24.19"
"20384"	"False"	"High"	"[R].GFCFITFK.[E]"	"1xCarbamidomethyl [C3]"	"0.00706501"	"0.0007621"	"1"	"4"	"24"	"Q60668-1"	"Q60668-1 [224-231]"	""	"0"	"1019.50190"	"146.514"	"3.880"	"0.925138005747468"	"0.906515362333117"	"76.27"	"66.49"	"1.9"	"291.0"	"7.2"	"60.10"	"42.43"	"44.29"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005322"	"2.24"	"52.06"
"70898"	"False"	"High"	"[KR].WYLSGFYK.[K]"	""	"0.00866334"	"0.0007621"	"1"	"2"	"26"	"B9EJ86"	"B9EJ86 [468-475]"	""	"0"	"1063.52474"	"93.772"	"2.773"	"0.952589814133025"	"0.906515362333117"	"33.89"	"28.44"	"2.9"	"289.0"	"8.2"	"22.19"	"26.45"	"20.81"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006431"	"2.31"	"49.99"
"1150"	"False"	"High"	"[R].AFSFYLSNIGR.[D]"	""	"0.00291759"	"0.0007621"	"1"	"1"	"5"	"O08856"	"O08856 [76-86]"	""	"0"	"1274.65280"	"106.423"	"2.857"	"0.454924058924831"	"0.909223670800027"	"44.98"	"46.67"	"2.5"	"289.4"	"8.0"	"32.30"	"30.62"	"33.64"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.0002361"	"2.52"	"52.12"
"30584"	"False"	"High"	"[K].KYKPLFDYFIK.[C]"	""	"0.00493592"	"0.0007621"	"1"	"1"	"5"	"Q8BU30"	"Q8BU30 [288-298]"	""	"1"	"1461.81405"	"82.933"	"2.325"	"0.592458659195948"	"0.949256351462087"	"39.06"	"26.50"	"3.5"	"288.9"	"7.6"	"18.45"	"34.12"	"31.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003851"	"3.10"	"49.03"
"1148"	"False"	"High"	"[K].AFSCSSFNSNTFLTR.[L]"	"1xCarbamidomethyl [C4]"	"0.0245458"	"0.0007621"	"1"	"1"	"3"	"P46061"	"P46061 [503-517]"	""	"0"	"1738.78534"	"56.912"	"1.518"	"0.925138005747468"	"0.913565512658592"	"140.64"	"59.63"	"4.4"	"287.7"	"7.9"	"45.81"	"84.24"	"58.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001661"	"2.12"	"45.48"
"30573"	"False"	"High"	"[K].KYGLFKEQNPYEK.[F]"	"1xBiotin [K6]"	"0.0161581"	"0.0007621"	"1"	"1"	"1"	"Q8R143"	"Q8R143 [161-173]"	"Q8R143 1xBiotin [K166]"	"2"	"1869.92038"	"0.870"	"0.585"	"0.973877558437902"	"0.906515362333117"	"62.64"	"67.36"	"118.2"	"108.6"	"73.2"	"55.80"	"31.78"	"46.16"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005064"	"0.001129"	"3.00"	"41.42"
"1137"	"False"	"High"	"[K].AFPVYLWQPYLR.[H]"	""	"0.00938785"	"0.0007621"	"1"	"1"	"15"	"Q3UW53"	"Q3UW53 [160-171]"	""	"0"	"1552.83110"	"97.445"	"2.394"	"0.425904733810833"	"0.919235111389825"	"50.19"	"47.29"	"3.1"	"289.9"	"7.0"	"36.60"	"49.24"	"32.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.00069"	"2.88"	"61.26"
"70915"	"False"	"High"	"[K].YAAELHLVHWNTK.[Y]"	""	"0.00312306"	"0.0007621"	"1"	"1"	"3"	"P00920"	"P00920 [114-126]"	""	"0"	"1581.81724"	"167.355"	"6.814"	"0.423204176496168"	"0.906515362333117"	"77.73"	"93.46"	"1.7"	"287.5"	"10.9"	"48.42"	"64.32"	"78.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002516"	"2.66"	"38.58"
"70932"	"False"	"High"	"[K].YAFVNWINK.[A]"	""	"0.00357838"	"0.0007621"	"1"	"2"	"36"	"Q61233"	"Q61233 [124-132]"	""	"0"	"1154.59931"	"137.768"	"3.957"	"0.925138005747468"	"0.906515362333117"	"55.78"	"43.48"	"2.1"	"290.4"	"7.6"	"56.18"	"26.46"	"25.89"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002857"	"3.01"	"48.90"
"30515"	"False"	"High"	"[R].KWQIFK.[T]"	""	"0.0345735"	"0.0007621"	"1"	"1"	"16"	"P61211"	"P61211 [152-157]"	""	"1"	"849.49814"	"103.466"	"2.945"	"0.947989303413716"	"0.906515362333117"	"45.54"	"36.03"	"2.6"	"289.5"	"7.9"	"25.60"	"34.99"	"47.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002313"	"2.64"	"35.39"
"20405"	"False"	"High"	"[R].GFFGFPGPR.[S]"	""	"0.0137652"	"0.0007621"	"1"	"1"	"21"	"O35387"	"O35387 [9-17]"	""	"0"	"981.49411"	"123.158"	"3.035"	"0.940298707768758"	"0.910169443405431"	"41.25"	"54.29"	"2.5"	"290.5"	"7.0"	"41.77"	"8.64"	"35.48"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009783"	"1.91"	"50.83"
"20409"	"False"	"High"	"[R].GFFLNHYFSK.[Y]"	""	"0.00680777"	"0.0007621"	"1"	"1"	"16"	"Q8BGC4"	"Q8BGC4 [302-311]"	""	"0"	"1259.62077"	"188.316"	"4.338"	"0.925138005747468"	"0.906515362333117"	"87.95"	"79.59"	"1.6"	"292.3"	"6.1"	"69.37"	"72.08"	"31.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000517"	"3.04"	"46.10"
"20378"	"False"	"High"	"[K].GFAFISFHR.[R]"	""	"0.00239351"	"0.0007621"	"1"	"1"	"27"	"Q9Z1D1"	"Q9Z1D1 [281-289]"	""	"0"	"1081.55778"	"96.795"	"2.262"	"0.947989303413716"	"0.906515362333117"	"79.03"	"68.93"	"3.0"	"288.8"	"8.2"	"58.77"	"59.99"	"43.96"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001965"	"2.59"	"45.99"
"30847"	"False"	"High"	"[R].LAGKGTAEPHSASDAGMKR.[A]"	"1xBiotin [K4]; 1xOxidation [M17]"	"0.00493592"	"0.0007621"	"1"	"1"	"13"	"Q99LR1"	"Q99LR1 [42-60]"	"Q99LR1 1xBiotin [K45]"	"2"	"2126.01173"	"0.031"	"0.691"	"6.53424378561839E-05"	"0.906515362333117"	"71.66"	"74.68"	"173.8"	"5.8"	"120.3"	"70.02"	"49.14"	"73.77"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003856"	"3.22"	"23.64"
"70873"	"False"	"High"	"[K].WWTCFVK.[R]"	"1xCarbamidomethyl [C4]"	"0.0180522"	"0.0007621"	"1"	"1"	"34"	"Q9JM76"	"Q9JM76 [159-165]"	""	"0"	"1026.48658"	"72.297"	"3.027"	"0.998339301563982"	"0.906515362333117"	"50.42"	"76.02"	"4.3"	"282.7"	"13.0"	"48.60"	"36.17"	"44.70"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001246"	"1.94"	"49.05"
"30890"	"False"	"High"	"[K].IAGYVTHLMK.[R]"	""	"0.0352115"	"0.0007621"	"1"	"1"	"2"	"P63276"	"P63276 [50-59]"	""	"0"	"1132.61833"	"45.062"	"3.732"	"0.563876479871168"	"0.906515362333117"	"143.30"	"82.84"	"6.1"	"278.7"	"15.2"	"49.71"	"79.67"	"60.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002356"	"2.38"	"33.88"
"70802"	"False"	"High"	"[R].WTGMIIGPPR.[TV]"	"1xOxidation [M4]"	"0.0100479"	"0.0007621"	"2"	"4"	"14"	"Q9D2M8; Q9CZY3"	"Q9D2M8 [46-55]; Q9CZY3 [48-57]"	""	"0"	"1143.59793"	"207.824"	"2.657"	"0.925138005747468"	"0.916215054610739"	"49.71"	"52.19"	"1.7"	"293.8"	"4.5"	"30.42"	"42.64"	"54.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0007341"	"2.18"	"37.79"
"31230"	"False"	"High"	"[R].LATFWHYAK.[V]"	""	"0.00357838"	"0.0007621"	"1"	"1"	"16"	"Q9CPQ8"	"Q9CPQ8 [27-35]"	""	"0"	"1136.58874"	"125.164"	"4.598"	"0.925138005747468"	"0.906515362333117"	"62.40"	"74.13"	"2.3"	"285.4"	"12.3"	"61.57"	"46.51"	"43.92"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002857"	"2.33"	"39.29"
"19951"	"False"	"High"	"[R].GDVQNKPSGLWGMLK.[S]"	"1xBiotin [K6]; 1xOxidation [M13]"	"0.0131024"	"0.0007621"	"1"	"1"	"13"	"Q8BS95"	"Q8BS95 [218-232]"	"Q8BS95 1xBiotin [K223]"	"0"	"1871.91425"	"0.205"	"0.664"	"0.925138005747468"	"0.906515362333117"	"83.82"	"81.05"	"167.2"	"29.9"	"102.9"	"69.07"	"46.95"	"36.28"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009354"	"3.02"	"49.13"
"1170"	"False"	"High"	"[K].AFVGNQLPFIGFTYFR.[E]"	""	"0.0218436"	"0.0007621"	"1"	"2"	"1"	"P70336-1"	"P70336-1 [402-417]"	""	"0"	"1876.97447"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001483"	"2.81"	""
"19955"	"False"	"High"	"[K].GDVVIVLTGWRPGSGFTNTMR.[V]"	"1xOxidation [M20]"	"0.011023"	"0.0007621"	"1"	"2"	"20"	"P52480"	"P52480 [506-526]"	""	"0"	"2279.16011"	"414.455"	"7.106"	"0.801950165495267"	"0.906515362333117"	"96.00"	"86.30"	"0.7"	"294.6"	"4.7"	"92.23"	"42.03"	"31.90"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007985"	"2.96"	"52.87"
"19962"	"False"	"High"	"[K].GDWSQFTLWQQGR.[K]"	""	"0.00980268"	"0.0007621"	"1"	"1"	"1"	"Q8BSY0"	"Q8BSY0 [606-618]"	""	"0"	"1608.75537"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.000718"	"2.25"	""
"31116"	"False"	"High"	"[R].LAQAWFNSHR.[E]"	""	"0.0262584"	"0.0007621"	"1"	"2"	"4"	"Q9D024"	"Q9D024 [163-172]"	""	"0"	"1229.61742"	"159.428"	"3.825"	"0.430077479647442"	"0.906515362333117"	"42.37"	"32.31"	"1.7"	"291.6"	"6.7"	"30.03"	"36.54"	"14.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001763"	"2.39"	"33.21"
"1164"	"False"	"High"	"[R].AFSYYGPLR.[T]"	""	"0.0151924"	"0.0007621"	"1"	"4"	"20"	"Q8BL97-1"	"Q8BL97-1 [59-67]"	""	"0"	"1073.54146"	"146.807"	"3.772"	"0.925138005747468"	"0.906515362333117"	"58.26"	"50.53"	"2.1"	"290.1"	"7.8"	"39.79"	"25.69"	"31.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0004044"	"0.001065"	"2.42"	"40.73"
"31076"	"False"	"High"	"[K].IANKQFSAVK.[N]"	"1xBiotin [K4]"	"0.0113686"	"0.0007621"	"1"	"1"	"1"	"Q8VEE4"	"Q8VEE4 [273-282]"	"Q8VEE4 1xBiotin [K276]"	"1"	"1331.71402"	"31.917"	"1.014"	"0.665420827867785"	"0.906515362333117"	"89.53"	"63.83"	"8.0"	"285.5"	"6.5"	"56.61"	"67.63"	"38.06"	""	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0008205"	"2.53"	"36.57"
"31304"	"False"	"High"	"[K].LAWFLVTSANLSK.[A]"	""	"0.0112291"	"0.0007621"	"1"	"1"	"1"	"Q8BJ37"	"Q8BJ37 [508-520]"	""	"0"	"1449.81003"	"24.029"	"0.767"	"0.925138005747468"	""	"83.52"	"36.57"	"11.1"	"280.6"	"8.4"	"21.86"	"78.57"	"31.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0008119"	"2.44"	"57.54"
"20007"	"False"	"High"	"[K].GEAPAKSSTHR.[D]"	"1xBiotin [K6]"	"0.011023"	"0.0007621"	"1"	"2"	"8"	"A2AKQ0"	"A2AKQ0 [14-24]"	"A2AKQ0 1xBiotin [K19]"	"1"	"1366.65321"	"0.224"	"1.065"	"0.925138005747468"	"0.916215054610739"	"93.72"	"68.72"	"124.1"	"27.2"	"148.8"	"60.65"	"63.43"	"18.90"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007967"	"2.14"	"19.63"
"31045"	"False"	"High"	"[R].IAIYELLFK.[E]"	""	"0.00288171"	"0.0007621"	"1"	"1"	"11"	"P63325"	"P63325 [9-17]"	""	"0"	"1109.66051"	"101.102"	"2.605"	"0.452995671455796"	"0.913565512658592"	"61.42"	"83.07"	"4.1"	"285.5"	"10.4"	"44.69"	"50.32"	"52.59"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002345"	"2.86"	"61.54"
"20188"	"False"	"High"	"[R].GELFLFWNLYK.[A]"	""	"0.0124714"	"0.0007621"	"1"	"1"	"3"	"Q6ZQ88"	"Q6ZQ88 [690-700]"	""	"0"	"1429.75145"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0008914"	"1.69"	""
"30974"	"False"	"High"	"[K].IAIFGATGR.[T]"	""	"0.0197976"	"0.0007621"	"1"	"1"	"5"	"Q923D2"	"Q923D2 [6-14]"	""	"0"	"905.52033"	"116.456"	"3.729"	"0.503640274038299"	"0.906515362333117"	"43.62"	"40.32"	"2.6"	"288.4"	"9.0"	"71.36"	"45.06"	"32.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0005902"	"0.001355"	"1.96"	"37.80"
"30967"	"False"	"High"	"[K].LALDVEIATYR.[K]"	""	"0.026098"	"0.0007621"	"2"	"6"	"2"	"Q3UV17; Q922U2"	"Q3UV17 [460-470]; Q922U2 [455-465]"	""	"0"	"1263.69433"	"1.583"	"1.464"	"0.216857619441888"	""	"66.76"	"65.34"	"69.4"	"119.5"	"111.0"	"45.41"	"240.63"	"41.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001752"	"2.77"	"47.57"
"20324"	"False"	"High"	"[K].GESSGKNVTLPAVFK.[A]"	"1xBiotin [K6]"	"0.00882542"	"0.0007621"	"1"	"1"	"4"	"Q9D8E6"	"Q9D8E6 [15-29]"	"Q9D8E6 1xBiotin [K20]"	"1"	"1759.90473"	"0.295"	"0.679"	"0.925138005747468"	"0.906515362333117"	"58.21"	"58.13"	"138.2"	"38.7"	"123.0"	"35.36"	"59.31"	"47.89"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006534"	"1.72"	"50.02"
"30945"	"False"	"High"	"[R].LAKYNQILR.[I]"	"1xBiotin [K3]"	"0.00496654"	"0.0007621"	"1"	"1"	"8"	"P17182"	"P17182 [404-412]"	"P17182 1xBiotin [K406]"	"1"	"1344.74565"	"0.102"	"0.710"	"0.925138005747468"	"0.906515362333117"	"44.08"	"36.37"	"155.3"	"17.8"	"126.9"	"32.38"	"34.28"	"21.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003869"	"2.01"	"43.51"
"30905"	"False"	"High"	"[R].IAKAASEK.[S]"	"1xBiotin [K3]"	"0.0123947"	"0.0007621"	"1"	"1"	"4"	"P17182"	"P17182 [328-335]"	"P17182 1xBiotin [K330]"	"1"	"1043.55539"	"0.236"	"0.797"	"0.925138005747468"	"0.906515362333117"	"31.84"	"38.30"	"143.8"	"34.8"	"121.4"	"41.20"	"18.66"	"22.20"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0008874"	"2.03"	"23.40"
"70860"	"False"	"High"	"[R].WVVPFSPVIQK.[-]"	"1xBiotin [K11]"	"0.0104918"	"0.0007621"	"1"	"1"	"5"	"Q9QUK4"	"Q9QUK4 [1437-1447]"	"Q9QUK4 1xBiotin [K1447]"	"0"	"1525.82357"	"0.540"	"0.964"	"0.925138005747468"	"0.906515362333117"	"64.11"	"45.55"	"111.5"	"69.0"	"119.5"	"44.05"	"52.96"	"22.43"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007619"	"2.30"	"64.22"
"70868"	"False"	"High"	"[R].WWILQNR.[M]"	""	"0.0286091"	"0.0007621"	"1"	"1"	"3"	"Q8BGX2"	"Q8BGX2 [178-184]"	""	"0"	"1015.54721"	"129.293"	"3.356"	"0.933451859704016"	"0.906515362333117"	"43.71"	"58.54"	"2.1"	"290.1"	"7.8"	"78.85"	"36.84"	"36.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001913"	"1.81"	"51.01"
"20015"	"False"	"High"	"[K].GECFGLLGFNGAGKTTTFK.[M]"	"1xBiotin [K14]; 1xCarbamidomethyl [C3]"	"0.00318156"	"0.0007621"	"1"	"1"	"3"	"Q8R420"	"Q8R420 [1409-1427]"	"Q8R420 1xBiotin [K1422]"	"1"	"2231.06237"	"1.146"	"1.237"	"0.976090939419167"	"0.906515362333117"	"105.81"	"105.01"	"83.7"	"94.7"	"121.6"	"81.37"	"26.16"	"30.93"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002563"	"3.27"	"57.18"
"27507"	"False"	"High"	"[K].KKVATVPGTLK.[K]"	"1xBiotin [K]"	"0.0061286"	"0.0007621"	"1"	"1"	"10"	"P14148"	"P14148 [9-19]"	"P14148 1xBiotin [K]"	"2"	"1367.80792"	"0.155"	"0.972"	"0.925138005747468"	"0.906515362333117"	"69.44"	"61.32"	"145.3"	"19.7"	"134.9"	"43.16"	"37.47"	"44.96"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004684"	"3.20"	"32.49"
"27465"	"False"	"High"	"[K].KKPTTVPLPQAK.[Q]"	"1xBiotin [K1]"	"0.0196762"	"0.0007621"	"1"	"1"	"2"	"Q8VHE0"	"Q8VHE0 [534-545]"	"Q8VHE0 1xBiotin [K534]"	"1"	"1533.88215"	"0.286"	"0.865"	"0.925138005747468"	"0.906515362333117"	"55.73"	"70.53"	"152.2"	"42.4"	"105.4"	"50.23"	"35.21"	"51.56"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005902"	"0.001347"	"2.54"	"33.41"
"27464"	"False"	"High"	"[K].KKPTPIQLNPAPDGSAVNGTSSAETNLEALQK.[K]"	"1xBiotin [K1]"	"0.00373673"	"0.0007621"	"1"	"1"	"2"	"P31938"	"P31938 [4-35]"	"P31938 1xBiotin [K4]"	"1"	"3502.78462"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000298"	"4.67"	""
"162"	"False"	"High"	"[K].AAKHSSVQGR.[E]"	"1xBiotin [K3]"	"0.0069782"	"0.0007621"	"1"	"2"	"1"	"P21619"	"P21619 [552-561]"	"P21619 1xBiotin [K554]"	"1"	"1266.63716"	"0.507"	"1.338"	"0.925138005747468"	"0.906515362333117"	"81.53"	"72.75"	"96.7"	"52.8"	"150.5"	"61.96"	"59.75"	"44.46"	""	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005284"	"2.93"	"16.90"
"72431"	"False"	"High"	"[R].YSQDSFSKHYK.[S]"	"1xBiotin [K8]"	"0.00636021"	"0.0007621"	"1"	"1"	"6"	"Q91YQ1"	"Q91YQ1 [27-37]"	"Q91YQ1 1xBiotin [K34]"	"1"	"1615.72095"	"0.680"	"0.628"	"0.0938471810381803"	"0.906515362333117"	"146.82"	"89.70"	"153.3"	"70.4"	"76.3"	"69.15"	"236.75"	"67.91"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000484"	"2.59"	"33.12"
"23888"	"False"	"High"	"[R].GYSFTTTAER.[E]"	""	"0.0117976"	"0.0007621"	"1"	"2"	"17"	"P60710"	"P60710 [197-206]"	""	"0"	"1132.52693"	"142.903"	"3.317"	"0.925138005747468"	"0.906515362333117"	"39.98"	"33.85"	"1.8"	"291.4"	"6.8"	"37.93"	"35.35"	"23.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008474"	"2.06"	"29.50"
"23869"	"False"	"High"	"[R].GYPTLLWFR.[D]"	""	"0.0106879"	"0.0007621"	"1"	"1"	"49"	"Q91W90"	"Q91W90 [247-255]"	""	"0"	"1152.62004"	"114.160"	"2.303"	"0.925138005747468"	"0.906515362333117"	"84.69"	"83.59"	"2.7"	"289.9"	"7.4"	"79.14"	"23.89"	"48.39"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000776"	"2.47"	"58.80"
"23868"	"False"	"High"	"[R].GYPTLLLFR.[G]"	""	"0.0179415"	"0.0007621"	"1"	"1"	"27"	"Q91W90"	"Q91W90 [380-388]"	""	"0"	"1079.62479"	"105.066"	"2.543"	"0.940042144832625"	"0.919235111389825"	"55.06"	"59.29"	"2.8"	"290.5"	"6.7"	"52.36"	"23.89"	"30.22"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001243"	"2.22"	"55.98"
"23864"	"False"	"High"	"[K].GYPHWPAR.[IV]"	""	"0.0104918"	"0.0007621"	"2"	"9"	"12"	"Q99JF8; P51859"	"Q99JF8 [17-24]; P51859 [22-29]"	""	"0"	"983.48461"	"57.804"	"3.282"	"0.952905080717326"	"0.906515362333117"	"79.45"	"66.88"	"6.3"	"268.8"	"24.9"	"48.38"	"81.74"	"31.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007646"	"2.00"	"29.29"
"72487"	"False"	"High"	"[K].YTCSFCGK.[T]"	"2xCarbamidomethyl [C3; C6]"	"0.0145507"	"0.0007621"	"1"	"1"	"9"	"P61514"	"P61514 [37-44]"	""	"0"	"1022.40701"	"111.778"	"3.397"	"0.454960685216845"	"0.906515362333117"	"60.80"	"48.21"	"2.7"	"288.7"	"8.5"	"47.95"	"61.57"	"25.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001028"	"1.79"	"22.53"
"139"	"False"	"High"	"[K].AAGQKAPAQK.[A]"	"1xBiotin [K5]"	"0.0287847"	"0.0007621"	"1"	"1"	"1"	"Q9CR57"	"Q9CR57 [175-184]"	"Q9CR57 1xBiotin [K179]"	"1"	"1195.62520"	"0.535"	"0.835"	"0.925138005747468"	"0.906515362333117"	"76.14"	"95.25"	"126.2"	"67.5"	"106.3"	"66.78"	"48.74"	"83.83"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0006486"	"0.001925"	"2.96"	"19.82"
"22007"	"False"	"High"	"[K].GMTLVTPLQLLLFASK.[K]"	""	"0.0029357"	"0.0007621"	"1"	"3"	"3"	"O70133"	"O70133 [1060-1075]"	""	"0"	"1732.00774"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.000238"	"3.07"	""
"23808"	"False"	"High"	"[K].GYHLLKPMGK.[V]"	""	"0.01116"	"0.0007621"	"1"	"1"	"8"	"Q62465"	"Q62465 [285-294]"	""	"0"	"1143.63431"	"32.353"	"4.970"	"0.925138005747468"	"0.906515362333117"	"147.43"	"41.37"	"6.8"	"257.1"	"36.0"	"34.09"	"120.45"	"24.15"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008049"	"2.67"	"27.22"
"23807"	"False"	"High"	"[K].GYGYGQGAGTLSTDKGESLGIK.[H]"	"1xBiotin [K]"	"0.00251498"	"0.0007621"	"1"	"1"	"5"	"P97315"	"P97315 [70-91]"	"P97315 1xBiotin [K]"	"1"	"2385.13910"	"0.640"	"0.511"	"0.94218192752743"	"0.906515362333117"	"56.34"	"76.34"	"145.5"	"92.6"	"61.9"	"40.47"	"33.40"	"72.70"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0001583"	"0.000206"	"3.19"	"47.13"
"72515"	"False"	"High"	"[R].YTLYPNNFQFR.[Y]"	""	"0.0211827"	"0.0007621"	"1"	"1"	"7"	"P29416"	"P29416 [37-47]"	""	"0"	"1462.71138"	"47.156"	"2.261"	"0.925138005747468"	"0.906515362333117"	"140.01"	"67.20"	"3.6"	"288.1"	"8.4"	"55.40"	"77.01"	"25.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.000628"	"0.001441"	"2.08"	"47.83"
"23795"	"False"	"High"	"[K].GYGFVSFK.[D]"	""	"0.0296787"	"0.0007621"	"1"	"2"	"16"	"Q91V81-1"	"Q91V81-1 [417-424]"	""	"0"	"904.45633"	"149.175"	"4.525"	"0.925138005747468"	"0.906515362333117"	"96.46"	"103.02"	"1.9"	"288.3"	"9.8"	"82.93"	"40.73"	"30.31"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001989"	"1.82"	"41.78"
"23794"	"False"	"High"	"[K].GYGFVSFFNK.[W]"	""	"0.00475612"	"0.0007621"	"1"	"1"	"19"	"P52912"	"P52912 [148-157]"	""	"0"	"1165.56767"	"487.753"	"9.252"	"0.698394517820836"	"0.906515362333117"	"86.69"	"59.85"	"0.5"	"294.1"	"5.3"	"82.56"	"62.41"	"33.84"	"MandatoryModificationMissing"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003721"	"2.97"	"53.64"
"23758"	"False"	"High"	"[R].GYAFVTFCTK.[E]"	"1xCarbamidomethyl [C8]"	"0.0052508"	"0.0007621"	"1"	"2"	"9"	"Q7TMK9"	"Q7TMK9 [204-213]"	""	"0"	"1193.56596"	"241.910"	"6.263"	"0.925138005747468"	"0.906515362333117"	"109.00"	"110.62"	"1.3"	"290.8"	"7.9"	"96.04"	"25.08"	"24.38"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0004068"	"2.59"	"44.35"
"22068"	"False"	"High"	"[K].GNFNYIEFTR.[I]"	""	"0.0150062"	"0.0007621"	"1"	"1"	"4"	"Q3THE2"	"Q3THE2 [152-161]"	""	"0"	"1260.60076"	"35.952"	"1.467"	"0.925138005747468"	"0.906777072223237"	"140.09"	"59.75"	"8.7"	"282.5"	"8.9"	"39.66"	"85.84"	"48.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.001054"	"2.06"	"44.90"
"23733"	"False"	"High"	"[K].GWPLYLSTK.[N]"	""	"0.0185022"	"0.0007621"	"1"	"1"	"40"	"O88844"	"O88844 [204-212]"	""	"0"	"1064.57751"	"108.882"	"4.309"	"0.929016530787821"	"0.906515362333117"	"75.65"	"70.97"	"2.2"	"291.6"	"6.3"	"52.30"	"34.30"	"57.88"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001278"	"1.89"	"46.90"
"23730"	"False"	"High"	"[K].GWNWGTVK.[F]"	""	"0.023227"	"0.0007621"	"1"	"2"	"11"	"Q08943"	"Q08943 [106-113]"	""	"0"	"947.47338"	"125.898"	"4.552"	"0.925138005747468"	"0.906515362333117"	"75.91"	"62.88"	"1.9"	"289.8"	"8.3"	"55.57"	"34.51"	"35.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001576"	"2.17"	"40.61"
"115"	"False"	"High"	"[K].AAGAGKVTK.[S]"	"1xBiotin [K6]"	"0.00548308"	"0.0007621"	"1"	"1"	"12"	"P10126"	"P10126 [445-453]"	"P10126 1xBiotin [K450]"	"1"	"1028.55573"	"0.040"	"0.734"	"0.000105752238379389"	"0.906515362333117"	"35.70"	"37.11"	"170.6"	"6.7"	"122.7"	"13.63"	"41.95"	"49.48"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004228"	"2.86"	"23.01"
"23900"	"False"	"High"	"[R].GYTPIYTPFFMR.[K]"	""	"0.00756207"	"0.0007621"	"1"	"1"	"4"	"P26638"	"P26638 [219-230]"	""	"0"	"1492.72933"	"28.450"	"2.052"	"0.925138005747468"	"0.970525080472744"	"135.53"	"55.71"	"8.4"	"271.3"	"20.3"	"40.45"	"84.89"	"34.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0005686"	"2.26"	"57.97"
"23901"	"False"	"High"	"[R].GYTPIYTPFFMR.[K]"	"1xOxidation [M11]"	"0.00715289"	"0.0007621"	"1"	"1"	"15"	"P26638"	"P26638 [219-230]"	""	"0"	"1508.72425"	"135.014"	"2.751"	"0.731380567752682"	"0.916215054610739"	"40.72"	"53.63"	"2.2"	"291.5"	"6.3"	"40.32"	"18.70"	"41.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005385"	"2.12"	"52.69"
"23903"	"False"	"High"	"[K].GYTSWAIGLSVADLAESIMK.[N]"	"1xOxidation [M19]"	"0.0341544"	"0.0007621"	"1"	"1"	"2"	"P06151"	"P06151 [246-265]"	""	"0"	"2128.06308"	"0.816"	"1.216"	""	"0.906515362333117"	"72.53"	"74.93"	"107.9"	"72.7"	"119.5"	"53.50"	"37.97"	"45.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002287"	"2.27"	"66.16"
"23911"	"False"	"High"	"[R].GYWGGPAFLR.[K]"	""	"0.00950455"	"0.0007621"	"1"	"1"	"16"	"Q9R112"	"Q9R112 [433-442]"	""	"0"	"1123.56834"	"96.590"	"2.804"	"0.949662611758987"	"0.906515362333117"	"19.04"	"21.46"	"3.1"	"288.3"	"8.7"	"36.99"	"28.94"	"14.02"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006965"	"1.90"	"48.89"
"72016"	"False"	"High"	"[K].YMMWFQR.[H]"	"2xOxidation [M2; M3]"	"0.0246969"	"0.0007621"	"1"	"1"	"11"	"Q8K0V4"	"Q8K0V4 [700-706]"	""	"0"	"1093.45938"	"410.020"	"3.469"	"0.925138005747468"	"0.906515362333117"	"50.26"	"66.66"	"0.7"	"296.7"	"2.6"	"32.91"	"37.87"	"59.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001662"	"1.76"	"37.15"
"24642"	"False"	"High"	"[K].HLTDAYFK.[K]"	""	"0.00784775"	"0.0007621"	"1"	"1"	"6"	"P47911"	"P47911 [219-226]"	""	"0"	"994.49926"	"194.587"	"0.893"	"0.759386698760409"	"0.906515362333117"	"58.24"	"81.41"	"1.6"	"296.9"	"1.5"	"35.19"	"46.74"	"102.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005875"	"2.89"	"28.85"
"24630"	"False"	"High"	"[R].HLSKMQQNGYENPTYK.[F]"	"1xBiotin [K4]"	"0.00845184"	"0.0007621"	"1"	"3"	"6"	"P12023"	"P12023 [748-763]"	"P12023 1xBiotin [K751]"	"1"	"2163.99502"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0006285"	"3.16"	""
"24611"	"False"	"High"	"[R].HLQLAIR.[NG]"	""	"0.0100479"	"0.0007621"	"2"	"11"	"21"	"Q64523; Q8BFU2"	"Q64523 [83-89]; Q8BFU2 [83-89]"	""	"0"	"850.52575"	"125.154"	"3.225"	"0.925138005747468"	"0.906515362333117"	"71.38"	"67.62"	"2.6"	"289.7"	"7.7"	"61.50"	"51.82"	"31.84"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.000735"	"1.99"	"28.61"
"334"	"False"	"High"	"[K].AASGEAKPK.[A]"	"1xBiotin [K7]"	"0.00893515"	"0.0007621"	"2"	"3"	"7"	"P43276; P43277"	"P43276 [111-119]; P43277 [112-120]"	"P43276 1xBiotin [K117]; P43277 1xBiotin [K118]"	"0"	"1084.54556"	"0.406"	"0.812"	"0.925138005747468"	"0.906515362333117"	"52.55"	"68.85"	"120.7"	"56.4"	"122.9"	"40.25"	"30.13"	"64.63"	"NotUnique"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0006599"	"2.48"	"21.64"
"24580"	"False"	"High"	"[R].HLMNPYGSWR.[M]"	"1xOxidation [M3]"	"0.0279171"	"0.0007621"	"1"	"1"	"4"	"Q9D0Q7"	"Q9D0Q7 [251-260]"	""	"0"	"1276.58915"	"121.495"	"0.937"	"0.521973927803249"	"0.906515362333117"	"51.42"	"60.12"	"3.0"	"294.1"	"2.8"	"36.21"	"42.33"	"58.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0006486"	"0.001869"	"2.22"	"31.81"
"24432"	"False"	"High"	"[K].HKPNIYFKPK.[K]"	""	"0.0137652"	"0.0007621"	"1"	"1"	"6"	"Q9QXB9"	"Q9QXB9 [173-182]"	""	"0"	"1271.72590"	"89.088"	"1.874"	"0.975052343286225"	"0.937945192250145"	"75.04"	"71.22"	"2.9"	"291.7"	"5.5"	"51.22"	"48.70"	"57.89"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009737"	"2.83"	"19.47"
"72068"	"False"	"High"	"[R].YNFFTGCPK.[A]"	"1xCarbamidomethyl [C7]"	"0.00531614"	"0.0007621"	"1"	"1"	"14"	"P80313"	"P80313 [358-366]"	""	"0"	"1133.50844"	"166.961"	"4.620"	"0.925138005747468"	"0.906515362333117"	"57.49"	"66.96"	"1.8"	"289.2"	"9.0"	"60.07"	"83.54"	"46.60"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004112"	"2.42"	"40.34"
"24299"	"False"	"High"	"[K].HGINCFINR.[Q]"	"1xCarbamidomethyl [C5]"	"0.00438868"	"0.0007621"	"1"	"1"	"4"	"P80314"	"P80314 [285-293]"	""	"0"	"1130.55237"	"185.142"	"1.053"	"0.372337294997791"	"0.906777072223237"	"47.47"	"70.69"	"1.7"	"296.5"	"1.8"	"28.44"	"38.92"	"139.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.0003463"	"3.21"	"29.13"
"23710"	"False"	"High"	"[R].GWFVYQQR.[N]"	""	"0.0172908"	"0.0007621"	"1"	"1"	"26"	"Q9JHR7"	"Q9JHR7 [775-782]"	""	"0"	"1083.53704"	"108.056"	"3.617"	"0.930005426177468"	"0.906515362333117"	"58.02"	"46.24"	"2.5"	"287.9"	"9.6"	"51.69"	"36.85"	"9.44"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001199"	"2.16"	"42.12"
"24287"	"False"	"High"	"[R].HGKLAELEQR.[S]"	"1xBiotin [K3]"	"0.0298607"	"0.0007621"	"1"	"1"	"1"	"Q9Z2P8"	"Q9Z2P8 [31-40]"	"Q9Z2P8 1xBiotin [K33]"	"1"	"1406.72089"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.001996"	"2.96"	""
"72159"	"False"	"High"	"[K].YPKSVYLGR.[I]"	"1xBiotin [K3]"	"0.0118706"	"0.0007621"	"1"	"1"	"3"	"Q9D081"	"Q9D081 [207-215]"	"Q9D081 1xBiotin [K209]"	"1"	"1308.67690"	"0.256"	"1.085"	"0.925138005747468"	"0.938162963724392"	"90.81"	"51.31"	"136.2"	"22.8"	"141.0"	"55.13"	"68.75"	"21.94"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0003095"	"0.0008524"	"2.36"	"41.60"
"24206"	"False"	"High"	"[K].HFLELKSFK.[D]"	"1xBiotin [K6]"	"0.00410002"	"0.0007621"	"1"	"1"	"6"	"Q8R092"	"Q8R092 [235-243]"	"Q8R092 1xBiotin [K240]"	"1"	"1374.72385"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003238"	"2.52"	""
"24199"	"False"	"High"	"[K].HFGYTSYSVSNSVK.[E]"	""	"0.00452652"	"0.0007621"	"1"	"1"	"9"	"P10605"	"P10605 [224-237]"	""	"0"	"1575.74380"	"191.153"	"1.856"	"0.925138005747468"	"0.955198587033291"	"37.78"	"102.74"	"1.7"	"295.4"	"2.9"	"32.07"	"23.10"	"78.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003544"	"2.43"	"32.13"
"72195"	"False"	"High"	"[K].YPSPFFVFGEK.[I]"	""	"0.0331284"	"0.0007621"	"1"	"3"	"2"	"O70133"	"O70133 [1040-1050]"	""	"0"	"1317.65140"	"17.387"	"0.654"	"0.929016530787821"	"0.906515362333117"	"76.37"	"72.29"	"15.8"	"274.4"	"9.8"	"8.64"	"77.15"	"56.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002214"	"1.57"	"56.57"
"24191"	"False"	"High"	"[R].HFGGMAWYFVNK.[K]"	""	"0.0254658"	"0.0007621"	"1"	"1"	"5"	"Q9CXW2"	"Q9CXW2 [266-277]"	""	"0"	"1456.68305"	"31.196"	"1.998"	"0.656719278304696"	"0.981281916820826"	"144.25"	"82.29"	"9.0"	"277.1"	"13.9"	"48.44"	"79.92"	"62.65"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001716"	"3.21"	"49.03"
"24185"	"False"	"High"	"[K].HFCPNVPIILVGNKK.[D]"	"1xCarbamidomethyl [C3]"	"0.0171846"	"0.0007621"	"1"	"2"	"1"	"Q9QUI0"	"Q9QUI0 [105-119]"	""	"1"	"1735.96761"	"58.578"	"2.807"	"0.529141090895061"	"0.916172717218603"	"127.16"	"63.04"	"5.5"	"280.7"	"13.8"	"20.05"	"108.77"	"60.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0005416"	"0.001194"	"3.20"	"41.01"
"72238"	"False"	"High"	"[R].YQKSTELLIR.[K]"	"1xBiotin [K3]"	"0.00239351"	"0.0007621"	"1"	"4"	"12"	"P84244"	"P84244 [55-64]"	"P84244 1xBiotin [K57]"	"1"	"1476.78791"	"0.079"	"0.813"	"0.00410583197742114"	"0.906515362333117"	"54.14"	"55.91"	"162.3"	"11.7"	"126.0"	"31.14"	"44.73"	"53.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0001972"	"2.84"	"45.37"
"72250"	"False"	"High"	"[R].YQPFKPLSIGGIIILK.[D]"	""	"0.00770359"	"0.0007621"	"1"	"1"	"6"	"Q3TXS7"	"Q3TXS7 [900-915]"	""	"0"	"1787.08295"	"76.020"	"2.794"	"0.925138005747468"	"0.906515362333117"	"77.08"	"59.04"	"3.5"	"284.8"	"11.7"	"50.34"	"56.21"	"21.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005775"	"3.24"	"58.90"
"197"	"False"	"High"	"[R].AALKLEPSNK.[T]"	"1xBiotin [K4]"	"0.00279393"	"0.0007621"	"1"	"2"	"12"	"O35465-1"	"O35465-1 [321-330]"	"O35465-1 1xBiotin [K324]"	"1"	"1296.69803"	"0.106"	"0.782"	"0.0717243008471092"	"0.906515362333117"	"40.20"	"23.78"	"161.2"	"17.0"	"121.7"	"17.16"	"36.83"	"17.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002274"	"2.32"	"36.41"
"24284"	"False"	"High"	"[K].HGKGLDK.[S]"	"1xBiotin [K3]"	"0.0193165"	"0.0007621"	"1"	"1"	"11"	"Q9DBG7"	"Q9DBG7 [220-226]"	"Q9DBG7 1xBiotin [K222]"	"1"	"980.49821"	"0.109"	"0.746"	"0.00236099209201476"	"0.906515362333117"	"31.67"	"23.56"	"158.8"	"18.5"	"122.7"	"36.05"	"22.88"	"16.74"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001325"	"2.28"	"21.95"
"24663"	"False"	"High"	"[K].HIYLLPSGR.[I]"	""	"0.0250017"	"0.0007621"	"1"	"1"	"6"	"P05201"	"P05201 [379-387]"	""	"0"	"1055.59964"	"92.715"	"1.679"	"0.466031980976297"	"0.924676984508477"	"37.35"	"43.19"	"3.9"	"289.6"	"6.5"	"40.18"	"25.80"	"39.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.00169"	"2.34"	"33.85"
"23709"	"False"	"High"	"[R].GWFSGFWGK.[K]"	""	"0.00299069"	"0.0007621"	"1"	"3"	"3"	"Q8BX70-1"	"Q8BX70-1 [471-479]"	""	"0"	"1071.50468"	"85.886"	"1.930"	"0.973358748574628"	"0.906515362333117"	"51.27"	"50.18"	"2.7"	"291.7"	"5.6"	"38.03"	"31.59"	"28.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002421"	"2.51"	"58.27"
"23702"	"False"	"High"	"[K].GWAAAVTFNPQAR.[E]"	""	"0.00684998"	"0.0007621"	"1"	"1"	"3"	"Q5SUR0"	"Q5SUR0 [1127-1139]"	""	"0"	"1388.70696"	"65.632"	"1.318"	"0.925138005747468"	"0.906515362333117"	"77.62"	"40.62"	"3.9"	"290.7"	"5.4"	"35.18"	"60.09"	"32.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005194"	"3.00"	"43.61"
"22230"	"False"	"High"	"[K].GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNR.[T]"	"1xCarbamidomethyl [C14]"	"0.00332236"	"0.0007621"	"1"	"1"	"1"	"P63017"	"P63017 [4-36]"	""	"1"	"3472.72778"	"1.729"	"1.332"	"0.838925607793601"	""	"74.17"	"61.60"	"72.8"	"129.8"	"97.5"	"48.39"	"238.04"	"41.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002672"	"4.39"	"50.62"
"23274"	"False"	"High"	"[R].GTFYQGYR.[C]"	""	"0.0286091"	"0.0007621"	"1"	"1"	"12"	"P27870"	"P27870 [538-545]"	""	"0"	"991.46321"	"292.262"	"6.561"	"0.925138005747468"	"0.906515362333117"	"83.27"	"85.46"	"0.9"	"293.3"	"5.8"	"69.92"	"40.47"	"40.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001914"	"1.73"	"29.66"
"22266"	"False"	"High"	"[K].GPFLVSAPLSTIINWER.[E]"	""	"0.0145507"	"0.0007621"	"1"	"1"	"1"	"Q6PDQ2"	"Q6PDQ2 [769-785]"	""	"0"	"1900.03271"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.001027"	"2.64"	""
"23230"	"False"	"High"	"[K].GTAYTFFTPGNLK.[Q]"	""	"0.00809403"	"0.0007621"	"1"	"1"	"6"	"Q501J6"	"Q501J6 [437-449]"	""	"0"	"1416.71579"	"31.673"	"1.194"	"0.925138005747468"	"0.906515362333117"	"54.73"	"29.35"	"9.0"	"281.1"	"9.9"	"20.75"	"58.70"	"29.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0006025"	"3.05"	"48.09"
"23217"	"False"	"High"	"[K].GTAFGGWK.[S]"	""	"0.0264198"	"0.0007621"	"1"	"1"	"12"	"P28474"	"P28474 [316-323]"	""	"0"	"823.40971"	"117.922"	"3.918"	"0.925138005747468"	"0.906515362333117"	"38.06"	"47.35"	"2.8"	"287.1"	"10.2"	"25.53"	"26.48"	"42.50"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.00178"	"2.12"	"33.54"
"72665"	"False"	"High"	"[K].YYAVNYPLR.[D]"	""	"0.0107541"	"0.0007621"	"1"	"1"	"12"	"O09106"	"O09106 [221-229]"	""	"0"	"1158.59422"	"168.910"	"4.713"	"0.925138005747468"	"0.906515362333117"	"51.23"	"59.55"	"1.7"	"290.5"	"7.8"	"42.40"	"35.79"	"41.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007811"	"1.92"	"38.47"
"72705"	"False"	"High"	"[R].YYKNIGLGFK.[T]"	"1xBiotin [K3]"	"0.00620485"	"0.0007621"	"1"	"1"	"7"	"P62281"	"P62281 [36-45]"	"P62281 1xBiotin [K38]"	"1"	"1428.73442"	"1.092"	"0.952"	"0.936509618400951"	"0.906515362333117"	"91.40"	"84.86"	"94.7"	"111.8"	"93.5"	"83.42"	"29.00"	"35.49"	""	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0002312"	"0.0004751"	"2.32"	"49.54"
"22332"	"False"	"High"	"[K].GPLMMYISK.[M]"	"1xOxidation [M]"	"0.0113686"	"0.0007621"	"1"	"1"	"22"	"P58252"	"P58252 [392-400]"	""	"0"	"1055.52640"	"68.954"	"3.444"	"0.982626859977453"	"0.906515362333117"	"63.20"	"71.42"	"4.1"	"284.2"	"11.7"	"50.23"	"49.54"	"50.35"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008216"	"2.54"	"38.16"
"23058"	"False"	"High"	"[R].GSPECVGLTETKSMIFSPASR.[V]"	"1xBiotin [K12]; 1xCarbamidomethyl [C5]; 1xOxidation [M14]"	"0.00251498"	"0.0007621"	"1"	"1"	"8"	"P83093"	"P83093 [649-669]"	"P83093 1xBiotin [K660]"	"1"	"2496.15674"	"0.251"	"0.709"	"0.925138005747468"	"0.906515362333117"	"81.95"	"87.99"	"143.1"	"40.7"	"116.2"	"65.05"	"35.23"	"56.99"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0002058"	"4.26"	"53.08"
"23030"	"False"	"High"	"[K].GSLSQELSKSFLTLTRPDR.[A]"	"1xBiotin [K9]"	"0.0181637"	"0.0007621"	"1"	"1"	"1"	"Q8VI59-1"	"Q8VI59-1 [243-261]"	"Q8VI59-1 1xBiotin [K251]"	"1"	"2361.22310"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0005416"	"0.001253"	"2.73"	""
"23029"	"False"	"High"	"[R].GSLSGWILSK.[A]"	""	"0.00334298"	"0.0007621"	"1"	"1"	"25"	"P35564"	"P35564 [79-88]"	""	"0"	"1047.58332"	"128.699"	"3.412"	"0.925138005747468"	"0.906515362333117"	"47.69"	"47.43"	"2.1"	"290.1"	"7.8"	"42.54"	"22.80"	"19.12"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000269"	"2.76"	"47.18"
"23013"	"False"	"High"	"[R].GSLLQIPVKTLK.[Y]"	"1xBiotin [K9]"	"0.00441591"	"0.0007621"	"1"	"1"	"6"	"Q8BTY2"	"Q8BTY2 [959-970]"	"Q8BTY2 1xBiotin [K967]"	"1"	"1522.90255"	"0.425"	"1.115"	"0.925138005747468"	"0.906515362333117"	"66.94"	"56.49"	"126.1"	"51.3"	"122.6"	"57.47"	"43.16"	"34.14"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003477"	"2.82"	"54.76"
"22417"	"False"	"High"	"[R].GPSYGLSR.[E]"	""	"0.0339468"	"0.0007621"	"1"	"2"	"6"	"Q9WVA4"	"Q9WVA4 [5-12]"	""	"0"	"836.42609"	"155.246"	"4.999"	"0.925138005747468"	"0.906515362333117"	"65.33"	"69.03"	"1.8"	"289.8"	"8.4"	"50.44"	"43.87"	"70.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000686"	"0.00227"	"1.83"	"22.47"
"22435"	"False"	"High"	"[K].GPVSVGIDASHSSFFFYK.[S]"	""	"0.00458286"	"0.0007621"	"1"	"1"	"3"	"O70370"	"O70370 [255-272]"	""	"0"	"1944.94904"	"38.733"	"1.357"	"0.925138005747468"	"0.906515362333117"	"95.40"	"36.65"	"7.1"	"283.3"	"9.6"	"22.73"	"82.35"	"36.30"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003593"	"2.88"	"50.83"
"72706"	"False"	"High"	"[R].YYKNNFSDGFR.[Q]"	"1xBiotin [K3]"	"0.0160588"	"0.0007621"	"1"	"1"	"4"	"Q9EP69"	"Q9EP69 [481-491]"	"Q9EP69 1xBiotin [K483]"	"1"	"1636.72129"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0005064"	"0.001121"	"2.42"	""
"22446"	"False"	"High"	"[R].GQAFVIFK.[E]"	""	"0.0345735"	"0.0007621"	"1"	"2"	"7"	"Q9CQI7"	"Q9CQI7 [50-57]"	""	"0"	"909.51926"	"146.768"	"3.724"	"0.925138005747468"	"0.906515362333117"	"74.54"	"77.42"	"2.1"	"289.2"	"8.7"	"77.21"	"43.74"	"21.04"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000686"	"0.00231"	"1.55"	"43.57"
"22928"	"False"	"High"	"[R].GSFSLFWK.[G]"	""	"0.029139"	"0.0007621"	"1"	"1"	"6"	"P60330"	"P60330 [146-153]"	""	"0"	"971.49853"	"170.292"	"2.783"	"0.266254853379793"	"0.906515362333117"	"37.98"	"51.02"	"1.8"	"293.1"	"5.2"	"22.34"	"27.49"	"59.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001958"	"1.50"	"53.02"
"22796"	"False"	"High"	"[K].GRPTSTNPIASIFAWTR.[G]"	""	"0.00328151"	"0.0007621"	"1"	"1"	"6"	"P54071"	"P54071 [361-377]"	""	"0"	"1874.98716"	"56.351"	"2.541"	"0.925138005747468"	"0.932495232540503"	"55.75"	"51.28"	"4.8"	"284.6"	"10.7"	"33.65"	"52.42"	"38.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002644"	"3.08"	"58.49"
"22676"	"False"	"High"	"[K].GQVVTKTALLK.[Q]"	"1xBiotin [K6]"	"0.00855693"	"0.0007621"	"1"	"4"	"6"	"A2AN08"	"A2AN08 [4812-4822]"	"A2AN08 1xBiotin [K4817]"	"1"	"1383.80283"	"14.552"	"0.604"	"0.861442719681534"	"0.906515362333117"	"44.04"	"49.58"	"17.5"	"271.4"	"11.1"	"42.57"	"37.60"	"39.43"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006328"	"2.46"	"44.40"
"23286"	"False"	"High"	"[R].GTGGSESSKANGLTAESK.[A]"	"1xBiotin [K9]"	"0.0210529"	"0.0007621"	"1"	"3"	"1"	"Q8BJS4"	"Q8BJS4 [116-133]"	"Q8BJS4 1xBiotin [K124]"	"1"	"1906.88110"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001437"	"3.82"	""
"72654"	"False"	"High"	"[K].YWPFYQK.[N]"	""	"0.0311661"	"0.0007621"	"1"	"1"	"40"	"Q9D964"	"Q9D964 [103-109]"	""	"0"	"1031.49853"	"144.401"	"3.591"	"0.925138005747468"	"0.906515362333117"	"78.71"	"72.35"	"1.5"	"293.1"	"5.4"	"63.61"	"50.08"	"54.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002079"	"1.70"	"46.58"
"22176"	"False"	"High"	"[R].GNVGFVFTK.[E]"	""	"0.0177219"	"0.0007621"	"1"	"1"	"12"	"P14869"	"P14869 [84-92]"	""	"0"	"968.51999"	"220.447"	"9.086"	"0.925138005747468"	"0.906515362333117"	"124.01"	"114.40"	"1.6"	"284.5"	"13.9"	"125.47"	"71.99"	"66.85"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001224"	"2.33"	"39.23"
"23424"	"False"	"High"	"[R].GTTITLVLK.[E]"	""	"0.00938785"	"0.0007621"	"1"	"1"	"2"	"P08113"	"P08113 [244-252]"	""	"0"	"945.59791"	"41.908"	"0.662"	"0.925138005747468"	"0.906515362333117"	"109.28"	"85.79"	"7.1"	"288.9"	"4.0"	"140.19"	"86.83"	"84.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0006882"	"2.22"	"40.39"
"72554"	"False"	"High"	"[R].YTYLEKAIK.[I]"	"1xBiotin [K6]"	"0.00756207"	"0.0007621"	"1"	"2"	"12"	"Q6A4J8"	"Q6A4J8 [1092-1100]"	"Q6A4J8 1xBiotin [K1097]"	"1"	"1354.70754"	"0.165"	"0.829"	"0.550484947584338"	"0.906515362333117"	"32.72"	"25.43"	"148.6"	"27.1"	"124.3"	"26.63"	"32.11"	"34.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005658"	"2.34"	"45.25"
"22102"	"False"	"High"	"[R].GNIFNYWITVSKPVFR.[K]"	""	"0.0026263"	"0.0007621"	"1"	"1"	"6"	"Q9D8Y1"	"Q9D8Y1 [143-158]"	""	"0"	"1941.03813"	"7.974"	"0.652"	"0.925138005747468"	"0.906515362333117"	"251.29"	"52.82"	"36.4"	"241.3"	"22.3"	"35.81"	"121.78"	"39.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002148"	"3.39"	"61.27"
"22116"	"False"	"High"	"[R].GNLSWLR.[E]"	""	"0.0327265"	"0.0007621"	"1"	"1"	"11"	"Q62422"	"Q62422 [84-90]"	""	"0"	"845.46281"	"174.716"	"5.807"	"0.925138005747468"	"0.906515362333117"	"64.11"	"64.89"	"1.8"	"287.4"	"10.8"	"45.44"	"74.14"	"62.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002193"	"2.19"	"40.29"
"23612"	"False"	"High"	"[R].GVMLAVDAVIAELKK.[Q]"	""	"0.0199197"	"0.0007621"	"1"	"1"	"1"	"P63038-1"	"P63038-1 [143-157]"	""	"1"	"1556.90803"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005902"	"0.001367"	"2.40"	""
"22134"	"False"	"High"	"[K].GNPFQFYLTR.[V]"	""	"0.0106879"	"0.0007621"	"1"	"1"	"10"	"Q8BJ37"	"Q8BJ37 [162-171]"	""	"0"	"1242.62658"	"130.053"	"2.238"	"0.434690404868879"	"0.954044461176668"	"50.45"	"45.62"	"2.3"	"292.9"	"4.8"	"41.23"	"38.45"	"19.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007763"	"2.04"	"52.12"
"72557"	"False"	"High"	"[R].YVANLFPYK.[G]"	""	"0.0119441"	"0.0007621"	"1"	"1"	"9"	"Q9D819"	"Q9D819 [80-88]"	""	"0"	"1114.59316"	"138.883"	"2.661"	"0.460981504528686"	"0.913565512658592"	"43.96"	"63.20"	"2.0"	"292.1"	"5.9"	"27.19"	"33.17"	"44.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.0003095"	"0.0008566"	"1.77"	"44.28"
"23585"	"False"	"High"	"[R].GVLLMLFGGVPK.[T]"	"1xOxidation [M5]"	"0.0106222"	"0.0007621"	"1"	"1"	"3"	"P97311"	"P97311 [367-378]"	""	"0"	"1246.72279"	"209.717"	"4.123"	"0.380827439155979"	"0.906515362333117"	"71.93"	"56.70"	"1.5"	"293.1"	"5.4"	"45.05"	"85.36"	"48.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.000773"	"2.97"	"58.29"
"111"	"False"	"High"	"[K].AAFQSQYKSHFVAASLSNQK.[A]"	"1xBiotin [K8]"	"0.019198"	"0.0007621"	"1"	"2"	"1"	"Q810A7-1"	"Q810A7-1 [702-721]"	"Q810A7-1 1xBiotin [K709]"	"1"	"2438.19214"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0005416"	"0.001318"	"2.45"	""
"23580"	"False"	"High"	"[R].GVLKVFLENVIR.[D]"	"1xBiotin [K4]"	"0.0125486"	"0.0007621"	"1"	"1"	"1"	"P62806"	"P62806 [57-68]"	"P62806 1xBiotin [K60]"	"1"	"1612.92434"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.0008959"	"2.51"	""
"23704"	"False"	"High"	"[R].GWATVWPNR.[E]"	""	"0.015099"	"0.0007621"	"1"	"1"	"11"	"Q9CQL5"	"Q9CQL5 [67-75]"	""	"0"	"1086.54794"	"173.680"	"5.442"	"0.434853540501642"	"0.906515362333117"	"49.20"	"78.31"	"1.7"	"286.2"	"12.1"	"36.94"	"43.56"	"59.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001061"	"2.27"	"43.09"
"23575"	"False"	"High"	"[K].GVIFYLR.[D]"	""	"0.0230848"	"0.0007621"	"1"	"1"	"13"	"Q9Z0X1"	"Q9Z0X1 [562-568]"	""	"0"	"867.50870"	"132.010"	"3.239"	"0.928611703535518"	"0.906515362333117"	"52.38"	"53.99"	"2.5"	"289.9"	"7.6"	"42.49"	"46.35"	"75.74"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001568"	"2.24"	"45.63"
"23545"	"False"	"High"	"[R].GVHFIFNK.[E]"	""	"0.0101101"	"0.0007621"	"1"	"1"	"8"	"Q61093"	"Q61093 [560-567]"	""	"0"	"961.52541"	"239.731"	"6.706"	"0.925138005747468"	"0.906515362333117"	"78.95"	"83.38"	"1.2"	"290.9"	"7.9"	"71.06"	"30.90"	"68.16"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007369"	"2.48"	"35.96"
"23525"	"False"	"High"	"[K].GVGASGSFR.[L]"	""	"0.0135128"	"0.0007621"	"1"	"1"	"3"	"P10922"	"P10922 [86-94]"	""	"0"	"837.42134"	"296.689"	"4.083"	"0.925138005747468"	"0.906515362333117"	"49.00"	"50.69"	"0.9"	"295.3"	"3.8"	"28.47"	"36.60"	"41.70"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009587"	"2.91"	"19.29"
"109"	"False"	"High"	"[K].AAFKELQSTFK.[-]"	"1xBiotin [K4]"	"0.00295392"	"0.0007621"	"1"	"1"	"9"	"Q9D8Y0"	"Q9D8Y0 [230-240]"	"Q9D8Y0 1xBiotin [K233]"	"1"	"1495.76136"	"0.304"	"1.003"	"0.925138005747468"	"0.906515362333117"	"71.73"	"47.90"	"135.8"	"35.7"	"128.6"	"36.18"	"52.99"	"28.75"	""	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002399"	"2.35"	"46.65"
"23480"	"False"	"High"	"[K].GVAPLWMR.[Q]"	""	"0.0239508"	"0.0007621"	"1"	"1"	"14"	"Q8VEM8"	"Q8VEM8 [214-221]"	""	"0"	"929.50257"	"64.944"	"6.051"	"0.975477698258044"	"0.906515362333117"	"95.49"	"65.31"	"3.9"	"269.1"	"27.0"	"28.76"	"76.73"	"54.28"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001623"	"1.85"	"43.06"
"23463"	"False"	"High"	"[R].GTYYFFDCLNWR.[K]"	"1xCarbamidomethyl [C8]"	"0.0061666"	"0.0007621"	"1"	"3"	"6"	"Q8C5L3-1"	"Q8C5L3-1 [497-508]"	""	"0"	"1641.71547"	"60.699"	"1.323"	"0.925138005747468"	"0.906515362333117"	"77.52"	"65.02"	"4.9"	"289.6"	"5.6"	"45.30"	"63.66"	"45.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0002312"	"0.0004701"	"1.93"	"59.62"
"23460"	"False"	"High"	"[K].GTYLATFHQR.[G]"	""	"0.0123184"	"0.0007621"	"1"	"1"	"1"	"Q8JZQ9"	"Q8JZQ9 [335-344]"	""	"0"	"1193.60618"	"151.824"	"1.047"	"0.284218816319636"	""	"76.74"	"29.10"	"2.5"	"294.9"	"2.6"	"35.93"	"76.74"	"30.68"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.00088"	"2.43"	"29.15"
"72622"	"False"	"High"	"[K].YVRPFLNSISK.[A]"	""	"0.011439"	"0.0007621"	"1"	"1"	"15"	"Q8BG32"	"Q8BG32 [72-82]"	""	"0"	"1323.74195"	"270.439"	"8.670"	"0.925138005747468"	"0.906515362333117"	"59.39"	"61.32"	"1.1"	"289.8"	"9.2"	"49.85"	"43.66"	"84.47"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000827"	"3.11"	"35.82"
"72636"	"False"	"High"	"[K].YWDGWFR.[G]"	""	"0.026098"	"0.0007621"	"1"	"1"	"12"	"Q8BVQ5"	"Q8BVQ5 [297-303]"	""	"0"	"1029.45773"	"147.408"	"5.269"	"0.925138005747468"	"0.906515362333117"	"51.73"	"52.64"	"1.8"	"288.1"	"10.0"	"42.14"	"38.24"	"49.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.00176"	"1.47"	"51.65"
"22175"	"False"	"High"	"[R].GNVAKTSR.[N]"	"1xBiotin [K5]"	"0.0148224"	"0.0007621"	"1"	"1"	"22"	"Q9Z1W5"	"Q9Z1W5 [22-29]"	"Q9Z1W5 1xBiotin [K26]"	"1"	"1058.54114"	"0.016"	"0.902"	"2.02065471673078E-05"	"0.906515362333117"	"63.73"	"39.87"	"163.1"	"2.5"	"134.4"	"20.77"	"55.37"	"31.86"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001041"	"2.30"	"21.60"
"23574"	"False"	"High"	"[K].GVLFYGPPGCGK.[T]"	"1xCarbamidomethyl [C10]"	"0.0036454"	"0.0007621"	"1"	"1"	"12"	"Q01853"	"Q01853 [513-524]"	""	"0"	"1251.61906"	"215.932"	"5.313"	"0.925138005747468"	"0.906515362333117"	"68.04"	"71.37"	"1.3"	"292.3"	"6.4"	"57.14"	"46.66"	"88.75"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002906"	"2.82"	"40.05"
"32543"	"False"	"High"	"[R].LFMVLWLK.[G]"	"1xOxidation [M3]"	"0.004308"	"0.0007621"	"1"	"1"	"29"	"Q9Z1Q5"	"Q9Z1Q5 [30-37]"	""	"0"	"1065.61654"	"132.604"	"2.454"	"0.925138005747468"	"0.906515362333117"	"49.51"	"48.42"	"2.5"	"291.9"	"5.6"	"34.90"	"37.72"	"38.20"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003396"	"2.16"	"58.13"
"21759"	"False"	"High"	"[R].GLSSLLYGSIPK.[A]"	""	"0.00291759"	"0.0007621"	"1"	"1"	"2"	"Q8JZU2"	"Q8JZU2 [86-97]"	""	"0"	"1234.70416"	"29.377"	"0.953"	"0.925138005747468"	"0.906515362333117"	"54.14"	"44.17"	"9.4"	"282.2"	"8.5"	"29.73"	"56.43"	"34.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002371"	"2.11"	"51.90"
"21728"	"False"	"High"	"[K].GLSFLFPLLK.[L]"	""	"0.00412546"	"0.0007621"	"1"	"2"	"26"	"Q62448"	"Q62448 [722-731]"	""	"0"	"1134.69214"	"143.149"	"4.376"	"0.925138005747468"	"0.906515362333117"	"51.82"	"44.11"	"1.9"	"289.2"	"8.9"	"39.40"	"34.42"	"22.59"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003258"	"2.40"	"65.31"
"26691"	"False"	"High"	"[K].KFEDSEK.[A]"	"1xBiotin [K1]"	"0.0133471"	"0.0007621"	"1"	"1"	"6"	"Q9DBG7"	"Q9DBG7 [138-144]"	"Q9DBG7 1xBiotin [K138]"	"1"	"1108.49794"	"0.114"	"0.907"	"0.0128776403420873"	"0.906515362333117"	"33.65"	"43.31"	"152.8"	"16.0"	"131.2"	"29.35"	"24.64"	"44.55"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0003479"	"0.0009468"	"2.28"	"27.33"
"26667"	"False"	"High"	"[R].KFAYLGR.[L]"	""	"0.0264198"	"0.0007621"	"1"	"1"	"19"	"P19253"	"P19253 [134-140]"	""	"1"	"854.48830"	"127.546"	"3.549"	"0.925138005747468"	"0.906515362333117"	"59.00"	"71.39"	"2.4"	"288.4"	"9.3"	"85.40"	"55.57"	"44.90"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001775"	"2.77"	"27.53"
"26624"	"False"	"High"	"[K].KETISLQMEEFNTAIYSNDDLLSSK.[E]"	"1xBiotin [K1]"	"0.010363"	"0.0007621"	"1"	"2"	"1"	"Q99P72-2"	"Q99P72-2 [801-825]"	"Q99P72-2 1xBiotin [K801]"	"1"	"3102.46459"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.000753"	"3.63"	""
"71779"	"False"	"High"	"[R].YIFTMLSPLAR.[L]"	"1xOxidation [M5]"	"0.00481531"	"0.0007621"	"1"	"1"	"12"	"Q01320"	"Q01320 [804-814]"	""	"0"	"1327.70787"	"120.736"	"1.206"	"0.925138005747468"	"0.906515362333117"	"75.01"	"64.38"	"2.2"	"295.2"	"2.5"	"53.95"	"52.00"	"31.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0003768"	"1.95"	"50.42"
"21232"	"False"	"High"	"[R].GKRPIFECFWNGR.[L]"	"1xCarbamidomethyl [C8]"	"0.00452652"	"0.0007621"	"1"	"1"	"10"	"Q6P5D8"	"Q6P5D8 [467-479]"	""	"1"	"1666.82709"	"76.887"	"2.992"	"0.431625879740687"	"0.906515362333117"	"40.61"	"28.68"	"3.8"	"284.3"	"11.9"	"16.54"	"63.67"	"20.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003547"	"2.85"	"43.33"
"26294"	"False"	"High"	"[K].KEDLVFIFWAPENAPLK.[S]"	""	"0.00299069"	"0.0007621"	"1"	"1"	"8"	"P18760"	"P18760 [96-112]"	""	"1"	"2017.07932"	"43.233"	"0.621"	"0.925138005747468"	"0.906515362333117"	"89.47"	"48.88"	"6.7"	"289.4"	"3.9"	"16.59"	"72.31"	"50.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002425"	"2.97"	"60.55"
"71781"	"False"	"High"	"[R].YIFTMLSSLAR.[L]"	""	"0.00243836"	"0.0007621"	"1"	"1"	"8"	"Q64511"	"Q64511 [814-824]"	""	"0"	"1301.69222"	"33.462"	"2.392"	"0.925138005747468"	"0.923750342545975"	"70.15"	"54.05"	"9.1"	"271.6"	"19.3"	"39.34"	"64.21"	"43.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002003"	"2.23"	"58.98"
"26264"	"False"	"High"	"[K].KEANQAPK.[S]"	"1xBiotin [K1]"	"0.0131024"	"0.0007621"	"1"	"1"	"12"	"Q922Q8"	"Q922Q8 [219-226]"	"Q922Q8 1xBiotin [K219]"	"1"	"1111.55645"	"0.176"	"1.046"	"0.925138005747468"	"0.935866453494337"	"75.95"	"55.75"	"123.1"	"28.1"	"148.8"	"41.52"	"56.27"	"36.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009333"	"2.07"	"19.15"
"21244"	"False"	"High"	"[K].GKSPQLALR.[Q]"	"1xBiotin [K2]"	"0.0116528"	"0.0007621"	"1"	"1"	"2"	"Q99PL6"	"Q99PL6 [34-42]"	"Q99PL6 1xBiotin [K35]"	"1"	"1195.66159"	"0.251"	"1.126"	"0.925138005747468"	"0.91398852688127"	"74.00"	"50.83"	"143.3"	"27.2"	"129.5"	"30.62"	"58.60"	"41.16"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0008371"	"1.89"	"38.04"
"26125"	"False"	"High"	"[R].KDLYANTVLSGGTTMYPGIADR.[M]"	"1xBiotin [K1]; 1xOxidation [M15]"	"0.0347849"	"0.0007621"	"1"	"2"	"1"	"P60710"	"P60710 [291-312]"	"P60710 1xBiotin [K291]"	"1"	"2585.23743"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000686"	"0.002334"	"3.44"	""
"21245"	"False"	"High"	"[R].GKSSFFGDR.[G]"	"1xBiotin [K2]"	"0.00770359"	"0.0007621"	"1"	"1"	"12"	"Q62167"	"Q62167 [80-88]"	"Q62167 1xBiotin [K81]"	"1"	"1226.56227"	"0.038"	"0.748"	"0.00123971143260215"	"0.906515362333117"	"61.26"	"45.22"	"171.1"	"6.2"	"122.7"	"23.62"	"63.12"	"46.89"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005759"	"2.88"	"42.46"
"26094"	"False"	"High"	"[R].KDIESYKSGSGVNNR.[R]"	"1xBiotin [K7]"	"0.00334298"	"0.0007621"	"1"	"1"	"11"	"O88630"	"O88630 [144-158]"	"O88630 1xBiotin [K150]"	"2"	"1879.89669"	"10.231"	"0.923"	"0.837024075063163"	"0.906515362333117"	"75.09"	"34.73"	"25.1"	"251.0"	"23.9"	"15.99"	"82.49"	"53.70"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002683"	"3.11"	"32.54"
"26093"	"False"	"High"	"[R].KDIESYK.[S]"	"1xBiotin [K1]"	"0.00702147"	"0.0007621"	"1"	"1"	"13"	"O88630"	"O88630 [144-150]"	"O88630 1xBiotin [K144]"	"1"	"1108.53432"	"0.044"	"1.006"	"0.000138899818425173"	"0.916215054610739"	"48.94"	"47.79"	"154.3"	"7.6"	"138.1"	"33.92"	"37.44"	"57.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.00053"	"2.85"	"33.73"
"26020"	"False"	"High"	"[K].KDESLVSR.[A]"	"1xBiotin [K1]"	"0.0183887"	"0.0007621"	"1"	"1"	"7"	"Q8R4R6"	"Q8R4R6 [310-317]"	"Q8R4R6 1xBiotin [K310]"	"1"	"1159.57758"	"0.161"	"0.645"	"0.925138005747468"	"0.906515362333117"	"42.72"	"36.23"	"163.1"	"27.1"	"109.8"	"23.04"	"41.78"	"37.02"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001265"	"2.30"	"32.03"
"21272"	"False"	"High"	"[R].GKVSNLVPYLR.[D]"	"1xBiotin [K2]"	"0.0225248"	"0.0007621"	"1"	"1"	"5"	"Q64343"	"Q64343 [299-309]"	"Q64343 1xBiotin [K300]"	"1"	"1471.80898"	"0.479"	"0.389"	"0.925138005747468"	"0.906515362333117"	"81.50"	"101.13"	"162.9"	"81.9"	"55.1"	"86.16"	"28.87"	"72.60"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0006427"	"0.001531"	"2.70"	"51.75"
"422"	"False"	"High"	"[K].AAYVLFYQR.[QR]"	""	"0.0082966"	"0.0007621"	"1"	"5"	"3"	"Q8R5H1-1"	"Q8R5H1-1 [924-932]"	""	"0"	"1130.59931"	"160.320"	"4.006"	"0.428431464711328"	"0.906515362333117"	"39.47"	"37.21"	"1.9"	"290.2"	"7.8"	"33.67"	"19.48"	"8.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006168"	"2.02"	"43.73"
"21278"	"False"	"High"	"[K].GKYFVTFPYPYMNGR.[L]"	"1xOxidation [M12]"	"0.0135128"	"0.0007621"	"1"	"1"	"3"	"Q8BMJ2"	"Q8BMJ2 [46-60]"	""	"1"	"1855.88360"	"138.352"	"1.768"	"0.427089858136149"	"0.937945192250145"	"68.04"	"47.28"	"1.8"	"294.7"	"3.5"	"39.92"	"47.38"	"26.74"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009604"	"2.45"	"46.67"
"25841"	"False"	"High"	"[R].KAYGLALAK.[L]"	""	"0.00360058"	"0.0007621"	"1"	"1"	"11"	"P40142"	"P40142 [319-327]"	""	"1"	"934.57203"	"267.361"	"4.449"	"0.925138005747468"	"0.906515362333117"	"84.01"	"64.27"	"1.3"	"293.0"	"5.7"	"51.09"	"61.57"	"44.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0002878"	"3.12"	"26.37"
"21294"	"False"	"High"	"[R].GIAKPASADFQR.[A]"	"1xBiotin [K4]"	"0.00342673"	"0.0007621"	"1"	"1"	"1"	"Q61249"	"Q61249 [285-296]"	"Q61249 1xBiotin [K288]"	"0"	"1486.74711"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002745"	"2.08"	""
"71722"	"False"	"High"	"[R].YLAQYYFK.[C]"	""	"0.0136805"	"0.0007621"	"1"	"2"	"3"	"Q8BGZ4"	"Q8BGZ4 [515-522]"	""	"0"	"1095.55096"	"136.235"	"3.025"	"0.360971211023604"	"0.906515362333117"	"50.94"	"58.61"	"2.1"	"290.4"	"7.5"	"38.84"	"36.99"	"48.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009712"	"1.85"	"41.92"
"71718"	"False"	"High"	"[K].YLAISGFLFLR.[F]"	""	"0.0101728"	"0.0007621"	"1"	"1"	"8"	"Q9Z268"	"Q9Z268 [461-471]"	""	"0"	"1299.74597"	"56.653"	"1.109"	"0.925138005747468"	"0.906515362333117"	"66.64"	"70.87"	"4.5"	"290.8"	"4.7"	"42.80"	"58.27"	"69.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0007404"	"1.80"	"64.47"
"705"	"False"	"High"	"[K].ADYFSTVAAVVFLR.[K]"	""	"0.0201662"	"0.0007621"	"1"	"1"	"3"	"Q8VEE4"	"Q8VEE4 [468-481]"	""	"0"	"1558.82640"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.000628"	"0.001384"	"1.99"	""
"71677"	"False"	"High"	"[R].YKGKEDVGK.[T]"	"1xBiotin [K]"	"0.00499735"	"0.0007621"	"1"	"1"	"19"	"Q9CQU3"	"Q9CQU3 [184-192]"	"Q9CQU3 1xBiotin [K]"	"2"	"1249.62453"	"0.033"	"0.628"	"5.09415307722964E-05"	"0.906515362333117"	"38.22"	"31.37"	"186.0"	"6.2"	"107.9"	"25.43"	"32.52"	"20.35"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003894"	"2.45"	"24.36"
"27441"	"False"	"High"	"[K].KKPFVYTQGQAVLNR.[A]"	""	"0.00927258"	"0.0007621"	"1"	"1"	"3"	"Q8VCT3"	"Q8VCT3 [162-176]"	""	"1"	"1748.98061"	"1.425"	"1.632"	"0.947989303413716"	"0.916215054610739"	"81.41"	"73.71"	"72.8"	"80.8"	"146.4"	"54.24"	"238.09"	"35.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.000684"	"2.79"	"31.09"
"71627"	"False"	"High"	"[R].YHSLAPMYYR.[G]"	"1xOxidation [M7]"	"0.0131024"	"0.0007621"	"1"	"3"	"14"	"P35278"	"P35278 [83-92]"	""	"0"	"1316.60922"	"1000.000"	"6.313"	"9.75666666666667E-15"	"0.906515362333117"	"69.24"	"139.61"	"0.2"	"298.8"	"1.0"	"33.30"	"57.53"	"101.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009326"	"1.94"	"29.23"
"20712"	"False"	"High"	"[K].GGKGLGK.[G]"	"1xBiotin [K3]"	"0.0347849"	"0.0007621"	"1"	"1"	"7"	"P62806"	"P62806 [7-13]"	"P62806 1xBiotin [K9]"	"1"	"842.45528"	"0.049"	"0.519"	"0.00209043715235711"	"0.906515362333117"	"50.43"	"51.29"	"184.5"	"10.2"	"105.3"	"34.55"	"50.46"	"44.60"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000686"	"0.002323"	"2.20"	"25.43"
"27360"	"False"	"High"	"[K].KKEELLK.[Q]"	"1xBiotin [K2]"	"0.0189632"	"0.0007621"	"1"	"1"	"3"	"Q6ZWV7"	"Q6ZWV7 [13-19]"	"Q6ZWV7 1xBiotin [K14]"	"2"	"1113.63364"	"0.201"	"0.719"	"0.0172460238343866"	"0.906515362333117"	"72.63"	"105.77"	"162.3"	"37.4"	"100.3"	"59.91"	"33.95"	"75.87"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001302"	"2.94"	"31.05"
"20714"	"False"	"High"	"[K].GGKLDMSDLK.[A]"	"1xBiotin [K3]"	"0.00628205"	"0.0007621"	"2"	"3"	"6"	"P13011; P13516"	"P13011 [196-205]; P13516 [193-202]"	"P13011 1xBiotin [K198]; P13516 1xBiotin [K195]"	"1"	"1289.62282"	"0.273"	"0.888"	"0.925138005747468"	"0.906777072223237"	"37.24"	"47.29"	"143.0"	"35.9"	"121.0"	"18.84"	"32.15"	"38.08"	"NotUnique"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.00048"	"2.94"	"43.50"
"20776"	"False"	"High"	"[R].GGNFGFGDSR.[G]"	""	"0.00877106"	"0.0007621"	"1"	"3"	"12"	"O88569"	"O88569 [204-213]"	""	"0"	"1013.44353"	"181.223"	"4.714"	"0.925138005747468"	"0.906515362333117"	"74.02"	"83.42"	"1.6"	"290.6"	"7.8"	"67.87"	"50.51"	"42.47"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006486"	"2.20"	"30.57"
"71639"	"False"	"High"	"[K].YKADTLK.[S]"	"1xBiotin [K2]"	"0.0311661"	"0.0007621"	"1"	"1"	"12"	"Q99LC8"	"Q99LC8 [252-258]"	"Q99LC8 1xBiotin [K253]"	"1"	"1064.54449"	"0.021"	"0.737"	"3.27355792540127E-05"	"0.906515362333117"	"54.45"	"44.06"	"173.8"	"3.4"	"122.8"	"48.72"	"216.11"	"23.07"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002079"	"2.19"	"30.72"
"27219"	"False"	"High"	"[K].KGWDAEGSPFR.[G]"	"1xBiotin [K1]"	"0.0219782"	"0.0007621"	"1"	"3"	"1"	"Q8R1N4"	"Q8R1N4 [335-345]"	"Q8R1N4 1xBiotin [K335]"	"1"	"1475.67361"	"0.945"	"0.909"	"0.925138005747468"	"0.906515362333117"	"38.11"	"61.91"	"105.9"	"97.2"	"96.9"	"55.13"	"23.18"	"61.17"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001496"	"2.50"	"45.62"
"71640"	"False"	"High"	"[K].YKAEILK.[K]"	"1xBiotin [K2]"	"0.0140222"	"0.0007621"	"1"	"1"	"35"	"Q76N33-1"	"Q76N33-1 [143-149]"	"Q76N33-1 1xBiotin [K144]"	"1"	"1090.59653"	"0.004"	"0.770"	"1.05627524059028E-06"	"0.906515362333117"	"65.21"	"54.23"	"152.5"	"0.6"	"146.8"	"29.57"	"49.79"	"36.65"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009917"	"2.58"	"38.50"
"420"	"False"	"High"	"[R].AAYSNFWCGMTSQGYYK.[R]"	"1xCarbamidomethyl [C8]; 1xOxidation [M10]"	"0.002659"	"0.0007621"	"1"	"1"	"10"	"Q8K297"	"Q8K297 [191-207]"	""	"0"	"2049.84696"	"191.389"	"2.568"	"0.368592391352662"	"0.906515362333117"	"76.61"	"73.03"	"1.5"	"294.5"	"4.0"	"40.43"	"54.44"	"49.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002167"	"3.07"	"44.35"
"27207"	"False"	"High"	"[K].KGVNLPGAAVDLPAVSEK.[D]"	"1xBiotin [K1]"	"0.00366802"	"0.0007621"	"1"	"2"	"5"	"P52480"	"P52480 [207-224]"	"P52480 1xBiotin [K207]"	"1"	"1991.06302"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002921"	"2.97"	""
"20888"	"False"	"High"	"[R].GGTWFAGFGR.[E]"	""	"0.00551709"	"0.0007621"	"1"	"1"	"32"	"Q91YT0"	"Q91YT0 [258-267]"	""	"0"	"1055.50574"	"159.474"	"3.230"	"0.925138005747468"	"0.906515362333117"	"49.32"	"65.21"	"2.2"	"290.2"	"7.6"	"36.92"	"64.29"	"64.06"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004259"	"3.07"	"48.30"
"27126"	"False"	"High"	"[K].KGQQGWWR.[G]"	""	"0.0178314"	"0.0007621"	"1"	"1"	"6"	"P27870"	"P27870 [815-822]"	""	"1"	"1045.53262"	"352.990"	"3.170"	"0.925138005747468"	"0.906515362333117"	"64.05"	"133.11"	"0.8"	"294.9"	"4.2"	"89.77"	"30.34"	"118.02"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001231"	"1.92"	"28.81"
"27087"	"False"	"High"	"[K].KGPEVNPGSR.[G]"	"1xBiotin [K1]"	"0.00461129"	"0.0007621"	"1"	"1"	"8"	"Q64518"	"Q64518 [1020-1029]"	"Q64518 1xBiotin [K1020]"	"1"	"1266.62593"	"0.163"	"0.781"	"0.0156007558105852"	"0.906515362333117"	"96.70"	"97.59"	"162.7"	"24.6"	"112.7"	"66.66"	"43.12"	"46.29"	""	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003623"	"2.18"	"27.89"
"71659"	"False"	"High"	"[K].YKEALLGR.[V]"	"1xBiotin [K2]"	"0.0077994"	"0.0007621"	"1"	"1"	"9"	"Q99PT1"	"Q99PT1 [51-58]"	"Q99PT1 1xBiotin [K52]"	"1"	"1175.62414"	"0.052"	"1.057"	"0.00440232072909719"	"0.916215054610739"	"69.88"	"62.29"	"141.1"	"8.9"	"150.0"	"65.29"	"46.19"	"42.68"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005837"	"2.67"	"40.95"
"20982"	"False"	"High"	"[K].GHNGWVTQIATTPQFPDMILSASR.[D]"	"1xOxidation [M18]"	"0.0046399"	"0.0007621"	"1"	"1"	"2"	"P68040"	"P68040 [13-36]"	""	"0"	"2643.29840"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003625"	"3.33"	""
"26897"	"False"	"High"	"[K].KGELLMEDVWPLSK.[Y]"	"1xBiotin [K1]; 1xOxidation [M6]"	"0.0158621"	"0.0007621"	"1"	"1"	"1"	"Q9R1X5"	"Q9R1X5 [125-138]"	"Q9R1X5 1xBiotin [K125]"	"1"	"1886.93907"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005064"	"0.001111"	"2.59"	""
"21078"	"False"	"High"	"[K].GKEDVGK.[T]"	"1xBiotin [K2]"	"0.0197976"	"0.0007621"	"1"	"1"	"18"	"Q9CQU3"	"Q9CQU3 [186-192]"	"Q9CQU3 1xBiotin [K187]"	"1"	"958.46624"	"0.028"	"1.052"	"5.33508427791077E-05"	"0.920195905108535"	"48.24"	"62.61"	"154.0"	"4.3"	"141.8"	"31.71"	"36.39"	"46.34"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005902"	"0.001354"	"2.75"	"23.59"
"26819"	"False"	"High"	"[K].KGAAEDGDKLDIGNTEMK.[L]"	"1xBiotin [K1]"	"0.00839977"	"0.0007621"	"1"	"1"	"6"	"Q61335"	"Q61335 [159-176]"	"Q61335 1xBiotin [K159]"	"2"	"2117.98418"	"0.689"	"0.778"	"0.939160161221265"	"0.906515362333117"	"41.89"	"53.70"	"117.4"	"84.5"	"98.1"	"33.25"	"31.07"	"39.86"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.0002502"	"0.0006237"	"3.56"	"36.49"
"26805"	"False"	"High"	"[R].KFVFFNIPQIQYK.[N]"	""	"0.0138503"	"0.0007621"	"1"	"1"	"8"	"Q9D125"	"Q9D125 [46-58]"	""	"1"	"1671.92573"	"99.584"	"4.592"	"0.438755141134966"	"0.906515362333117"	"53.73"	"80.83"	"2.8"	"287.7"	"9.5"	"45.02"	"30.98"	"61.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009799"	"2.69"	"55.45"
"20809"	"False"	"High"	"[R].GGPLTGNYR.[L]"	""	"0.0347849"	"0.0007621"	"1"	"1"	"12"	"Q9D6N1"	"Q9D6N1 [82-90]"	""	"0"	"934.47411"	"184.791"	"5.995"	"0.925138005747468"	"0.906515362333117"	"53.63"	"46.96"	"1.3"	"290.1"	"8.5"	"49.55"	"46.59"	"28.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002327"	"2.55"	"24.29"
"21756"	"False"	"High"	"[K].GLSQSALPYR.[R]"	""	"0.0217098"	"0.0007621"	"1"	"1"	"4"	"P62301"	"P62301 [10-19]"	""	"0"	"1091.58438"	"102.870"	"3.371"	"0.478597253695619"	"0.906515362333117"	"55.47"	"67.70"	"3.6"	"287.6"	"8.9"	"39.33"	"31.97"	"52.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001481"	"2.50"	"32.37"
"25802"	"False"	"High"	"[R].KATGPPVSELITK.[A]"	"1xBiotin [K1]"	"0.00804417"	"0.0007621"	"1"	"1"	"2"	"P43276"	"P43276 [34-46]"	"P43276 1xBiotin [K34]"	"1"	"1566.85599"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005994"	"2.79"	""
"21313"	"False"	"High"	"[R].GLAVGIALVMYGR.[M]"	"1xOxidation [M10]"	"0.00458286"	"0.0007621"	"1"	"1"	"1"	"Q3TXS7"	"Q3TXS7 [547-559]"	""	"0"	"1335.74532"	"14.589"	"1.032"	"0.925138005747468"	""	"261.06"	"66.52"	"19.8"	"259.2"	"21.0"	"49.16"	"134.47"	"47.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003599"	"2.83"	"50.77"
"375"	"False"	"High"	"[R].AATQFWR.[N]"	""	"0.0235139"	"0.0007621"	"1"	"1"	"14"	"P08003"	"P08003 [422-428]"	""	"0"	"879.44716"	"116.209"	"3.963"	"0.925138005747468"	"0.906515362333117"	"44.67"	"41.36"	"2.7"	"285.4"	"11.9"	"26.86"	"51.46"	"29.50"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001596"	"2.06"	"34.10"
"25266"	"False"	"High"	"[K].HTSYISGPWFDMYLTAR.[D]"	"1xOxidation [M12]"	"0.0265822"	"0.0007621"	"1"	"1"	"1"	"P52825"	"P52825 [108-124]"	""	"0"	"2060.95347"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001788"	"2.39"	""
"25243"	"False"	"High"	"[K].HTLVKGIIDSTVSEQR.[Q]"	"1xBiotin [K5]"	"0.0197976"	"0.0007621"	"1"	"1"	"1"	"G5E829"	"G5E829 [774-789]"	"G5E829 1xBiotin [K778]"	"1"	"2009.04844"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0005902"	"0.00136"	"2.96"	""
"21544"	"False"	"High"	"[K].GLLQLQWK.[Q]"	""	"0.0289613"	"0.0007621"	"1"	"1"	"10"	"Q9CZW5"	"Q9CZW5 [520-527]"	""	"0"	"985.58293"	"221.666"	"7.028"	"0.925138005747468"	"0.906515362333117"	"48.70"	"58.28"	"1.3"	"289.7"	"9.0"	"43.28"	"30.01"	"42.69"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0006486"	"0.001946"	"1.57"	"49.04"
"71956"	"False"	"High"	"[K].YMACCLLYR.[G]"	"2xCarbamidomethyl [C4; C5]"	"0.00512251"	"0.0007621"	"1"	"5"	"20"	"P05213"	"P05213 [312-320]"	""	"0"	"1249.55263"	"25.516"	"3.625"	"0.925138005747468"	"0.906515362333117"	"147.07"	"70.43"	"9.9"	"252.7"	"37.4"	"59.75"	"107.67"	"34.59"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003979"	"2.34"	"41.28"
"25076"	"False"	"High"	"[K].HSLFATKPGGGALVFR.[E]"	""	"0.0246969"	"0.0007621"	"1"	"1"	"5"	"Q68FH4"	"Q68FH4 [441-456]"	""	"0"	"1657.91729"	"106.197"	"2.673"	"0.429688111580326"	"0.919235111389825"	"73.16"	"57.43"	"2.8"	"290.7"	"6.5"	"36.33"	"55.01"	"42.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.00167"	"2.66"	"40.02"
"25066"	"False"	"High"	"[K].HSKNITQR.[G]"	"1xBiotin [K3]"	"0.00583283"	"0.0007621"	"1"	"3"	"18"	"Q9Z1W5"	"Q9Z1W5 [14-21]"	"Q9Z1W5 1xBiotin [K16]"	"1"	"1209.61570"	"0.040"	"0.684"	"0.000111107012040991"	"0.906515362333117"	"80.39"	"45.68"	"173.8"	"10.2"	"116.0"	"68.69"	"45.64"	"24.57"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004483"	"2.25"	"22.73"
"21606"	"False"	"High"	"[K].GIPEFWFTIFR.[N]"	""	"0.0027767"	"0.0007621"	"1"	"1"	"11"	"Q78ZA7"	"Q78ZA7 [158-168]"	""	"0"	"1412.73613"	"5.393"	"1.888"	"0.925138005747468"	"0.973302589881271"	"281.48"	"93.62"	"39.3"	"194.5"	"66.1"	"47.60"	"131.38"	"162.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002259"	"2.72"	"67.77"
"24904"	"False"	"High"	"[R].HQGVMVGMGQKDSYVGDEAQSK.[R]"	"1xBiotin [K11]; 1xOxidation [M]"	"0.00746917"	"0.0007621"	"1"	"6"	"4"	"P60710"	"P60710 [40-61]"	"P60710 1xBiotin [K50]"	"1"	"2593.14797"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0005597"	"3.55"	""
"21607"	"False"	"High"	"[K].GIPEFWLTVFK.[N]"	""	"0.0069782"	"0.0007621"	"1"	"1"	"18"	"P28656"	"P28656 [166-176]"	""	"0"	"1336.72999"	"217.102"	"8.851"	"0.925138005747468"	"0.906515362333117"	"80.13"	"86.31"	"1.4"	"287.1"	"11.5"	"58.09"	"46.17"	"48.95"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005264"	"2.07"	"65.76"
"24898"	"False"	"High"	"[R].HQGLQEKLAEEMLGLAR.[S]"	"1xBiotin [K7]"	"0.0059054"	"0.0007621"	"1"	"2"	"1"	"Q9CQ56"	"Q9CQ56 [176-192]"	"Q9CQ56 1xBiotin [K182]"	"1"	"2149.08925"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.0004527"	"3.23"	""
"24894"	"False"	"High"	"[K].HQFAWPFR.[Q]"	""	"0.00944602"	"0.0007621"	"1"	"2"	"9"	"Q7JJ13-1"	"Q7JJ13-1 [92-99]"	""	"0"	"1088.54246"	"63.642"	"1.918"	"0.562778661222741"	"0.982339048472816"	"82.57"	"94.27"	"4.4"	"287.6"	"8.1"	"109.21"	"27.47"	"64.05"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0006932"	"2.40"	"44.60"
"71973"	"False"	"High"	"[K].YMEAFKPFLGIGLK.[N]"	"1xOxidation [M2]"	"0.0115811"	"0.0007621"	"1"	"1"	"4"	"P70168"	"P70168 [646-659]"	""	"0"	"1629.87091"	"53.269"	"0.884"	"0.925138005747468"	"0.906515362333117"	"54.62"	"63.83"	"6.9"	"288.2"	"4.9"	"38.55"	"38.15"	"52.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0008353"	"2.64"	"51.54"
"21634"	"False"	"High"	"[R].GLPLVDDGGWNTVPISKGSRPIDTSR.[L]"	"1xBiotin [K17]"	"0.0082966"	"0.0007621"	"1"	"1"	"3"	"Q6NZJ6"	"Q6NZJ6 [1047-1072]"	"Q6NZJ6 1xBiotin [K1063]"	"1"	"2963.50436"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000618"	"1.89"	""
"24796"	"False"	"High"	"[R].HNWGQGFR.[L]"	""	"0.0133471"	"0.0007621"	"1"	"1"	"20"	"Q99J56"	"Q99J56 [240-247]"	""	"0"	"1001.47002"	"106.805"	"2.763"	"0.932172616415912"	"0.906515362333117"	"58.93"	"39.78"	"2.8"	"290.0"	"7.2"	"33.19"	"90.15"	"22.53"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009465"	"2.15"	"25.90"
"24767"	"False"	"High"	"[K].HNHGAYQFFR.[E]"	""	"0.0209239"	"0.0007621"	"1"	"3"	"1"	"Q8VE10-1"	"Q8VE10-1 [178-187]"	""	"0"	"1276.59701"	"195.049"	"5.544"	"0.925138005747468"	"0.906515362333117"	"71.74"	"77.37"	"1.6"	"290.3"	"8.1"	"71.28"	"40.04"	"35.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001427"	"2.69"	"29.88"
"24756"	"False"	"High"	"[K].HNELTGDNVGPLILKKK.[E]"	"2xBiotin [K16; K]"	"0.00324116"	"0.0007621"	"1"	"1"	"4"	"Q9CQB5"	"Q9CQB5 [117-133]"	"Q9CQB5 2xBiotin [K132; K]"	"2"	"2328.22027"	"0.392"	"0.700"	"0.925138005747468"	"0.906515362333117"	"46.93"	"93.65"	"143.6"	"56.0"	"100.5"	"38.83"	"35.78"	"71.20"	""	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0001583"	"0.0002608"	"3.30"	"51.29"
"24754"	"False"	"High"	"[K].HNEETGDNVGPLIIKK.[K]"	"1xBiotin [K16]"	"0.017505"	"0.0007621"	"1"	"1"	"4"	"Q91WS0"	"Q91WS0 [90-105]"	"Q91WS0 1xBiotin [K105]"	"1"	"1990.00624"	"0.025"	"0.749"	"4.28461889385649E-05"	"0.906515362333117"	"51.02"	"44.19"	"161.8"	"4.3"	"134.0"	"58.05"	"33.52"	"16.13"	""	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0005416"	"0.001211"	"2.96"	"41.83"
"24735"	"False"	"High"	"[R].HMYHSLYLK.[V]"	"1xOxidation [M2]"	"0.005869"	"0.0007621"	"1"	"1"	"12"	"P84099"	"P84099 [118-126]"	""	"0"	"1207.59284"	"1000.000"	"44.262"	"9.75666666666667E-15"	"0.0468259595410407"	"46.89"	"52.47"	"0.1"	"296.2"	"3.8"	"46.29"	"24.05"	"35.83"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002312"	"0.0004504"	"2.73"	"23.38"
"71942"	"False"	"High"	"[R].YLVVLYYNANR.[A]"	""	"0.00449861"	"0.0007621"	"1"	"1"	"1"	"P59708"	"P59708 [86-96]"	""	"0"	"1387.73686"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003532"	"2.16"	""
"25304"	"False"	"High"	"[R].HVFGQPAK.[A]"	""	"0.02578"	"0.0007621"	"1"	"1"	"3"	"O89053"	"O89053 [13-20]"	""	"0"	"883.47846"	"123.980"	"1.703"	"0.456381964830803"	"0.992082519751165"	"61.00"	"72.38"	"2.2"	"292.8"	"5.0"	"55.02"	"22.33"	"43.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0006427"	"0.001736"	"1.90"	"14.78"
"71941"	"False"	"High"	"[R].YLVVLNFR.[D]"	""	"0.00998601"	"0.0007621"	"1"	"2"	"21"	"P10852"	"P10852 [456-463]"	""	"0"	"1023.59858"	"122.039"	"3.260"	"0.925138005747468"	"0.906515362333117"	"49.89"	"35.19"	"2.5"	"289.8"	"7.7"	"27.00"	"43.39"	"17.62"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007315"	"1.99"	"51.00"
"21529"	"False"	"High"	"[RK].GILLYGPPGTGK.[T]"	""	"0.0243957"	"0.0007621"	"1"	"4"	"5"	"Q01853"	"Q01853 [240-251]"	""	"0"	"1172.66739"	"255.833"	"2.863"	"0.193099244381187"	"0.916215054610739"	"55.13"	"107.49"	"1.5"	"293.7"	"4.8"	"64.81"	"50.77"	"87.17"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0006427"	"0.001645"	"2.69"	"40.98"
"21315"	"False"	"High"	"[K].GIAYIEFK.[S]"	""	"0.0166635"	"0.0007621"	"1"	"1"	"13"	"P09405"	"P09405 [432-439]"	""	"0"	"940.51384"	"136.297"	"3.911"	"0.928611703535518"	"0.906515362333117"	"42.31"	"57.75"	"2.1"	"289.8"	"8.1"	"30.97"	"27.65"	"44.38"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001158"	"2.03"	"42.34"
"71882"	"False"	"High"	"[K].YIQHTYR.[K]"	""	"0.023227"	"0.0007621"	"1"	"1"	"10"	"Q99PT1"	"Q99PT1 [128-134]"	""	"0"	"980.49484"	"147.986"	"2.552"	"0.925138005747468"	"0.909990296418396"	"68.97"	"69.13"	"1.9"	"293.4"	"4.7"	"64.00"	"37.32"	"44.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001575"	"1.72"	"14.81"
"25539"	"False"	"High"	"[R].KAFPLSLGGR.[D]"	"1xBiotin [K1]"	"0.00668268"	"0.0007621"	"1"	"3"	"9"	"Q8BML1"	"Q8BML1 [741-750]"	"Q8BML1 1xBiotin [K741]"	"1"	"1271.69289"	"0.197"	"0.452"	"0.925138005747468"	"0.906515362333117"	"45.94"	"73.74"	"177.7"	"35.8"	"86.5"	"19.38"	"35.20"	"55.03"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005069"	"2.25"	"49.53"
"21401"	"False"	"High"	"[R].GLFSFFQGR.[Y]"	""	"0.0163584"	"0.0007621"	"1"	"2"	"13"	"Q9D2X5-1"	"Q9D2X5-1 [472-480]"	""	"0"	"1058.54179"	"133.245"	"2.995"	"0.925138005747468"	"0.906515362333117"	"52.95"	"45.76"	"2.5"	"291.2"	"6.4"	"36.96"	"43.79"	"51.65"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001142"	"1.81"	"57.29"
"25464"	"False"	"High"	"[R].KACQIFVR.[N]"	"1xCarbamidomethyl [C3]"	"0.0309763"	"0.0007621"	"1"	"2"	"6"	"Q9D0E1"	"Q9D0E1 [650-657]"	""	"1"	"1021.56115"	"304.013"	"6.638"	"0.366507028826689"	"0.906515362333117"	"56.08"	"56.43"	"1.0"	"292.4"	"6.6"	"67.36"	"37.06"	"24.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002068"	"2.15"	"23.71"
"71898"	"False"	"High"	"[R].YLRPPNTSLFVR.[N]"	""	"0.0029357"	"0.0007621"	"1"	"3"	"3"	"Q9R0U0-1"	"Q9R0U0-1 [4-15]"	""	"0"	"1462.81651"	"76.042"	"0.899"	"0.475849900854088"	""	"131.96"	"53.47"	"5.0"	"290.9"	"4.1"	"47.09"	"87.14"	"31.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002387"	"2.26"	"40.64"
"21403"	"False"	"High"	"[K].GIFVIGFSYPVVPK.[G]"	""	"0.017505"	"0.0007621"	"1"	"1"	"11"	"O88986"	"O88986 [367-380]"	""	"0"	"1522.86681"	"69.930"	"1.379"	"0.487524984662636"	"0.916215054610739"	"82.13"	"95.05"	"4.1"	"288.8"	"7.1"	"49.55"	"81.81"	"80.12"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0005416"	"0.001214"	"3.17"	"60.14"
"21404"	"False"	"High"	"[K].GIFVQSVMPYLVATK.[L]"	""	"0.0153808"	"0.0007621"	"1"	"2"	"2"	"O70503-1"	"O70503-1 [224-238]"	""	"0"	"1652.90803"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.000459"	"0.001082"	"3.07"	""
"25399"	"False"	"High"	"[K].HYGPGWVSMANAGK.[D]"	"1xOxidation [M9]"	"0.00636021"	"0.0007621"	"1"	"1"	"9"	"P24369"	"P24369 [132-145]"	""	"0"	"1490.68451"	"353.428"	"1.053"	"0.925138005747468"	"0.906515362333117"	"53.87"	"78.93"	"0.7"	"298.4"	"0.9"	"34.86"	"39.24"	"86.17"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0004837"	"3.14"	"28.61"
"25770"	"False"	"High"	"[R].KASGPPVSELITK.[A]"	"1xBiotin [K1]"	"0.00605328"	"0.0007621"	"2"	"2"	"11"	"P15864; P43277"	"P15864 [34-46]; P43277 [35-47]"	"P15864 1xBiotin [K34]; P43277 1xBiotin [K35]"	"1"	"1552.84034"	"0.285"	"0.649"	"0.925138005747468"	"0.906515362333117"	"29.85"	"37.35"	"152.5"	"43.6"	"103.9"	"18.23"	"23.36"	"52.78"	"NotUnique"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0002312"	"0.0004627"	"2.78"	"42.93"
"25398"	"False"	"High"	"[K].HYGPGWVSMANAGK.[D]"	""	"0.00819469"	"0.0007621"	"1"	"1"	"3"	"P24369"	"P24369 [132-145]"	""	"0"	"1474.68959"	"9.712"	"1.390"	"0.925138005747468"	"0.950055801575781"	"153.47"	"111.34"	"41.5"	"233.1"	"25.5"	"77.80"	"107.72"	"87.40"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0006103"	"2.26"	"35.61"
"25395"	"False"	"High"	"[K].HYGFQLYQSDPSGNYGGWK.[A]"	""	"0.0202906"	"0.0007621"	"1"	"1"	"1"	"Q9R1P0"	"Q9R1P0 [142-160]"	""	"0"	"2203.98319"	"137.263"	"2.164"	"0.399031752280175"	"0.94529650366445"	"50.28"	"64.48"	"2.2"	"294.1"	"3.8"	"40.12"	"45.99"	"52.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.000628"	"0.001389"	"2.16"	"44.92"
"25394"	"False"	"High"	"[R].HYFQNTQGLIFVVDSNDR.[E]"	""	"0.0163584"	"0.0007621"	"1"	"5"	"1"	"P61205"	"P61205 [80-97]"	""	"0"	"2153.04104"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005064"	"0.00114"	"3.69"	""
"71899"	"False"	"High"	"[R].YIRPVFVSR.[S]"	""	"0.0116528"	"0.0007621"	"1"	"2"	"3"	"Q3TFD2-1"	"Q3TFD2-1 [169-177]"	""	"0"	"1136.65749"	"111.428"	"1.789"	"0.423976448584242"	"0.944009216783929"	"78.88"	"53.51"	"2.4"	"292.3"	"5.3"	"46.24"	"64.57"	"30.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0008371"	"2.77"	"32.55"
"71909"	"False"	"High"	"[R].YISGSIHYFR.[I]"	""	"0.0046399"	"0.0007621"	"1"	"1"	"6"	"P23780"	"P23780 [51-60]"	""	"0"	"1242.62658"	"311.357"	"7.285"	"0.925138005747468"	"0.906515362333117"	"48.70"	"44.91"	"0.9"	"292.8"	"6.3"	"37.62"	"28.80"	"32.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003628"	"2.69"	"34.67"
"71915"	"False"	"High"	"[R].YLSNAYAR.[E]"	""	"0.0254658"	"0.0007621"	"1"	"1"	"16"	"Q9Z1Q5"	"Q9Z1Q5 [209-216]"	""	"0"	"957.47886"	"118.462"	"3.694"	"0.925138005747468"	"0.906515362333117"	"54.42"	"45.11"	"2.4"	"289.1"	"8.5"	"56.70"	"32.38"	"16.07"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.00172"	"2.03"	"23.40"
"71926"	"False"	"High"	"[R].YITPDQLADLYK.[S]"	""	"0.012018"	"0.0007621"	"1"	"1"	"3"	"P17182"	"P17182 [270-281]"	""	"0"	"1439.74167"	"42.656"	"1.312"	"0.925138005747468"	"0.906515362333117"	"142.91"	"88.62"	"5.8"	"285.8"	"8.4"	"38.84"	"91.12"	"78.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0003095"	"0.0008652"	"2.05"	"50.56"
"71928"	"False"	"High"	"[R].YLTVAAVFR.[G]"	""	"0.014109"	"0.0007621"	"2"	"3"	"10"	"Q9D6F9; P99024"	"Q9D6F9 [310-318]; P99024 [310-318]"	""	"0"	"1039.59349"	"127.971"	"3.757"	"0.925138005747468"	"0.906515362333117"	"51.11"	"61.82"	"2.1"	"288.7"	"9.2"	"47.71"	"25.22"	"50.04"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009961"	"2.54"	"48.38"
"25355"	"False"	"High"	"[K].HVVFGKVK.[E]"	"1xBiotin [K6]"	"0.0262584"	"0.0007621"	"1"	"1"	"6"	"P17742"	"P17742 [126-133]"	"P17742 1xBiotin [K131]"	"1"	"1139.63940"	"0.126"	"0.816"	"0.925138005747468"	"0.906515362333117"	"62.59"	"84.04"	"161.3"	"20.4"	"118.3"	"47.41"	"49.22"	"83.00"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001765"	"1.83"	"34.80"
"21526"	"False"	"High"	"[K].GILLQLFGGTR.[K]"	""	"0.00239351"	"0.0007621"	"1"	"1"	"16"	"P49717"	"P49717 [478-488]"	""	"0"	"1174.69427"	"240.313"	"6.480"	"0.925138005747468"	"0.906515362333117"	"81.49"	"73.92"	"1.2"	"291.1"	"7.7"	"69.31"	"20.44"	"51.68"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001059"	"0.0001964"	"2.54"	"58.74"
"21416"	"False"	"High"	"[K].GLGKGGAK.[R]"	"1xBiotin [K4]"	"0.0333312"	"0.0007621"	"1"	"1"	"6"	"P62806"	"P62806 [10-17]"	"P62806 1xBiotin [K13]"	"1"	"913.49240"	"0.098"	"0.747"	"0.925138005747468"	"0.906515362333117"	"48.95"	"80.61"	"161.7"	"15.4"	"122.9"	"27.71"	"43.79"	"66.68"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002223"	"2.11"	"25.81"
"19487"	"False"	"High"	"[R].GAPQHYPKTAGNSEFLGK.[T]"	"1xBiotin [K8]"	"0.0177219"	"0.0007621"	"1"	"2"	"3"	"Q62448"	"Q62448 [24-41]"	"Q62448 1xBiotin [K31]"	"1"	"2128.02803"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0005416"	"0.001226"	"2.37"	""
"70619"	"False"	"High"	"[K].WPFWLSPR.[Q]"	""	"0.00441591"	"0.0007621"	"1"	"1"	"51"	"Q9D0R2"	"Q9D0R2 [611-618]"	""	"0"	"1088.56761"	"71.001"	"2.033"	"0.994201151226993"	"0.906515362333117"	"51.15"	"51.65"	"4.9"	"285.8"	"9.3"	"32.87"	"36.07"	"64.35"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003476"	"2.23"	"58.08"
"62743"	"False"	"High"	"[R].SVDGGLMVKGPR.[H]"	"1xBiotin [K9]; 1xOxidation [M7]"	"0.0133471"	"0.0007621"	"1"	"2"	"1"	"Q9QZQ1"	"Q9QZQ1 [512-523]"	"Q9QZQ1 1xBiotin [K520]"	"1"	"1457.72393"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.00095"	"2.29"	""
"69396"	"False"	"High"	"[K].VTAIKSLSIEIGHEVKNQNK.[L]"	"2xBiotin [K5; K16]"	"0.0119441"	"0.0007621"	"1"	"1"	"3"	"O35623"	"O35623 [43-62]"	"O35623 2xBiotin [K47; K58]"	"2"	"2660.38985"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0003095"	"0.0008585"	"3.56"	""
"35128"	"False"	"High"	"[R].LLNILMQLR.[K]"	""	"0.0194357"	"0.0007621"	"1"	"3"	"4"	"Q6PGB8"	"Q6PGB8 [453-461]"	""	"0"	"1113.68126"	"0.709"	"2.194"	"0.943046984779956"	"0.969054191468458"	"87.52"	"69.91"	"90.6"	"54.6"	"154.8"	"30.38"	"237.08"	"54.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0005902"	"0.001333"	"1.93"	"57.08"
"35126"	"False"	"High"	"[R].ILNIFGVIK.[G]"	""	"0.011023"	"0.0007621"	"1"	"1"	"2"	"Q62351"	"Q62351 [388-396]"	""	"0"	"1016.65028"	"66.093"	"1.247"	"0.542011931624952"	""	"85.82"	"48.87"	"5.3"	"288.2"	"6.5"	"48.78"	"71.44"	"16.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0007986"	"2.20"	"57.14"
"18719"	"False"	"High"	"[K].FSMVQVWPVR.[Q]"	""	"0.00636021"	"0.0007621"	"1"	"2"	"9"	"P50516-1"	"P50516-1 [203-212]"	""	"0"	"1248.65577"	"94.878"	"6.189"	"0.499021506987873"	"0.906515362333117"	"55.33"	"35.78"	"3.4"	"276.6"	"20.0"	"34.30"	"61.43"	"21.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004852"	"2.63"	"53.20"
"35057"	"False"	"High"	"[K].LLLWSQR.[M]"	""	"0.0189632"	"0.0007621"	"1"	"16"	"6"	"Q9QXS1-1"	"Q9QXS1-1 [312-318]"	""	"0"	"915.54106"	"157.982"	"4.325"	"0.925138005747468"	"0.906515362333117"	"79.83"	"86.30"	"1.8"	"290.3"	"7.9"	"76.23"	"33.81"	"22.14"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001303"	"1.99"	"43.56"
"69475"	"False"	"High"	"[K].VTKSAQK.[A]"	"1xBiotin [K3]"	"0.0151924"	"0.0007621"	"1"	"2"	"15"	"P10126"	"P10126 [451-457]"	"P10126 1xBiotin [K453]"	"1"	"987.52918"	"0.095"	"0.745"	"0.00556263292220494"	"0.906515362333117"	"49.62"	"48.11"	"161.2"	"18.9"	"120.0"	"41.35"	"38.84"	"20.81"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0004044"	"0.001065"	"2.23"	"19.22"
"35032"	"False"	"High"	"[R].LLLTPWVK.[F]"	""	"0.0160588"	"0.0007621"	"1"	"1"	"3"	"P23116"	"P23116 [144-151]"	""	"0"	"969.61317"	"123.659"	"3.337"	"0.423976448584242"	"0.906515362333117"	"80.03"	"73.07"	"2.5"	"288.9"	"8.7"	"60.49"	"33.80"	"36.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005064"	"0.001121"	"2.17"	"51.54"
"2179"	"False"	"High"	"[K].ALGLSNFNSR.[Q]"	""	"0.0109552"	"0.0007621"	"1"	"1"	"7"	"Q9JII6"	"Q9JII6 [158-167]"	""	"0"	"1078.56398"	"127.475"	"2.393"	"0.393458898369186"	"0.935866453494337"	"47.20"	"95.04"	"2.5"	"291.7"	"5.9"	"44.61"	"22.75"	"72.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007914"	"2.24"	"36.52"
"37687"	"False"	"High"	"[KR].LRNWQWWR.[L]"	""	"0.0280885"	"0.0007621"	"1"	"6"	"17"	"Q8VDD5"	"Q8VDD5 [822-829]"	""	"1"	"1244.64357"	"44.571"	"1.360"	"0.925138005747468"	"0.995674964380212"	"57.31"	"51.89"	"6.3"	"285.1"	"8.6"	"40.96"	"36.21"	"37.65"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006486"	"0.001883"	"2.82"	"45.59"
"68145"	"False"	"High"	"[K].VIPELNGKLTGMAFR.[V]"	"1xBiotin [K8]"	"0.0246969"	"0.0007621"	"1"	"1"	"2"	"P16858"	"P16858 [218-232]"	"P16858 1xBiotin [K225]"	"1"	"1871.98702"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001664"	"2.07"	""
"34994"	"False"	"High"	"[R].ILLQSKNAGAVIGK.[G]"	"1xBiotin [K6]"	"0.0108878"	"0.0007621"	"1"	"3"	"2"	"P61979"	"P61979 [47-60]"	"P61979 1xBiotin [K52]"	"1"	"1637.94072"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.000787"	"2.90"	""
"34982"	"False"	"High"	"[K].LLLPWLEAR.[I]"	""	"0.012018"	"0.0007621"	"1"	"1"	"7"	"Q68FD5"	"Q68FD5 [857-865]"	""	"0"	"1110.66699"	"67.743"	"1.749"	"0.484565749895235"	"0.954461348772941"	"30.37"	"38.44"	"4.3"	"288.2"	"7.5"	"39.24"	"15.39"	"35.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003095"	"0.0008611"	"1.74"	"59.57"
"34979"	"False"	"High"	"[K].LLLPSTFFCYK.[N]"	"1xCarbamidomethyl [C9]"	"0.00332236"	"0.0007621"	"1"	"1"	"6"	"Q9ERU9"	"Q9ERU9 [2488-2498]"	""	"0"	"1388.72827"	"39.518"	"1.323"	"0.925138005747468"	"0.906515362333117"	"34.15"	"61.92"	"7.3"	"285.4"	"7.3"	"44.17"	"50.98"	"50.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002667"	"2.38"	"58.84"
"34970"	"False"	"High"	"[R].LLLPLFR.[V]"	""	"0.0309763"	"0.0007621"	"1"	"1"	"8"	"Q8R2U4"	"Q8R2U4 [79-85]"	""	"0"	"871.57639"	"66.378"	"1.709"	"0.466031980976297"	"0.960422171904683"	"38.14"	"53.02"	"4.4"	"288.9"	"6.7"	"24.57"	"74.79"	"49.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0006486"	"0.002075"	"2.03"	"56.95"
"69509"	"False"	"High"	"[R].VTMLFLGLHNVR.[Q]"	""	"0.0115811"	"0.0007621"	"1"	"1"	"5"	"Q922B2"	"Q922B2 [476-487]"	""	"0"	"1399.78785"	"70.907"	"3.652"	"0.478189225500009"	"0.906515362333117"	"72.76"	"72.13"	"4.0"	"280.1"	"15.9"	"57.58"	"55.05"	"46.26"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0008342"	"2.49"	"49.15"
"68220"	"False"	"High"	"[R].VIQQLEGAFALVFK.[S]"	""	"0.031937"	"0.0007621"	"1"	"3"	"3"	"P47856"	"P47856 [177-190]"	""	"0"	"1562.89409"	"0.691"	"0.820"	""	"0.906515362333117"	"47.40"	"47.95"	"118.5"	"85.5"	"96.0"	"28.22"	"46.46"	"31.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0006486"	"0.002143"	"2.41"	"64.04"
"37462"	"False"	"High"	"[K].IQSNKGSSYK.[L]"	"1xBiotin [K5]"	"0.00950455"	"0.0007621"	"1"	"3"	"8"	"O88738"	"O88738 [2284-2293]"	"O88738 1xBiotin [K2288]"	"1"	"1337.65181"	"0.296"	"1.060"	"0.925138005747468"	"0.906515362333117"	"100.20"	"90.66"	"124.6"	"36.8"	"138.7"	"75.73"	"45.23"	"43.84"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006975"	"2.08"	"26.19"
"35193"	"False"	"High"	"[K].ILPDVNLGKIIK.[S]"	"1xBiotin [K]"	"0.0100479"	"0.0007621"	"1"	"1"	"5"	"Q8BHY8"	"Q8BHY8 [714-725]"	"Q8BHY8 1xBiotin [K]"	"1"	"1548.91820"	"0.684"	"0.930"	"0.925138005747468"	"0.906515362333117"	"42.58"	"35.29"	"118.3"	"78.3"	"103.5"	"37.48"	"37.05"	"27.76"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0002502"	"0.0007324"	"2.73"	"56.70"
"37348"	"False"	"High"	"[R].IQMKSLTNK.[W]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.0226635"	"0.0007621"	"1"	"3"	"2"	"Q8R4D1"	"Q8R4D1 [548-556]"	"Q8R4D1 1xBiotin [K551]"	"1"	"1304.67010"	"0.476"	"0.576"	"0.933451859704016"	"0.906515362333117"	"94.64"	"86.87"	"140.3"	"70.2"	"89.5"	"72.89"	"44.43"	"60.40"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001535"	"2.08"	"31.26"
"35572"	"False"	"High"	"[K].LLSNMMLQYR.[G]"	""	"0.0176131"	"0.0007621"	"1"	"1"	"2"	"P28063"	"P28063 [154-163]"	""	"0"	"1268.64897"	"0.916"	"1.708"	"0.925138005747468"	"0.933220350789086"	"67.48"	"61.94"	"84.4"	"85.0"	"130.6"	"29.75"	"210.83"	"56.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.0005416"	"0.001222"	"2.43"	"45.82"
"18655"	"False"	"High"	"[R].FSGGFGAR.[D]"	""	"0.0243957"	"0.0007621"	"1"	"3"	"20"	"Q62167"	"Q62167 [593-600]"	""	"0"	"798.38931"	"119.311"	"2.649"	"0.925138005747468"	"0.906515362333117"	"61.59"	"55.97"	"2.4"	"291.0"	"6.7"	"45.98"	"42.30"	"36.48"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001645"	"1.93"	"25.22"
"35534"	"False"	"High"	"[K].LLSKMAGR.[S]"	"1xBiotin [K4]"	"0.0134297"	"0.0007621"	"1"	"1"	"12"	"Q9D8Y7"	"Q9D8Y7 [17-24]"	"Q9D8Y7 1xBiotin [K20]"	"1"	"1101.59073"	"0.077"	"0.864"	"0.00309305972177736"	"0.906515362333117"	"41.92"	"39.04"	"157.9"	"13.7"	"128.4"	"24.95"	"38.69"	"33.01"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009533"	"2.33"	"37.60"
"35522"	"False"	"High"	"[K].LISGWVSR.[S]"	""	"0.0307875"	"0.0007621"	"1"	"1"	"1"	"Q6P5F9"	"Q6P5F9 [758-765]"	""	"0"	"917.52033"	"143.922"	"4.045"	"0.925138005747468"	"0.906515362333117"	"66.00"	"65.13"	"2.2"	"288.9"	"8.9"	"61.18"	"37.72"	"43.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.002064"	"2.07"	"36.27"
"35447"	"False"	"High"	"[R].ILRPGGCLFLK.[E]"	"1xCarbamidomethyl [C7]"	"0.010363"	"0.0007621"	"1"	"1"	"4"	"Q8WTY4"	"Q8WTY4 [86-96]"	""	"0"	"1273.74492"	"151.076"	"4.283"	"0.925138005747468"	"0.906515362333117"	"75.29"	"78.74"	"1.9"	"289.2"	"8.9"	"72.39"	"26.73"	"42.90"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007555"	"3.08"	"40.35"
"35385"	"False"	"High"	"[K].IIQSFLWYLNPR.[Q]"	""	"0.00316194"	"0.0007621"	"1"	"1"	"5"	"Q80UP3"	"Q80UP3 [313-324]"	""	"0"	"1549.85256"	"25.560"	"0.774"	"0.925138005747468"	"0.906515362333117"	"91.28"	"53.32"	"10.9"	"280.9"	"8.1"	"26.93"	"81.84"	"49.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0001583"	"0.000255"	"2.33"	"61.50"
"18668"	"False"	"High"	"[R].FSGTYTCMNTFKGR.[T]"	"1xBiotin [K12]; 1xCarbamidomethyl [C7]; 1xOxidation [M8]"	"0.00866334"	"0.0007621"	"1"	"2"	"2"	"O88876-2"	"O88876-2 [222-235]"	"O88876-2 1xBiotin [K233]"	"1"	"1911.81864"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.000641"	"2.54"	""
"34956"	"False"	"High"	"[K].LIINSLYK.[N]"	""	"0.00819469"	"0.0007621"	"1"	"1"	"14"	"P08113"	"P08113 [88-95]"	""	"0"	"963.58734"	"238.600"	"5.867"	"0.925138005747468"	"0.906515362333117"	"93.35"	"105.31"	"1.0"	"290.3"	"8.7"	"102.47"	"71.45"	"36.78"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006094"	"2.22"	"41.11"
"68298"	"False"	"High"	"[K].VLSNRPIMFR.[G]"	""	"0.00569033"	"0.0007621"	"1"	"1"	"8"	"P97855"	"P97855 [392-401]"	""	"0"	"1232.69322"	"34.450"	"3.078"	"0.925138005747468"	"0.906515362333117"	"144.09"	"81.05"	"7.9"	"272.6"	"19.5"	"73.30"	"95.37"	"40.35"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0004373"	"1.95"	"34.23"
"35306"	"False"	"High"	"[K].LLQDFFNGK.[E]"	""	"0.0202906"	"0.0007621"	"1"	"2"	"7"	"P63017"	"P63017 [349-357]"	""	"0"	"1081.56767"	"96.795"	"2.262"	"0.947989303413716"	"0.906515362333117"	"79.03"	"68.93"	"3.0"	"288.8"	"8.2"	"58.77"	"59.99"	"43.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000628"	"0.001387"	"2.28"	"45.99"
"35286"	"False"	"High"	"[R].ILPWSTFR.[L]"	""	"0.00855693"	"0.0007621"	"1"	"1"	"9"	"P08775"	"P08775 [476-483]"	""	"0"	"1019.56728"	"90.563"	"3.307"	"0.940042144832625"	"0.906515362333117"	"89.60"	"86.76"	"3.7"	"285.8"	"10.5"	"74.12"	"48.71"	"46.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006349"	"1.69"	"49.08"
"18691"	"False"	"High"	"[K].FSLFAGGMLR.[V]"	""	"0.00272563"	"0.0007621"	"1"	"1"	"11"	"Q99KF1"	"Q99KF1 [129-138]"	""	"0"	"1098.57646"	"61.675"	"4.144"	"0.952905080717326"	"0.906515362333117"	"51.85"	"16.04"	"4.6"	"277.5"	"17.9"	"15.19"	"61.11"	"11.76"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002222"	"2.64"	"54.22"
"35265"	"False"	"High"	"[K].ILPQYIFNSR.[D]"	""	"0.00933004"	"0.0007621"	"1"	"1"	"3"	"Q05D44"	"Q05D44 [1092-1101]"	""	"0"	"1250.68918"	"133.278"	"1.266"	"0.372007186706233"	""	"35.20"	"63.73"	"2.5"	"295.2"	"2.4"	"40.36"	"43.36"	"40.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006856"	"2.25"	"45.50"
"2156"	"False"	"High"	"[R].ALGFMYIR.[Y]"	"1xOxidation [M5]"	"0.0280885"	"0.0007621"	"1"	"1"	"7"	"Q80SY5"	"Q80SY5 [160-167]"	""	"0"	"986.51280"	"328.292"	"5.806"	"0.925138005747468"	"0.906515362333117"	"14.29"	"57.37"	"0.9"	"294.0"	"5.1"	"50.61"	"31.93"	"30.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0006486"	"0.001887"	"2.06"	"41.77"
"35210"	"False"	"High"	"[R].IIPGFMCQGGDFTR.[H]"	"1xCarbamidomethyl [C7]; 1xOxidation [M6]"	"0.00904624"	"0.0007621"	"1"	"1"	"18"	"P17742"	"P17742 [56-69]"	""	"0"	"1614.74031"	"399.145"	"6.503"	"0.859982103652044"	"0.906515362333117"	"102.13"	"91.83"	"0.6"	"295.8"	"3.6"	"82.75"	"62.28"	"18.76"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006666"	"1.84"	"41.56"
"18692"	"False"	"High"	"[K].FSLFAGGMLR.[V]"	"1xOxidation [M8]"	"0.00478562"	"0.0007621"	"1"	"1"	"12"	"Q99KF1"	"Q99KF1 [129-138]"	""	"0"	"1114.57138"	"206.384"	"2.833"	"0.925138005747468"	"0.906515362333117"	"32.72"	"21.01"	"1.4"	"294.7"	"3.9"	"66.77"	"36.33"	"12.61"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003743"	"2.81"	"48.15"
"18681"	"False"	"High"	"[R].FSKSADER.[Q]"	"1xBiotin [K3]"	"0.0294977"	"0.0007621"	"1"	"2"	"1"	"Q9R049"	"Q9R049 [571-578]"	"Q9R049 1xBiotin [K573]"	"1"	"1165.53063"	"0.270"	"0.503"	"0.0532146089960603"	"0.906515362333117"	"109.70"	"121.26"	"187.4"	"42.1"	"70.5"	"74.01"	"43.08"	"67.72"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.00198"	"1.87"	"29.40"
"1894"	"False"	"High"	"[K].AKTASLFEQR.[S]"	"1xBiotin [K2]"	"0.00655988"	"0.0007621"	"1"	"2"	"9"	"Q69ZN7-1"	"Q69ZN7-1 [1922-1931]"	"Q69ZN7-1 1xBiotin [K1923]"	"1"	"1376.69910"	"0.254"	"0.765"	"0.925138005747468"	"0.906515362333117"	"58.12"	"54.33"	"142.2"	"40.6"	"117.2"	"46.01"	"30.63"	"33.37"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004983"	"2.21"	"41.24"
"68137"	"False"	"High"	"[R].VLPAQATEYAFAFIQVPQDEDAR.[T]"	""	"0.0105568"	"0.0007621"	"1"	"1"	"2"	"Q78PY7"	"Q78PY7 [788-810]"	""	"0"	"2579.27764"	"0.759"	"1.792"	"0.925138005747468"	"0.94306020666367"	"50.73"	"40.10"	"85.1"	"68.3"	"146.7"	"25.07"	"215.33"	"40.94"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0007693"	"3.18"	"61.66"
"34896"	"False"	"High"	"[K].LILKPRPHVQ.[-]"	"1xBiotin [K4]"	"0.00794536"	"0.0007621"	"1"	"1"	"10"	"Q3UJ81-1"	"Q3UJ81-1 [116-125]"	"Q3UJ81-1 1xBiotin [K119]"	"0"	"1426.83514"	"0.064"	"0.939"	"0.000165622177427664"	"0.906515362333117"	"31.59"	"37.35"	"146.4"	"10.7"	"142.9"	"21.08"	"25.39"	"33.21"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005925"	"2.34"	"38.06"
"34458"	"False"	"High"	"[R].LLFQNLWKPR.[L]"	""	"0.00267551"	"0.0007621"	"1"	"1"	"28"	"Q8BMB3"	"Q8BMB3 [232-241]"	""	"0"	"1314.76810"	"152.341"	"3.382"	"0.925138005747468"	"0.906515362333117"	"60.19"	"57.89"	"1.9"	"290.1"	"8.0"	"43.48"	"45.07"	"35.68"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002179"	"2.67"	"51.28"
"69729"	"False"	"High"	"[K].VVKTSVVFNK.[L]"	"1xBiotin [K3]"	"0.0239508"	"0.0007621"	"1"	"1"	"4"	"Q791N7"	"Q791N7 [51-60]"	"Q791N7 1xBiotin [K53]"	"1"	"1346.75007"	"0.663"	"1.056"	"0.925138005747468"	"0.906515362333117"	"44.21"	"55.83"	"104.5"	"69.6"	"125.8"	"39.06"	"38.49"	"36.81"	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001623"	"1.96"	"40.32"
"37933"	"False"	"High"	"[R].ISEQFTAMFR.[R]"	""	"0.00558575"	"0.0007621"	"4"	"6"	"3"	"Q7TMM9; Q9D6F9; Q9ERD7; P99024"	"Q7TMM9 [381-390]; Q9D6F9 [381-390]; Q9ERD7 [381-390]; P99024 [381-390]"	""	"0"	"1229.59832"	"56.294"	"3.850"	"0.495286521064498"	"0.906515362333117"	"72.09"	"40.23"	"5.3"	"275.2"	"19.5"	"24.92"	"75.87"	"28.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0004307"	"2.35"	"47.41"
"1738"	"False"	"High"	"[K].AKEIESEEQNLVTKGPAPLGTFQVTTPQR.[K]"	"2xBiotin [K2; K14]"	"0.00515428"	"0.0007621"	"1"	"1"	"3"	"Q3U9G9"	"Q3U9G9 [187-215]"	"Q3U9G9 2xBiotin [K188; K200]"	"2"	"3620.80873"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004006"	"4.52"	""
"37943"	"False"	"High"	"[R].LSFFFDFK.[G]"	""	"0.00871703"	"0.0007621"	"1"	"1"	"15"	"P19096"	"P19096 [144-151]"	""	"0"	"1050.52949"	"190.372"	"5.219"	"0.925138005747468"	"0.906515362333117"	"36.56"	"39.76"	"1.4"	"291.0"	"7.6"	"34.50"	"20.86"	"24.81"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006461"	"2.47"	"60.40"
"34435"	"False"	"High"	"[K].LIFFYEWTIK.[L]"	""	"0.00251498"	"0.0007621"	"1"	"1"	"7"	"Q8BK64"	"Q8BK64 [77-86]"	""	"0"	"1359.73474"	"152.606"	"4.176"	"0.390636537541388"	"0.906515362333117"	"72.80"	"74.57"	"2.2"	"289.5"	"8.2"	"49.15"	"60.27"	"56.06"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002061"	"2.45"	"63.19"
"34433"	"False"	"High"	"[R].ILFFSTPK.[K]"	""	"0.0164595"	"0.0007621"	"1"	"1"	"11"	"Q9CX56"	"Q9CX56 [293-300]"	""	"0"	"952.55023"	"152.121"	"3.486"	"0.925138005747468"	"0.906515362333117"	"48.17"	"49.09"	"1.9"	"291.7"	"6.5"	"42.83"	"26.21"	"24.51"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001148"	"1.87"	"47.91"
"62792"	"False"	"High"	"[K].SVGGSFYLQSKVVR.[A]"	"1xBiotin [K11]"	"0.00346939"	"0.0007621"	"1"	"1"	"3"	"Q9CQV1"	"Q9CQV1 [87-100]"	"Q9CQV1 1xBiotin [K97]"	"1"	"1752.91015"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002777"	"3.20"	""
"18955"	"False"	"High"	"[R].FVFSLVDAMNGK.[E]"	""	"0.0171846"	"0.0007621"	"1"	"1"	"3"	"P08249"	"P08249 [258-269]"	""	"0"	"1327.67148"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0005416"	"0.001191"	"2.68"	""
"18969"	"False"	"High"	"[R].FVKVPLK.[N]"	"1xBiotin [K3]"	"0.00888012"	"0.0007621"	"1"	"1"	"36"	"P21855"	"P21855 [12-18]"	"P21855 1xBiotin [K14]"	"1"	"1056.62743"	"0.158"	"0.729"	"0.00239159342329391"	"0.906515362333117"	"44.23"	"26.92"	"164.3"	"26.7"	"109.0"	"16.86"	"80.18"	"22.41"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006554"	"2.57"	"41.92"
"34314"	"False"	"High"	"[R].ILEFFGLK.[K]"	""	"0.0145507"	"0.0007621"	"1"	"1"	"6"	"P09103"	"P09103 [303-310]"	""	"0"	"966.56588"	"247.513"	"7.166"	"0.925138005747468"	"0.906515362333117"	"78.47"	"77.40"	"1.3"	"289.9"	"8.8"	"62.33"	"45.47"	"17.27"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0003479"	"0.001024"	"2.09"	"55.14"
"37953"	"False"	"High"	"[K].LSFLYLITGNLEK.[L]"	""	"0.00620485"	"0.0007621"	"1"	"1"	"5"	"Q8CIE6"	"Q8CIE6 [703-715]"	""	"0"	"1510.85156"	"35.102"	"1.116"	"0.925138005747468"	"0.906515362333117"	"118.64"	"101.07"	"8.1"	"283.5"	"8.4"	"25.96"	"84.35"	"78.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.0004738"	"3.00"	"64.93"
"34236"	"False"	"High"	"[K].LLDMVGKVQIPIMLVGNK.[K]"	"1xBiotin [K7]"	"0.00605328"	"0.0007621"	"1"	"1"	"2"	"Q921J2"	"Q921J2 [103-120]"	"Q921J2 1xBiotin [K109]"	"1"	"2194.21603"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002312"	"0.0004622"	"2.78"	""
"1684"	"False"	"High"	"[K].AKAAALAAAAADAPQR.[N]"	"1xBiotin [K2]"	"0.011023"	"0.0007621"	"1"	"2"	"2"	"Q91ZP6"	"Q91ZP6 [167-182]"	"Q91ZP6 1xBiotin [K168]"	"1"	"1692.88500"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0007967"	"2.80"	""
"34196"	"False"	"High"	"[K].LLDFGSLSNLQVTQPTVGMNFK.[T]"	"1xOxidation [M19]"	"0.0026263"	"0.0007621"	"1"	"1"	"9"	"P63276"	"P63276 [108-129]"	""	"0"	"2425.24317"	"116.300"	"3.465"	"0.496878725339527"	"0.906515362333117"	"37.71"	"88.31"	"2.3"	"289.4"	"8.3"	"24.72"	"26.18"	"78.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000215"	"3.41"	"57.53"
"34459"	"False"	"High"	"[R].LLFQNLWKPR.[L]"	"1xBiotin [K8]"	"0.0182758"	"0.0007621"	"1"	"1"	"1"	"Q8BMB3"	"Q8BMB3 [232-241]"	"Q8BMB3 1xBiotin [K239]"	"0"	"1540.84570"	"0.736"	"1.051"	"0.925138005747468"	"0.906515362333117"	"68.72"	"40.17"	"116.7"	"69.3"	"114.0"	"36.85"	"53.57"	"20.28"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"0.0005416"	"0.001262"	"2.09"	"60.07"
"69721"	"False"	"High"	"[K].VVKQASEGPLK.[G]"	"1xBiotin [K3]"	"0.00628205"	"0.0007621"	"1"	"1"	"10"	"P16858"	"P16858 [259-269]"	"P16858 1xBiotin [K261]"	"1"	"1381.75080"	"0.104"	"0.699"	"0.0195943690629657"	"0.906515362333117"	"46.22"	"48.34"	"164.8"	"16.8"	"118.4"	"26.99"	"42.31"	"61.46"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0004803"	"2.99"	"32.82"
"2223"	"False"	"High"	"[R].AIHSWLTR.[A]"	""	"0.0106222"	"0.0007621"	"1"	"1"	"6"	"P99026"	"P99026 [132-139]"	""	"0"	"983.54213"	"328.619"	"11.067"	"0.925138005747468"	"0.906515362333117"	"50.57"	"62.07"	"0.8"	"290.0"	"9.2"	"96.25"	"35.24"	"35.34"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007704"	"1.96"	"31.62"
"68404"	"False"	"High"	"[R].VMAGKVEMTLEVLNER.[E]"	"1xBiotin [K5]"	"0.00742315"	"0.0007621"	"1"	"2"	"4"	"Q69ZN7-1"	"Q69ZN7-1 [1948-1963]"	"Q69ZN7-1 1xBiotin [K1952]"	"1"	"2045.02281"	"1.012"	"1.919"	"0.925138005747468"	"0.989845584388546"	"29.76"	"27.62"	"74.6"	"80.4"	"145.0"	"20.19"	"28.57"	"22.50"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0005581"	"2.61"	"62.41"
"69510"	"False"	"High"	"[R].VTMLFLGLHNVR.[Q]"	"1xOxidation [M3]"	"0.00502835"	"0.0007621"	"1"	"1"	"5"	"Q922B2"	"Q922B2 [476-487]"	""	"0"	"1415.78277"	"231.405"	"2.455"	"0.925138005747468"	"0.936660535922236"	"66.00"	"69.45"	"1.3"	"295.7"	"3.0"	"52.77"	"34.71"	"57.15"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0003921"	"2.20"	"42.49"
"69514"	"False"	"High"	"[KR].VTMQNLNDR.[L]"	"1xOxidation [M3]"	"0.0170791"	"0.0007621"	"2"	"8"	"1"	"P02535-1; Q61781"	"P02535-1 [146-154]; Q61781 [123-131]"	""	"0"	"1106.52588"	"1.840"	"1.484"	"0.925138005747468"	"0.929688265682494"	"63.73"	"50.73"	"67.6"	"118.4"	"114.0"	"42.39"	"236.70"	"22.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0005416"	"0.001189"	"2.47"	"15.65"
"34863"	"False"	"High"	"[R].IILGGFSQGGALSLYTALTTQQK.[L]"	""	"0.02578"	"0.0007621"	"1"	"2"	"2"	"P97823-1"	"P97823-1 [113-135]"	""	"0"	"2367.29184"	"1.494"	"2.006"	"0.925138005747468"	"0.988273606811704"	"59.89"	"80.78"	"66.7"	"99.6"	"133.7"	"31.68"	"150.70"	"70.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0006427"	"0.001733"	"2.66"	"62.53"
"18817"	"False"	"High"	"[K].FTASAGIQVVGDDLTVTNPK.[R]"	""	"0.0196762"	"0.0007621"	"1"	"1"	"4"	"P17182"	"P17182 [307-326]"	""	"0"	"2033.05496"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0005902"	"0.001351"	"3.36"	""
"37794"	"False"	"High"	"[K].IRYPENFFLLR.[G]"	""	"0.00605328"	"0.0007621"	"1"	"1"	"6"	"P62137"	"P62137 [112-122]"	""	"1"	"1467.81070"	"167.365"	"4.474"	"0.925138005747468"	"0.906515362333117"	"49.75"	"49.44"	"1.8"	"290.9"	"7.3"	"40.91"	"32.46"	"30.33"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002312"	"0.0004627"	"2.97"	"51.72"
"18848"	"False"	"High"	"[K].FTGLSKEELLK.[V]"	"1xBiotin [K]"	"0.0327265"	"0.0007621"	"1"	"2"	"4"	"P10852"	"P10852 [54-64]"	"P10852 1xBiotin [K]"	"1"	"1490.79233"	"1.076"	"0.549"	"0.998769547666767"	"0.906515362333117"	"50.80"	"65.41"	"124.3"	"112.3"	"63.4"	"43.30"	"28.45"	"56.02"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006486"	"0.002184"	"2.83"	"51.43"
"34785"	"False"	"High"	"[R].LILADALCYAHTFNPK.[V]"	"1xCarbamidomethyl [C8]"	"0.0178314"	"0.0007621"	"1"	"2"	"1"	"Q9CPY7-1"	"Q9CPY7-1 [369-384]"	""	"0"	"1846.95202"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001236"	"3.06"	""
"18807"	"False"	"High"	"[R].FSWPFR.[E]"	""	"0.0349975"	"0.0007621"	"1"	"2"	"16"	"Q9Z277"	"Q9Z277 [1356-1361]"	""	"0"	"839.41989"	"106.827"	"2.852"	"0.944967096116098"	"0.916215054610739"	"86.30"	"92.73"	"2.6"	"289.6"	"7.8"	"74.02"	"17.26"	"65.31"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002349"	"1.76"	"50.82"
"34637"	"False"	"High"	"[K].LLHGGVAISSKGTPLELVNGDGVDNEIR.[C]"	"1xBiotin [K11]"	"0.00531614"	"0.0007621"	"1"	"2"	"2"	"Q8BKC8-1"	"Q8BKC8-1 [61-88]"	"Q8BKC8-1 1xBiotin [K71]"	"1"	"3086.59391"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004113"	"4.35"	""
"34633"	"False"	"High"	"[K].LLHESHLKDLTK.[N]"	"1xBiotin [K12]"	"0.00399983"	"0.0007621"	"1"	"2"	"7"	"Q6P9J9"	"Q6P9J9 [878-889]"	"Q6P9J9 1xBiotin [K889]"	"1"	"1659.88869"	"0.225"	"0.933"	"0.490302156448734"	"0.906515362333117"	"47.98"	"66.65"	"141.7"	"32.5"	"125.8"	"46.00"	"32.40"	"54.77"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003175"	"3.49"	"36.43"
"34625"	"False"	"High"	"[R].LLGWIQNK.[ILV]"	""	"0.00904624"	"0.0007621"	"2"	"4"	"11"	"Q80X90; Q8BTM8"	"Q80X90 [145-152]; Q8BTM8 [172-179]"	""	"0"	"971.56728"	"136.830"	"4.378"	"0.925138005747468"	"0.906515362333117"	"57.48"	"52.41"	"1.8"	"289.7"	"8.5"	"50.27"	"26.53"	"20.78"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006655"	"2.11"	"41.97"
"37840"	"False"	"High"	"[K].ISATSIFFESMPYK.[V]"	""	"0.002594"	"0.0007621"	"1"	"1"	"2"	"P50431"	"P50431 [154-167]"	""	"0"	"1620.79781"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002121"	"3.30"	""
"37846"	"False"	"High"	"[R].LSAYVSYGGLLMR.[L]"	""	"0.0200426"	"0.0007621"	"1"	"1"	"5"	"Q923G2"	"Q923G2 [112-124]"	""	"0"	"1429.75080"	"0.945"	"1.245"	"0.925138005747468"	"0.906515362333117"	"73.67"	"87.44"	"109.4"	"97.5"	"93.1"	"40.98"	"207.36"	"68.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0005902"	"0.001375"	"2.28"	"50.64"
"18947"	"False"	"High"	"[K].FVETSPSGLDPNASVYQPLKK.[-]"	"1xBiotin [K]"	"0.0059054"	"0.0007621"	"1"	"1"	"5"	"Q7TQE6"	"Q7TQE6 [644-664]"	"Q7TQE6 1xBiotin [K]"	"1"	"2503.25374"	"0.718"	"0.644"	"0.925138005747468"	"0.906515362333117"	"42.20"	"54.00"	"121.6"	"94.7"	"83.7"	"34.00"	"28.10"	"50.51"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004533"	"4.79"	"48.07"
"69603"	"False"	"High"	"[R].VVALFYFASK.[L]"	""	"0.004308"	"0.0007621"	"1"	"1"	"9"	"Q07813-1"	"Q07813-1 [110-119]"	""	"0"	"1144.64011"	"83.030"	"0.730"	"0.461454191032477"	"0.906515362333117"	"68.30"	"83.65"	"3.6"	"293.8"	"2.6"	"10.75"	"50.24"	"87.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003399"	"2.68"	"54.39"
"69667"	"False"	"High"	"[R].VVFGLFGK.[T]"	""	"0.0113686"	"0.0007621"	"1"	"1"	"14"	"P24369"	"P24369 [60-67]"	""	"0"	"866.51345"	"151.462"	"4.180"	"0.925138005747468"	"0.906515362333117"	"49.14"	"39.67"	"1.7"	"291.4"	"6.9"	"39.12"	"40.73"	"25.80"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008201"	"2.22"	"49.66"
"68127"	"False"	"High"	"[K].VLNPPGGKSSLSFY.[-]"	"1xBiotin [K8]"	"0.0243957"	"0.0007621"	"1"	"1"	"4"	"Q6PGH2"	"Q6PGH2 [177-190]"	"Q6PGH2 1xBiotin [K184]"	"1"	"1691.84615"	"0.186"	"0.616"	"0.925138005747468"	"0.906515362333117"	"38.37"	"56.68"	"171.2"	"29.0"	"99.8"	"27.33"	"45.41"	"52.50"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001651"	"3.09"	"54.74"
"18560"	"False"	"High"	"[K].FRPSIAYFPQIVSVAAR.[M]"	""	"0.0161581"	"0.0007621"	"1"	"1"	"2"	"P85094"	"P85094 [27-43]"	""	"0"	"1922.06468"	"70.929"	"2.822"	"0.808990690679718"	"0.906515362333117"	"60.73"	"53.17"	"3.8"	"285.1"	"11.0"	"35.92"	"70.59"	"53.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0005064"	"0.001131"	"3.22"	"54.47"
"69300"	"False"	"High"	"[K].VSQMAQYFEPLTLAAVGAASK.[T]"	""	"0.00770359"	"0.0007621"	"1"	"1"	"1"	"P26039"	"P26039 [1731-1751]"	""	"0"	"2182.12127"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0005758"	"2.88"	""
"18537"	"False"	"High"	"[K].FREWHHFLVVNMK.[G]"	"1xOxidation [M12]"	"0.0214446"	"0.0007621"	"1"	"1"	"3"	"P70296"	"P70296 [81-93]"	""	"1"	"1758.88969"	"138.981"	"1.056"	"0.358541541706145"	""	"57.09"	"65.25"	"2.0"	"296.3"	"1.7"	"45.59"	"47.89"	"44.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000628"	"0.001461"	"2.37"	"39.02"
"18361"	"False"	"High"	"[R].FPLFGGWK.[T]"	""	"0.00304672"	"0.0007621"	"1"	"1"	"51"	"Q91YQ5"	"Q91YQ5 [321-328]"	""	"0"	"951.50870"	"93.197"	"2.363"	"0.952905080717326"	"0.906515362333117"	"32.87"	"28.28"	"3.1"	"289.7"	"7.2"	"14.86"	"47.57"	"30.51"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002472"	"2.33"	"54.12"
"18378"	"False"	"High"	"[R].FPNQNQTKNCWQNYLDFHR.[C]"	"1xBiotin [K8]; 1xCarbamidomethyl [C10]"	"0.00814421"	"0.0007621"	"1"	"1"	"1"	"P56391"	"P56391 [21-39]"	"P56391 1xBiotin [K28]"	"1"	"2736.21943"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0006075"	"2.90"	""
"2025"	"False"	"High"	"[K].ALDGLWHFR.[A]"	""	"0.00702147"	"0.0007621"	"1"	"1"	"6"	"P12265"	"P12265 [40-48]"	""	"0"	"1114.57924"	"133.153"	"3.963"	"0.423976448584242"	"0.906515362333117"	"69.93"	"79.02"	"2.0"	"287.3"	"10.8"	"58.29"	"48.28"	"37.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"0.0002502"	"0.0005297"	"2.49"	"46.69"
"18380"	"False"	"High"	"[R].FPNVVKGEK.[I]"	"1xBiotin [K6]"	"0.00904624"	"0.0007621"	"1"	"1"	"10"	"Q9JHJ0"	"Q9JHJ0 [164-172]"	"Q9JHJ0 1xBiotin [K169]"	"1"	"1243.65035"	"0.159"	"0.536"	"0.00949190333671434"	"0.906515362333117"	"40.14"	"41.98"	"164.0"	"30.6"	"105.4"	"34.12"	"22.97"	"30.39"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0006675"	"2.82"	"39.44"
"36453"	"False"	"High"	"[R].LNQLKPGLQYK.[L]"	"1xBiotin [K5]"	"0.00860997"	"0.0007621"	"1"	"3"	"9"	"Q9Z1X4"	"Q9Z1X4 [409-419]"	"Q9Z1X4 1xBiotin [K413]"	"0"	"1527.83520"	"0.187"	"0.592"	"0.925138005747468"	"0.906515362333117"	"58.91"	"56.62"	"165.6"	"34.3"	"100.0"	"21.75"	"46.16"	"43.18"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0006373"	"3.16"	"41.88"
"37037"	"False"	"High"	"[R].LPYDASKWEFAR.[E]"	"1xBiotin [K7]"	"0.00324116"	"0.0007621"	"1"	"1"	"3"	"P35969"	"P35969 [814-825]"	"P35969 1xBiotin [K820]"	"1"	"1708.81519"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002603"	"2.70"	""
"18160"	"False"	"High"	"[K].FMHNQFLKLK.[K]"	"1xBiotin [K8]"	"0.00475612"	"0.0007621"	"1"	"3"	"9"	"Q80U28"	"Q80U28 [1566-1575]"	"Q80U28 1xBiotin [K1573]"	"1"	"1531.79122"	"0.273"	"0.976"	"0.925138005747468"	"0.919063063983313"	"45.96"	"33.75"	"130.5"	"37.4"	"132.2"	"63.26"	"28.34"	"51.31"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003723"	"3.65"	"44.63"
"68651"	"False"	"High"	"[K].VPAGPKTLK.[K]"	"1xBiotin [K6]"	"0.0218436"	"0.0007621"	"1"	"1"	"5"	"P14148"	"P14148 [22-30]"	"P14148 1xBiotin [K27]"	"1"	"1136.64963"	"0.132"	"0.662"	"0.0597194200044478"	"0.906515362333117"	"59.94"	"59.17"	"154.6"	"24.7"	"120.7"	"45.85"	"31.58"	"36.23"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.000628"	"0.001489"	"2.46"	"33.21"
"36374"	"False"	"High"	"[R].LNLKGQK.[L]"	"1xBiotin [K4]"	"0.0335352"	"0.0007621"	"1"	"2"	"7"	"A2A8U2-1"	"A2A8U2-1 [533-539]"	"A2A8U2-1 1xBiotin [K536]"	"1"	"1026.57646"	"0.090"	"0.673"	"0.255086021930325"	"0.906515362333117"	"69.32"	"38.21"	"168.2"	"14.6"	"117.2"	"29.50"	"59.49"	"39.31"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002245"	"2.44"	"34.26"
"36364"	"False"	"High"	"[K].LNLGTVGFYR.[T]"	""	"0.0147313"	"0.0007621"	"1"	"1"	"8"	"Q11011"	"Q11011 [582-591]"	""	"0"	"1139.62077"	"55.148"	"1.683"	"0.929016530787821"	"0.981711763869624"	"38.29"	"38.01"	"5.2"	"286.2"	"8.6"	"37.88"	"37.25"	"54.20"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.00104"	"2.30"	"45.64"
"1946"	"False"	"High"	"[K].AIACLLFGGSR.[K]"	"1xCarbamidomethyl [C4]"	"0.0101728"	"0.0007621"	"1"	"1"	"4"	"P49718"	"P49718 [351-361]"	""	"0"	"1164.61939"	"50.793"	"1.809"	"0.925138005747468"	"0.981281916820826"	"37.06"	"46.97"	"5.8"	"284.3"	"9.9"	"35.04"	"24.35"	"33.46"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0007409"	"2.48"	"48.43"
"1938"	"False"	"High"	"[K].ALAAAGYDVEKNNSR.[I]"	"1xBiotin [K11]"	"0.0246969"	"0.0007621"	"2"	"4"	"1"	"P15864; P43277"	"P15864 [65-79]; P43277 [66-80]"	"P15864 1xBiotin [K75]; P43277 1xBiotin [K76]"	"1"	"1804.86466"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001671"	"2.62"	""
"36285"	"False"	"High"	"[K].LNFAVASR.[K]"	""	"0.00809403"	"0.0007621"	"1"	"1"	"12"	"P27773"	"P27773 [297-304]"	""	"0"	"877.48903"	"317.199"	"10.525"	"0.925138005747468"	"0.906515362333117"	"101.43"	"109.13"	"1.1"	"289.7"	"9.2"	"82.80"	"65.77"	"72.03"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006018"	"2.45"	"32.73"
"1916"	"False"	"High"	"[R].AKVNVNLLIFLLNK.[K]"	""	"0.00632101"	"0.0007621"	"1"	"1"	"3"	"Q9JKF1"	"Q9JKF1 [1639-1652]"	""	"1"	"1598.99922"	"9.537"	"1.279"	"0.925138005747468"	"0.906515362333117"	"170.92"	"75.03"	"36.0"	"222.1"	"42.0"	"44.89"	"149.59"	"60.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0004817"	"2.68"	"61.19"
"18478"	"False"	"High"	"[R].FQLTDSQIYEVLSVIR.[D]"	""	"0.0173976"	"0.0007621"	"1"	"1"	"2"	"O08553"	"O08553 [174-189]"	""	"0"	"1911.02220"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0005416"	"0.001204"	"2.25"	""
"18278"	"False"	"High"	"[R].FNPNFYR.[N]"	""	"0.0289613"	"0.0007621"	"1"	"1"	"11"	"Q3UE37"	"Q3UE37 [179-185]"	""	"0"	"957.45773"	"459.221"	"10.793"	"0.925138005747468"	"0.906515362333117"	"71.46"	"70.40"	"0.5"	"293.1"	"6.3"	"80.66"	"42.66"	"36.38"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001935"	"1.93"	"35.01"
"68633"	"False"	"High"	"[K].VNTSSALANISLALEQGCAVTLLK.[A]"	"1xCarbamidomethyl [C18]"	"0.0306"	"0.0007621"	"1"	"1"	"2"	"Q9JKF1"	"Q9JKF1 [303-326]"	""	"0"	"2473.33305"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002043"	"4.27"	""
"18161"	"False"	"High"	"[K].FMHNQFLKLK.[K]"	"1xBiotin [K8]; 1xOxidation [M2]"	"0.00775135"	"0.0007621"	"1"	"3"	"1"	"Q80U28"	"Q80U28 [1566-1575]"	"Q80U28 1xBiotin [K1573]"	"1"	"1547.78614"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0005794"	"1.95"	""
"18273"	"False"	"High"	"[R].FNNFSLNLNTNHGHILVDYSK.[N]"	""	"0.00845184"	"0.0007621"	"1"	"1"	"2"	"P06745"	"P06745 [37-57]"	""	"0"	"2447.21023"	"130.953"	"3.448"	"0.430383505746853"	"0.906515362333117"	"36.78"	"91.31"	"2.3"	"291.9"	"5.8"	"41.20"	"28.89"	"78.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0006273"	"2.36"	"45.95"
"36766"	"False"	"High"	"[K].LPLKPNDLKTR.[S]"	"1xBiotin [K9]"	"0.0154759"	"0.0007621"	"1"	"1"	"4"	"Q6P9J9"	"Q6P9J9 [146-156]"	"Q6P9J9 1xBiotin [K154]"	"1"	"1520.86174"	"0.292"	"0.856"	"0.925138005747468"	"0.906515362333117"	"73.80"	"81.93"	"157.2"	"42.3"	"100.5"	"61.71"	"41.64"	"68.60"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.000459"	"0.001087"	"2.62"	"37.71"
"68405"	"False"	"High"	"[R].VMAGKVEMTLEVLNER.[E]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.0179415"	"0.0007621"	"1"	"2"	"2"	"Q69ZN7-1"	"Q69ZN7-1 [1948-1963]"	"Q69ZN7-1 1xBiotin [K1952]"	"1"	"2061.01773"	"0.952"	"1.197"	"0.925138005747468"	"0.906515362333117"	"47.73"	"45.07"	"98.2"	"93.4"	"108.4"	"35.49"	"27.46"	"33.00"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001242"	"3.22"	"59.09"
"68468"	"False"	"High"	"[R].VMLYPSR.[I]"	"1xOxidation [M2]"	"0.0146407"	"0.0007621"	"1"	"1"	"21"	"O55142"	"O55142 [103-109]"	""	"0"	"881.45495"	"167.728"	"2.677"	"0.925138005747468"	"0.906515362333117"	"68.37"	"75.05"	"1.5"	"293.6"	"4.9"	"60.47"	"47.66"	"40.43"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001032"	"1.78"	"26.30"
"36735"	"False"	"High"	"[R].IPKPQHKVR.[G]"	"1xBiotin [K7]"	"0.0148224"	"0.0007621"	"1"	"2"	"10"	"Q8VCW4"	"Q8VCW4 [529-537]"	"Q8VCW4 1xBiotin [K535]"	"1"	"1328.76197"	"0.013"	"0.701"	"1.31206395738466E-05"	"0.906515362333117"	"56.01"	"52.94"	"179.6"	"2.2"	"118.1"	"44.87"	"31.98"	"26.97"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001045"	"1.97"	"22.37"
"2132"	"False"	"High"	"[K].AIFQAIAAK.[V]"	""	"0.0287847"	"0.0007621"	"1"	"1"	"8"	"Q9DCD0"	"Q9DCD0 [155-163]"	""	"0"	"932.55638"	"144.828"	"2.393"	"0.300459330130616"	"0.948249642291837"	"53.84"	"106.49"	"2.2"	"291.7"	"6.1"	"35.02"	"45.02"	"67.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0006486"	"0.001934"	"1.41"	"37.05"
"68516"	"False"	"High"	"[K].VNCSFYFK.[I]"	"1xCarbamidomethyl [C3]"	"0.0202906"	"0.0007621"	"1"	"5"	"11"	"Q9D883"	"Q9D883 [16-23]"	""	"0"	"1064.48698"	"214.954"	"5.998"	"0.925138005747468"	"0.906515362333117"	"70.00"	"74.18"	"1.6"	"287.6"	"10.7"	"58.40"	"34.00"	"23.28"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000628"	"0.001385"	"2.15"	"37.47"
"36698"	"False"	"High"	"[K].LPGPTVSASYSLEYGKAELEIQKDALEPGQR.[V]"	""	"0.00655988"	"0.0007621"	"1"	"1"	"1"	"P08030"	"P08030 [92-122]"	""	"2"	"3346.71653"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0004994"	"3.64"	""
"36230"	"False"	"High"	"[K].LNAFGNAFLNR.[F]"	""	"0.00660056"	"0.0007621"	"1"	"2"	"3"	"Q9QXY6"	"Q9QXY6 [125-135]"	""	"0"	"1236.64838"	"96.319"	"2.067"	"0.478597253695619"	"0.998316466510713"	"43.52"	"66.37"	"2.8"	"290.7"	"6.5"	"31.52"	"29.29"	"39.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005017"	"2.45"	"45.78"
"68519"	"False"	"High"	"[K].VNDKSVGGSFYLQSK.[V]"	"1xBiotin [K4]"	"0.00809403"	"0.0007621"	"1"	"1"	"1"	"Q9CQV1"	"Q9CQV1 [83-97]"	"Q9CQV1 1xBiotin [K86]"	"1"	"1854.90546"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0006042"	"2.65"	""
"36950"	"False"	"High"	"[R].LPTALWSGGR.[D]"	""	"0.0323294"	"0.0007621"	"1"	"1"	"4"	"Q9Z0M5"	"Q9Z0M5 [333-342]"	""	"0"	"1057.57890"	"122.550"	"2.836"	"0.435515251674893"	"0.906515362333117"	"64.09"	"71.71"	"2.3"	"290.4"	"7.3"	"55.09"	"37.85"	"49.67"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002162"	"2.63"	"41.24"
"36666"	"False"	"High"	"[R].IPFLLSGTSYK.[D]"	""	"0.00534912"	"0.0007621"	"1"	"1"	"10"	"Q99JY0"	"Q99JY0 [63-73]"	""	"0"	"1225.68270"	"153.803"	"3.943"	"0.925138005747468"	"0.906515362333117"	"71.58"	"84.47"	"2.0"	"290.9"	"7.1"	"65.50"	"26.24"	"40.81"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0004141"	"2.63"	"49.33"
"36634"	"False"	"High"	"[R].LPEFSFEKR.[Q]"	"1xBiotin [K8]"	"0.012783"	"0.0007621"	"1"	"1"	"4"	"Q7TQ95"	"Q7TQ95 [312-320]"	"Q7TQ95 1xBiotin [K319]"	"1"	"1378.68238"	"0.132"	"0.760"	"0.0109606866535761"	"0.906515362333117"	"52.00"	"44.57"	"154.5"	"26.1"	"119.4"	"36.23"	"30.75"	"49.01"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009121"	"2.22"	"50.36"
"36629"	"False"	"High"	"[K].IPDWFLNR.[Q]"	""	"0.00668268"	"0.0007621"	"1"	"1"	"18"	"P62270"	"P62270 [79-86]"	""	"0"	"1060.55744"	"155.911"	"4.059"	"0.925138005747468"	"0.906515362333117"	"45.49"	"65.42"	"1.9"	"290.0"	"8.1"	"38.51"	"60.80"	"59.35"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005059"	"2.08"	"50.51"
"36616"	"False"	"High"	"[K].LPDLKDAEAVQK.[F]"	"1xBiotin [K5]"	"0.0323294"	"0.0007621"	"1"	"1"	"4"	"Q9DCC8"	"Q9DCC8 [57-68]"	"Q9DCC8 1xBiotin [K61]"	"1"	"1552.80395"	"0.491"	"0.563"	"0.925138005747468"	"0.906515362333117"	"71.04"	"75.64"	"141.9"	"88.0"	"70.1"	"54.60"	"44.05"	"72.49"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0006486"	"0.002164"	"2.39"	"43.02"
"36972"	"False"	"High"	"[R].IPTRPFEEGKK.[I]"	"1xBiotin [K10]"	"0.00275957"	"0.0007621"	"1"	"2"	"12"	"Q99JX3"	"Q99JX3 [202-212]"	"Q99JX3 1xBiotin [K211]"	"1"	"1527.79881"	"0.461"	"0.824"	"0.0146989053743178"	"0.906515362333117"	"46.32"	"39.13"	"131.8"	"60.8"	"107.5"	"26.35"	"57.46"	"25.64"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002242"	"2.92"	"33.89"
"36595"	"False"	"High"	"[R].LPAYLTIQMVR.[F]"	""	"0.00756207"	"0.0007621"	"1"	"1"	"2"	"Q9JMA1"	"Q9JMA1 [320-330]"	""	"0"	"1304.73950"	"2.623"	"2.981"	"0.925138005747468"	"0.906515362333117"	"93.08"	"93.78"	"43.5"	"98.8"	"157.7"	"58.62"	"147.81"	"60.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0005675"	"2.25"	"51.08"
"36860"	"False"	"High"	"[K].LPPPKPLPGTLKR.[R]"	"1xBiotin [K12]"	"0.0144613"	"0.0007621"	"1"	"1"	"6"	"O35598"	"O35598 [711-723]"	"O35598 1xBiotin [K722]"	"1"	"1639.97163"	"8.359"	"0.585"	"0.69705377790346"	"0.906515362333117"	"85.69"	"42.90"	"27.7"	"254.9"	"17.4"	"35.70"	"79.61"	"40.22"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.001022"	"2.42"	"37.69"
"68316"	"False"	"High"	"[K].VISTTKAPAAIGPYSQAVQVDR.[T]"	"1xBiotin [K6]"	"0.00794536"	"0.0007621"	"1"	"1"	"1"	"P52760"	"P52760 [8-29]"	"P52760 1xBiotin [K13]"	"1"	"2498.30717"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005935"	"2.67"	""
"68899"	"False"	"High"	"[K].VQGVGSKGWR.[D]"	"1xBiotin [K7]"	"0.002594"	"0.0007621"	"1"	"1"	"17"	"Q9EPJ9"	"Q9EPJ9 [279-288]"	"Q9EPJ9 1xBiotin [K285]"	"1"	"1299.66265"	"0.048"	"0.857"	"6.49983793219649E-05"	"0.906515362333117"	"46.90"	"34.89"	"158.1"	"8.0"	"133.9"	"28.33"	"35.97"	"27.74"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002122"	"3.12"	"37.38"
"36220"	"False"	"High"	"[R].LMWSKYPLDVQK.[E]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.00369078"	"0.0007621"	"1"	"1"	"9"	"Q7TPE5"	"Q7TPE5 [282-293]"	"Q7TPE5 1xBiotin [K286]"	"1"	"1749.87026"	"0.588"	"0.652"	"0.925138005747468"	"0.906515362333117"	"79.08"	"66.57"	"120.6"	"87.5"	"91.8"	"53.54"	"49.52"	"44.40"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002951"	"2.32"	"51.68"
"18156"	"False"	"High"	"[R].FMGKGVSQAVEHINK.[T]"	"1xBiotin [K4]"	"0.0228031"	"0.0007621"	"1"	"1"	"3"	"P17182"	"P17182 [57-71]"	"P17182 1xBiotin [K60]"	"1"	"1870.93023"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001547"	"2.02"	""
"69169"	"False"	"High"	"[R].VSFCPLSLWR.[W]"	"1xCarbamidomethyl [C4]"	"0.00986342"	"0.0007621"	"1"	"1"	"6"	"Q8VBZ3"	"Q8VBZ3 [305-314]"	""	"0"	"1264.65069"	"62.774"	"1.825"	"0.925138005747468"	"0.998099211977233"	"42.90"	"50.82"	"4.7"	"285.3"	"10.0"	"29.31"	"37.44"	"36.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000723"	"2.04"	"58.36"
"69171"	"False"	"High"	"[R].VSFELFADK.[V]"	""	"0.0154759"	"0.0007621"	"1"	"1"	"1"	"P17742"	"P17742 [20-28]"	""	"0"	"1055.54079"	"116.919"	"1.533"	"0.382283135501357"	"0.916215054610739"	"60.05"	"89.23"	"3.6"	"292.0"	"4.4"	"53.87"	"70.44"	"65.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000459"	"0.001084"	"1.72"	"48.23"
"18512"	"False"	"High"	"[R].FQVHQQKGSK.[A]"	"1xBiotin [K]"	"0.00986342"	"0.0007621"	"1"	"1"	"3"	"Q9WUQ2"	"Q9WUQ2 [95-104]"	"Q9WUQ2 1xBiotin [K]"	"1"	"1412.71033"	"0.129"	"0.831"	"0.0584351270900306"	"0.906515362333117"	"47.16"	"59.33"	"161.7"	"20.8"	"117.5"	"40.06"	"19.59"	"53.93"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0007217"	"2.95"	"24.77"
"37269"	"False"	"High"	"[K].IQKLLQDFFNGK.[E]"	"1xBiotin [K3]"	"0.00565525"	"0.0007621"	"1"	"2"	"3"	"P63017"	"P63017 [346-357]"	"P63017 1xBiotin [K348]"	"1"	"1676.88287"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0004361"	"2.63"	""
"35838"	"False"	"High"	"[KR].ILWQFLK.[VE]"	""	"0.027409"	"0.0007621"	"1"	"3"	"13"	"P54071"	"P54071 [61-67]"	""	"0"	"947.57130"	"122.092"	"3.759"	"0.925138005747468"	"0.906515362333117"	"63.51"	"28.80"	"2.8"	"287.0"	"10.2"	"27.72"	"49.81"	"26.57"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001839"	"1.44"	"51.57"
"69177"	"False"	"High"	"[R].VSFYQLSHFLQCK.[E]"	"1xCarbamidomethyl [C12]"	"0.00509093"	"0.0007621"	"1"	"2"	"7"	"O55143-1"	"O55143-1 [864-876]"	""	"0"	"1656.82027"	"69.418"	"1.405"	"0.925138005747468"	"0.937072062058245"	"48.76"	"84.31"	"4.3"	"289.9"	"5.8"	"31.50"	"55.74"	"96.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003955"	"2.43"	"54.35"
"35854"	"False"	"High"	"[R].LLYGFLVR.[A]"	""	"0.0210529"	"0.0007621"	"1"	"1"	"8"	"P57716"	"P57716 [520-527]"	""	"0"	"980.59276"	"125.229"	"3.312"	"0.945458315571006"	"0.906515362333117"	"36.68"	"29.78"	"2.3"	"290.0"	"7.6"	"39.53"	"14.46"	"10.24"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.000628"	"0.001436"	"2.05"	"52.24"
"35828"	"False"	"High"	"[R].LLVVYPWTQR.[YF]"	""	"0.00295392"	"0.0007621"	"1"	"3"	"24"	"P02088"	"P02088 [32-41]"	""	"0"	"1274.72557"	"158.733"	"5.172"	"0.925138005747468"	"0.906515362333117"	"101.98"	"99.72"	"1.4"	"290.1"	"8.5"	"75.48"	"31.33"	"37.90"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002391"	"2.76"	"51.16"
"18515"	"False"	"High"	"[K].FQVWDLGGQTSIRPYWR.[C]"	""	"0.0300439"	"0.0007621"	"1"	"1"	"4"	"P61211"	"P61211 [63-79]"	""	"0"	"2109.06647"	"12.277"	"1.407"	"0.925138005747468"	"0.916215054610739"	"231.38"	"74.99"	"20.2"	"252.7"	"27.1"	"57.07"	"126.55"	"105.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0006486"	"0.002014"	"2.41"	"54.68"
"35731"	"False"	"High"	"[R].ILVATNLFGR.[G]"	""	"0.00452652"	"0.0007621"	"2"	"3"	"20"	"Q9Z1N5; Q8VDW0-1"	"Q9Z1N5 [340-349]; Q8VDW0-1 [339-348]"	""	"0"	"1103.65716"	"152.575"	"2.783"	"0.925138005747468"	"0.906515362333117"	"80.60"	"72.11"	"2.4"	"290.6"	"7.0"	"60.68"	"61.34"	"29.74"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003557"	"2.18"	"48.21"
"35714"	"False"	"High"	"[K].ILTTGFSR.[M]"	""	"0.0275773"	"0.0007621"	"1"	"1"	"8"	"O89053"	"O89053 [234-241]"	""	"0"	"894.50434"	"115.677"	"2.726"	"0.925158317651619"	"0.906515362333117"	"50.15"	"50.34"	"2.6"	"290.3"	"7.1"	"42.99"	"41.15"	"24.10"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.00185"	"1.82"	"30.57"
"18516"	"False"	"High"	"[K].FQWDLNAWTK.[S]"	""	"0.00676582"	"0.0007621"	"1"	"2"	"4"	"Q62318"	"Q62318 [392-401]"	""	"0"	"1308.63715"	"190.527"	"3.870"	"0.373622282101816"	"0.906515362333117"	"90.33"	"110.79"	"1.2"	"293.2"	"5.6"	"62.71"	"55.30"	"91.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.000513"	"2.26"	"54.95"
"69211"	"False"	"High"	"[RK].VSKATVLAR.[I]"	"1xBiotin [K3]"	"0.0025463"	"0.0007621"	"1"	"3"	"11"	"P13516"	"P13516 [335-343]"	"P13516 1xBiotin [K337]"	"1"	"1170.66634"	"0.013"	"0.911"	"1.23403812927718E-05"	"0.906515362333117"	"69.47"	"40.67"	"160.4"	"1.9"	"137.7"	"21.48"	"59.43"	"42.51"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000208"	"3.01"	"38.43"
"37277"	"False"	"High"	"[R].LQKQTTYSEK.[N]"	"1xBiotin [K3]"	"0.00824549"	"0.0007621"	"1"	"1"	"3"	"Q8R070"	"Q8R070 [270-279]"	"Q8R070 1xBiotin [K272]"	"1"	"1451.71989"	"0.462"	"0.757"	"0.934972688423062"	"0.906515362333117"	"77.82"	"75.82"	"123.6"	"69.0"	"107.4"	"60.37"	"43.39"	"83.98"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0002502"	"0.0006148"	"2.01"	"29.73"
"1902"	"False"	"High"	"[R].AKTPVTLK.[Q]"	"1xBiotin [K2]"	"0.011023"	"0.0007621"	"1"	"5"	"13"	"Q61029"	"Q61029 [205-212]"	"Q61029 1xBiotin [K206]"	"1"	"1083.62308"	"0.011"	"0.686"	"9.58177570709534E-06"	"0.906515362333117"	"57.67"	"42.62"	"180.9"	"1.8"	"117.3"	"34.71"	"45.35"	"28.20"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0007968"	"1.86"	"34.92"
"69188"	"False"	"High"	"[R].VSGILVKR.[N]"	"1xBiotin [K7]"	"0.012018"	"0.0007621"	"1"	"1"	"3"	"Q9QXK7"	"Q9QXK7 [481-488]"	"Q9QXK7 1xBiotin [K487]"	"1"	"1097.64996"	"0.224"	"0.917"	"0.925138005747468"	"0.906515362333117"	"54.31"	"66.66"	"136.8"	"34.7"	"128.6"	"30.60"	"51.46"	"76.82"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0003095"	"0.0008647"	"2.36"	"40.08"
"69941"	"False"	"High"	"[K].VWNLANCK.[L]"	"1xCarbamidomethyl [C7]"	"0.029139"	"0.0007621"	"1"	"1"	"6"	"P68040"	"P68040 [176-183]"	""	"0"	"1004.49821"	"158.908"	"6.196"	"0.925138005747468"	"0.906515362333117"	"47.53"	"61.73"	"1.9"	"286.2"	"11.9"	"56.88"	"36.93"	"39.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0006486"	"0.001949"	"1.68"	"33.11"
"35855"	"False"	"High"	"[R].IIYGGSVTGATCK.[E]"	"1xCarbamidomethyl [C12]"	"0.0100479"	"0.0007621"	"1"	"1"	"4"	"P17751"	"P17751 [257-269]"	""	"0"	"1326.67221"	"67.889"	"1.228"	"0.558644691043429"	""	"138.84"	"58.09"	"3.3"	"292.2"	"4.6"	"37.42"	"76.19"	"35.56"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007321"	"2.58"	"28.95"
"35871"	"False"	"High"	"[K].LIYQWVSR.[S]"	""	"0.0151924"	"0.0007621"	"1"	"2"	"6"	"Q9CQ80"	"Q9CQ80 [110-117]"	""	"0"	"1064.58874"	"215.431"	"8.066"	"0.925138005747468"	"0.906515362333117"	"87.01"	"88.12"	"1.3"	"286.5"	"12.2"	"80.49"	"41.89"	"40.48"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0004044"	"0.001069"	"1.87"	"42.52"
"36216"	"False"	"High"	"[K].LMWLFGCPLVR.[D]"	"1xCarbamidomethyl [C7]; 1xOxidation [M2]"	"0.00362292"	"0.0007621"	"1"	"1"	"18"	"Q5SUR0"	"Q5SUR0 [60-70]"	""	"0"	"1407.72756"	"136.456"	"3.381"	"0.925138005747468"	"0.906515362333117"	"55.52"	"58.16"	"2.1"	"290.5"	"7.4"	"60.30"	"27.47"	"33.71"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002889"	"2.57"	"59.28"
"37096"	"False"	"High"	"[K].LQCLKDFHK.[D]"	"1xBiotin [K5]; 1xCarbamidomethyl [C3]"	"0.00417681"	"0.0007621"	"1"	"1"	"20"	"O35316"	"O35316 [7-15]"	"O35316 1xBiotin [K11]"	"1"	"1414.69699"	"0.012"	"0.859"	"1.16364095154626E-05"	"0.906515362333117"	"45.39"	"42.34"	"159.3"	"1.9"	"138.7"	"13.84"	"210.04"	"34.27"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003293"	"3.06"	"37.45"
"18157"	"False"	"High"	"[R].FMGKGVSQAVEHINK.[T]"	"1xBiotin [K4]; 1xOxidation [M2]"	"0.017505"	"0.0007621"	"1"	"1"	"5"	"P17182"	"P17182 [57-71]"	"P17182 1xBiotin [K60]"	"1"	"1886.92515"	"0.257"	"0.906"	"0.925138005747468"	"0.906515362333117"	"32.82"	"35.14"	"143.3"	"36.2"	"120.5"	"20.55"	"27.83"	"28.68"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0005416"	"0.001214"	"2.94"	"37.76"
"18496"	"False"	"High"	"[R].FQSLGVAFYR.[G]"	""	"0.00397516"	"0.0007621"	"1"	"1"	"17"	"P51150"	"P51150 [70-79]"	""	"0"	"1187.62077"	"99.371"	"2.400"	"0.945458315571006"	"0.906515362333117"	"48.52"	"43.54"	"2.9"	"290.1"	"7.0"	"41.66"	"17.71"	"20.52"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003153"	"2.38"	"45.78"
"37221"	"False"	"High"	"[K].LQGESTKPVYIPK.[I]"	"1xBiotin [K7]"	"0.00719724"	"0.0007621"	"1"	"1"	"9"	"Q61510"	"Q61510 [313-325]"	"Q61510 1xBiotin [K319]"	"0"	"1685.89310"	"0.473"	"0.848"	"0.925138005747468"	"0.906515362333117"	"71.42"	"87.19"	"132.1"	"63.5"	"104.5"	"55.12"	"32.62"	"56.90"	""	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0002502"	"0.0005436"	"3.32"	"41.78"
"36106"	"False"	"High"	"[K].LMNFMYFQR.[N]"	"1xOxidation [M]"	"0.0134297"	"0.0007621"	"1"	"2"	"9"	"Q7TMB8-1"	"Q7TMB8-1 [122-130]"	""	"0"	"1265.58056"	"88.268"	"5.208"	"0.929016530787821"	"0.906515362333117"	"73.68"	"39.42"	"2.8"	"280.4"	"16.8"	"36.16"	"65.46"	"19.75"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009565"	"1.90"	"45.56"
"37223"	"False"	"High"	"[R].LQGFEQQWYR.[Q]"	""	"0.00487524"	"0.0007621"	"1"	"1"	"2"	"P12265"	"P12265 [56-65]"	""	"0"	"1354.65386"	"196.339"	"5.139"	"0.925138005747468"	"0.906515362333117"	"45.02"	"49.11"	"1.5"	"290.5"	"8.1"	"42.01"	"43.70"	"46.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.000381"	"2.51"	"42.80"
"37260"	"False"	"High"	"[K].IQKENPK.[V]"	"1xBiotin [K3]"	"0.0222498"	"0.0007621"	"1"	"1"	"17"	"Q9CQB5"	"Q9CQB5 [75-81]"	"Q9CQB5 1xBiotin [K77]"	"1"	"1082.56629"	"0.132"	"0.763"	"0.0084414679966702"	"0.906515362333117"	"41.76"	"42.79"	"157.8"	"22.7"	"119.5"	"39.51"	"20.30"	"23.52"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001515"	"2.21"	"24.38"
"36105"	"False"	"High"	"[K].LMNFMYFQR.[N]"	""	"0.00334298"	"0.0007621"	"1"	"2"	"6"	"Q7TMB8-1"	"Q7TMB8-1 [122-130]"	""	"0"	"1249.58565"	"24.998"	"4.882"	"0.780138739760663"	"0.906515362333117"	"144.11"	"38.59"	"9.8"	"245.7"	"44.5"	"27.48"	"100.57"	"26.00"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002691"	"2.93"	"52.19"
"36064"	"False"	"High"	"[K].LMLLLEVISGER.[L]"	"1xOxidation [M2]"	"0.0176131"	"0.0007621"	"1"	"4"	"1"	"P57780"	"P57780 [85-96]"	""	"0"	"1388.78176"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001222"	"2.68"	""
"36063"	"False"	"High"	"[K].LMLLLEVISGER.[L]"	""	"0.00308465"	"0.0007621"	"1"	"4"	"1"	"P57780"	"P57780 [85-96]"	""	"0"	"1372.78685"	"1.231"	"0.978"	"0.925138005747468"	"0.906515362333117"	"93.95"	"81.38"	"135.9"	"68.9"	"95.2"	"48.98"	"213.43"	"58.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002487"	"2.79"	"65.27"
"36019"	"False"	"High"	"[R].IMKAQALR.[D]"	"1xBiotin [K3]; 1xOxidation [M2]"	"0.00576114"	"0.0007621"	"2"	"2"	"7"	"P07901; P11499"	"P07901 [614-621]; P11499 [605-612]"	"P07901 1xBiotin [K616]; P11499 1xBiotin [K607]"	"1"	"1172.62785"	"0.136"	"0.668"	"0.0962567248290447"	"0.906515362333117"	"49.39"	"63.42"	"166.8"	"20.3"	"112.8"	"24.16"	"40.61"	"69.45"	"NotUnique"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0002312"	"0.0004443"	"2.72"	"33.44"
"36018"	"False"	"High"	"[R].IMKAQALR.[D]"	"1xBiotin [K3]"	"0.00950455"	"0.0007621"	"2"	"2"	"7"	"P07901; P11499"	"P07901 [614-621]; P11499 [605-612]"	"P07901 1xBiotin [K616]; P11499 1xBiotin [K607]"	"1"	"1156.63293"	"0.142"	"1.099"	"0.010309577665438"	"0.909223670800027"	"47.79"	"36.94"	"131.2"	"17.9"	"150.9"	"29.00"	"37.11"	"18.33"	"NotUnique"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006987"	"2.75"	"36.56"
"68976"	"False"	"High"	"[K].VQSLQATFGTFESLLR.[N]"	""	"0.0116528"	"0.0007621"	"1"	"1"	"2"	"Q8BMK4"	"Q8BMK4 [141-156]"	""	"0"	"1796.95412"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0008408"	"2.59"	""
"35893"	"False"	"High"	"[R].LMAKMGFR.[E]"	"1xBiotin [K4]; 1xOxidation [M]"	"0.0126262"	"0.0007621"	"1"	"1"	"11"	"Q9DBC3"	"Q9DBC3 [93-100]"	"Q9DBC3 1xBiotin [K96]"	"1"	"1195.57845"	"0.113"	"1.023"	"0.00349955824316297"	"0.906515362333117"	"54.07"	"46.66"	"148.5"	"13.0"	"138.5"	"49.90"	"37.12"	"31.32"	""	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0003479"	"0.0009026"	"1.92"	"40.98"
"1910"	"False"	"High"	"[R].AKVEFNIR.[K]"	"1xBiotin [K2]"	"0.00643934"	"0.0007621"	"1"	"3"	"2"	"Q9CY58"	"Q9CY58 [301-308]"	"Q9CY58 1xBiotin [K302]"	"1"	"1202.63504"	"0.076"	"0.718"	"0.00588948672466756"	"0.906515362333117"	"57.98"	"40.78"	"171.5"	"11.3"	"117.2"	"21.97"	"36.68"	"33.10"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0004903"	"2.74"	"43.25"
"36103"	"False"	"High"	"[K].LMNESLMLVTALNPHIGYDK.[A]"	"2xOxidation [M2; M7]"	"0.0238043"	"0.0007621"	"1"	"2"	"3"	"P97807-1"	"P97807-1 [445-464]"	""	"0"	"2291.14102"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001614"	"2.62"	""
"37979"	"False"	"High"	"[K].ISGKMTLK.[E]"	"1xBiotin [K4]"	"0.0211827"	"0.0007621"	"1"	"1"	"3"	"Q9DBX2"	"Q9DBX2 [115-122]"	"Q9DBX2 1xBiotin [K118]"	"1"	"1103.59515"	"9.215"	"0.984"	"0.998769547666767"	"0.906777072223237"	"100.34"	"41.09"	"24.1"	"252.5"	"23.4"	"24.52"	"81.44"	"39.41"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.000628"	"0.001447"	"2.22"	"37.25"
"34516"	"False"	"High"	"[K].ILGGSVLHLVLALR.[G]"	""	"0.00784775"	"0.0007621"	"1"	"1"	"2"	"P29595"	"P29595 [61-74]"	""	"0"	"1460.93114"	"32.071"	"2.107"	"0.925138005747468"	"0.906515362333117"	"138.52"	"62.70"	"7.5"	"275.4"	"17.1"	"60.77"	"154.08"	"48.77"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0002502"	"0.0005856"	"2.61"	"67.16"
"33266"	"False"	"High"	"[K].IGYPAPNFK.[A]"	""	"0.0157647"	"0.0007621"	"1"	"1"	"21"	"P35700"	"P35700 [8-16]"	""	"0"	"1006.53564"	"125.599"	"4.198"	"0.925138005747468"	"0.906515362333117"	"48.24"	"49.73"	"2.5"	"288.6"	"9.0"	"27.21"	"37.83"	"45.71"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001102"	"2.38"	"35.74"
"1441"	"False"	"High"	"[R].AGMIFYR.[K]"	"1xOxidation [M3]"	"0.0222498"	"0.0007621"	"1"	"1"	"6"	"P50431"	"P50431 [258-264]"	""	"0"	"873.42874"	"204.874"	"1.274"	"0.586247824331728"	""	"65.61"	"54.80"	"1.6"	"296.5"	"1.9"	"40.41"	"46.56"	"39.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001516"	"2.11"	"28.81"
"33254"	"False"	"High"	"[R].LGVWYNSFR.[A]"	""	"0.00518626"	"0.0007621"	"1"	"1"	"4"	"Q9CYH2"	"Q9CYH2 [145-153]"	""	"0"	"1141.57890"	"102.134"	"2.472"	"0.434853540501642"	"0.916215054610739"	"25.46"	"28.81"	"2.8"	"290.3"	"6.9"	"15.72"	"21.27"	"31.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0004023"	"2.01"	"47.25"
"19178"	"False"	"High"	"[K].FYSFLVLK.[K]"	""	"0.0213133"	"0.0007621"	"1"	"1"	"9"	"Q61550"	"Q61550 [601-608]"	""	"0"	"1016.58153"	"159.949"	"4.074"	"0.925138005747468"	"0.906515362333117"	"105.29"	"109.95"	"1.1"	"293.6"	"5.2"	"103.83"	"43.96"	"55.85"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000628"	"0.001456"	"1.93"	"54.34"
"19185"	"False"	"High"	"[R].FYSSFSGGFK.[G]"	""	"0.00336372"	"0.0007621"	"1"	"1"	"9"	"Q99KC8"	"Q99KC8 [621-630]"	""	"0"	"1126.52039"	"215.654"	"4.424"	"0.925138005747468"	"0.906515362333117"	"74.43"	"50.25"	"1.4"	"293.3"	"5.2"	"40.38"	"53.44"	"93.30"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002695"	"2.46"	"40.10"
"18045"	"False"	"High"	"[K].FITIFGTR.[S]"	""	"0.0343633"	"0.0007621"	"1"	"1"	"35"	"P48036"	"P48036 [192-199]"	""	"0"	"954.54073"	"145.276"	"3.688"	"0.925138005747468"	"0.906515362333117"	"45.11"	"54.68"	"2.1"	"290.1"	"7.8"	"43.49"	"28.15"	"52.81"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000686"	"0.002299"	"2.18"	"48.35"
"19192"	"False"	"High"	"[K].FYTLFGR.[S]"	""	"0.031937"	"0.0007621"	"1"	"1"	"34"	"Q8CGC7"	"Q8CGC7 [1504-1510]"	""	"0"	"903.47231"	"137.171"	"4.171"	"0.925138005747468"	"0.906515362333117"	"36.66"	"38.78"	"2.0"	"289.8"	"8.2"	"44.86"	"22.97"	"28.68"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002139"	"1.78"	"46.64"
"19193"	"False"	"High"	"[R].FYTNPIAKPIPQTPESVGNK.[N]"	"1xBiotin [K8]"	"0.0135128"	"0.0007621"	"1"	"1"	"4"	"Q6PFD9"	"Q6PFD9 [658-677]"	"Q6PFD9 1xBiotin [K665]"	"0"	"2427.23769"	"0.364"	"0.475"	"0.925138005747468"	"0.906515362333117"	"85.06"	"99.13"	"177.2"	"54.5"	"68.4"	"71.39"	"24.61"	"102.56"	""	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009575"	"2.87"	"48.21"
"33100"	"False"	"High"	"[K].IGPITPLQFYK.[E]"	""	"0.0160588"	"0.0007621"	"1"	"1"	"7"	"Q8R016"	"Q8R016 [245-255]"	""	"0"	"1276.72999"	"0.287"	"0.797"	"0.00656101443062286"	"0.906515362333117"	"534.28"	"30.77"	"137.7"	"46.3"	"116.0"	"25.89"	"109.68"	"19.69"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0005064"	"0.00112"	"2.19"	"50.59"
"1429"	"False"	"High"	"[K].AGIPVFAWK.[G]"	""	"0.0112986"	"0.0007621"	"1"	"1"	"13"	"P50247"	"P50247 [95-103]"	""	"0"	"988.56146"	"147.267"	"3.892"	"0.925138005747468"	"0.906515362333117"	"38.44"	"53.95"	"2.0"	"290.0"	"8.0"	"45.22"	"41.47"	"34.70"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0008137"	"2.19"	"50.55"
"33076"	"False"	"High"	"[R].IGNSYFK.[E]"	""	"0.0277467"	"0.0007621"	"1"	"1"	"13"	"Q60864"	"Q60864 [306-312]"	""	"0"	"828.42503"	"163.064"	"5.115"	"0.925138005747468"	"0.906515362333117"	"83.99"	"90.82"	"1.3"	"287.9"	"10.8"	"78.37"	"53.42"	"48.90"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001858"	"2.53"	"27.88"
"18037"	"False"	"High"	"[R].FLSWILNR.[Y]"	""	"0.00866334"	"0.0007621"	"1"	"1"	"14"	"Q8BP47"	"Q8BP47 [534-541]"	""	"0"	"1048.59383"	"101.582"	"2.460"	"0.942870059534198"	"0.906515362333117"	"48.15"	"37.36"	"3.0"	"289.5"	"7.5"	"34.02"	"28.42"	"21.94"	"MandatoryModificationMissing"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006425"	"2.32"	"54.11"
"67800"	"False"	"High"	"[K].VLDFEHFLPMLQTVAK.[N]"	""	"0.00715289"	"0.0007621"	"1"	"2"	"2"	"Q60605"	"Q60605 [64-79]"	""	"0"	"1888.00372"	"0.932"	"0.922"	""	"0.906515362333117"	"53.33"	"51.86"	"87.3"	"100.6"	"112.1"	"34.26"	"37.01"	"34.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.0002502"	"0.0005388"	"3.81"	"63.51"
"38398"	"False"	"High"	"[K].LSSYEQKIK.[E]"	"1xBiotin [K7]"	"0.00282872"	"0.0007621"	"1"	"2"	"11"	"Q8BI84-1"	"Q8BI84-1 [1261-1269]"	"Q8BI84-1 1xBiotin [K1267]"	"1"	"1321.68205"	"0.034"	"0.869"	"7.83176865929348E-05"	"0.906515362333117"	"42.14"	"53.20"	"162.2"	"5.4"	"132.4"	"23.24"	"224.05"	"47.16"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.00023"	"3.32"	"36.99"
"19244"	"False"	"High"	"[R].GAAQNIIPASTGAAKAVGK.[V]"	"1xBiotin [K15]"	"0.00349092"	"0.0007621"	"1"	"1"	"2"	"P16858"	"P16858 [199-217]"	"P16858 1xBiotin [K213]"	"1"	"1951.04296"	"0.608"	"0.855"	"0.925138005747468"	"0.906515362333117"	"71.28"	"68.23"	"132.9"	"80.9"	"86.3"	"51.20"	"40.06"	"69.36"	""	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002804"	"4.21"	"41.61"
"1407"	"False"	"High"	"[K].AGLKCGPITSTTR.[F]"	"1xBiotin [K4]; 1xCarbamidomethyl [C5]"	"0.00332236"	"0.0007621"	"1"	"4"	"11"	"Q6P1H6-1"	"Q6P1H6-1 [89-101]"	"Q6P1H6-1 1xBiotin [K92]"	"1"	"1587.79816"	"0.159"	"0.880"	"0.925138005747468"	"0.906515362333117"	"56.15"	"42.00"	"145.1"	"20.4"	"134.5"	"30.44"	"46.21"	"36.48"	""	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002666"	"3.10"	"37.64"
"2368"	"False"	"High"	"[K].ALIQTKSGSLPSLHDIIK.[G]"	"1xBiotin [K6]"	"0.0177219"	"0.0007621"	"1"	"2"	"2"	"Q8C341-1"	"Q8C341-1 [1214-1231]"	"Q8C341-1 1xBiotin [K1219]"	"1"	"2147.18929"	"1.037"	"1.299"	""	"0.985364111986862"	"46.83"	"78.34"	"101.0"	"90.5"	"108.6"	"31.79"	"36.05"	"92.80"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0005416"	"0.001225"	"2.76"	"53.61"
"33260"	"False"	"High"	"[K].IGYHLLYYLR.[A]"	""	"0.0133471"	"0.0007621"	"1"	"1"	"10"	"Q7TPD0"	"Q7TPD0 [685-694]"	""	"0"	"1310.72557"	"134.412"	"2.098"	"0.925138005747468"	"0.969054191468458"	"55.35"	"62.99"	"2.0"	"294.3"	"3.8"	"52.71"	"30.08"	"40.28"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009511"	"2.09"	"49.15"
"38209"	"False"	"High"	"[R].LSNIFVIGK.[G]"	""	"0.00362292"	"0.0007621"	"1"	"1"	"20"	"P62702"	"P62702 [222-230]"	""	"0"	"990.59824"	"142.334"	"3.930"	"0.925138005747468"	"0.906515362333117"	"27.29"	"42.14"	"2.2"	"290.1"	"7.7"	"32.55"	"25.17"	"23.40"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002889"	"2.91"	"45.13"
"33262"	"False"	"High"	"[K].LGYLLFR.[D]"	""	"0.0196762"	"0.0007621"	"1"	"1"	"13"	"Q99MK8"	"Q99MK8 [63-69]"	""	"0"	"881.52435"	"234.438"	"5.800"	"0.925138005747468"	"0.906515362333117"	"59.69"	"54.83"	"1.3"	"291.6"	"7.1"	"64.55"	"24.41"	"44.18"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005902"	"0.001354"	"2.03"	"50.01"
"38136"	"False"	"High"	"[R].LSLPSKSVDWTHFGGSPPSDELR.[T]"	"1xBiotin [K6]"	"0.0170791"	"0.0007621"	"1"	"3"	"1"	"Q9EP53"	"Q9EP53 [664-686]"	"Q9EP53 1xBiotin [K669]"	"1"	"2738.32428"	"1.192"	"2.280"	""	"0.955198587033291"	"51.82"	"83.24"	"68.5"	"81.4"	"150.1"	"25.80"	"35.96"	"63.35"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0005416"	"0.001189"	"2.35"	"54.87"
"33535"	"False"	"High"	"[K].LKAQLGQDEGK.[Q]"	"1xBiotin [K2]"	"0.00355631"	"0.0007621"	"1"	"1"	"8"	"Q61035"	"Q61035 [41-51]"	"Q61035 1xBiotin [K42]"	"1"	"1412.72023"	"0.560"	"0.718"	"0.94218192752743"	"0.906515362333117"	"79.72"	"84.24"	"120.7"	"82.6"	"96.7"	"75.77"	"36.66"	"67.14"	""	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.000285"	"2.72"	"32.50"
"70050"	"False"	"High"	"[R].VYWTNWHTGTISYR.[S]"	""	"0.0236586"	"0.0007621"	"1"	"1"	"3"	"Q91ZX7"	"Q91ZX7 [3915-3928]"	""	"0"	"1783.85508"	"255.447"	"8.934"	"0.925138005747468"	"0.906515362333117"	"72.52"	"80.67"	"1.2"	"290.1"	"8.7"	"62.46"	"34.98"	"47.21"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006427"	"0.001602"	"2.60"	"43.99"
"33492"	"False"	"High"	"[K].IHVYGYSMGYGR.[A]"	""	"0.0341544"	"0.0007621"	"1"	"1"	"2"	"Q9DAK9"	"Q9DAK9 [87-98]"	""	"0"	"1402.65723"	"62.606"	"2.537"	"0.595334794739338"	"0.918615707119367"	"57.12"	"90.70"	"4.6"	"283.6"	"11.8"	"46.57"	"31.31"	"71.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000686"	"0.002279"	"2.23"	"36.15"
"70051"	"False"	"High"	"[R].VYYIAGFFLTVSPESVLK.[V]"	""	"0.00360058"	"0.0007621"	"1"	"2"	"3"	"P55264"	"P55264 [180-197]"	""	"0"	"2033.09939"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0001583"	"0.0002871"	"3.12"	""
"33412"	"False"	"High"	"[K].LHQMWLSWNQK.[T]"	""	"0.0180522"	"0.0007621"	"1"	"1"	"1"	"Q9DBG5"	"Q9DBG5 [301-311]"	""	"0"	"1470.73106"	"1.464"	"2.453"	"0.925138005747468"	"0.925239438142975"	"86.87"	"69.92"	"60.0"	"87.8"	"152.3"	"38.66"	"149.21"	"53.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001246"	"2.56"	"43.98"
"2341"	"False"	"High"	"[K].ALLLLLVGGVDQSPQGMK.[I]"	"1xOxidation [M17]"	"0.0101101"	"0.0007621"	"1"	"1"	"1"	"Q61881"	"Q61881 [353-370]"	""	"0"	"1855.03575"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0007395"	"2.99"	""
"1381"	"False"	"High"	"[K].AGKTEPSFTK.[E]"	"1xBiotin [K3]"	"0.00760895"	"0.0007621"	"1"	"1"	"5"	"Q80TN4"	"Q80TN4 [578-587]"	"Q80TN4 1xBiotin [K580]"	"1"	"1291.63510"	"0.349"	"1.263"	"0.477067253044389"	"0.919235111389825"	"101.71"	"119.42"	"91.2"	"43.9"	"164.9"	"87.21"	"52.06"	"47.12"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005713"	"2.93"	"34.17"
"38187"	"False"	"High"	"[K].LSMKDVTVEK.[A]"	"1xBiotin [K4]"	"0.0156678"	"0.0007621"	"1"	"1"	"5"	"Q8R1T1-1"	"Q8R1T1-1 [334-343]"	"Q8R1T1-1 1xBiotin [K337]"	"1"	"1375.69598"	"0.540"	"0.272"	"0.925138005747468"	"0.906515362333117"	"63.86"	"88.97"	"169.2"	"94.5"	"36.3"	"48.94"	"20.18"	"113.21"	""	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.000459"	"0.001097"	"2.80"	"41.41"
"70106"	"False"	"High"	"[R].WALSQSNPSALR.[E]"	""	"0.0026426"	"0.0007621"	"1"	"1"	"12"	"Q01853"	"Q01853 [454-465]"	""	"0"	"1329.69097"	"245.689"	"8.925"	"0.925138005747468"	"0.906515362333117"	"82.34"	"80.45"	"1.4"	"286.9"	"11.6"	"42.58"	"91.93"	"52.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002161"	"3.41"	"38.40"
"19122"	"False"	"High"	"[K].FYIAQWFR.[D]"	""	"0.0158621"	"0.0007621"	"1"	"2"	"11"	"Q6KCD5-1"	"Q6KCD5-1 [1669-1676]"	""	"0"	"1130.57818"	"27.363"	"1.165"	"0.925138005747468"	"0.916215054610739"	"55.85"	"40.14"	"11.0"	"277.0"	"12.0"	"12.74"	"44.15"	"32.56"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0005064"	"0.001107"	"2.15"	"57.30"
"19129"	"False"	"High"	"[K].FYLLSMFPYPSGK.[L]"	""	"0.00357838"	"0.0007621"	"1"	"1"	"2"	"Q8VDC0"	"Q8VDC0 [83-95]"	""	"0"	"1549.77595"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002866"	"2.74"	""
"19130"	"False"	"High"	"[K].FYLLSMFPYPSGK.[L]"	"1xOxidation [M6]"	"0.00404962"	"0.0007621"	"1"	"1"	"3"	"Q8VDC0"	"Q8VDC0 [83-95]"	""	"0"	"1565.77086"	"10.068"	"1.037"	"0.925138005747468"	""	"247.58"	"59.80"	"26.4"	"241.2"	"32.4"	"49.89"	"114.98"	"35.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003204"	"2.95"	"56.34"
"70107"	"False"	"High"	"[R].WALWFFK.[N]"	""	"0.00512251"	"0.0007621"	"1"	"1"	"32"	"P63073"	"P63073 [43-49]"	""	"0"	"997.52944"	"86.437"	"2.098"	"0.973314545170336"	"0.906515362333117"	"55.35"	"64.12"	"3.0"	"291.7"	"5.3"	"41.10"	"41.37"	"44.37"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0003989"	"2.51"	"63.46"
"33283"	"False"	"High"	"[R].LHDGNHYVNKLTDLK.[C]"	"1xBiotin [K10]"	"0.0179415"	"0.0007621"	"1"	"1"	"3"	"Q9Z2B5"	"Q9Z2B5 [824-838]"	"Q9Z2B5 1xBiotin [K833]"	"1"	"1992.99601"	"0.551"	"0.836"	"0.925138005747468"	"0.906515362333117"	"66.48"	"66.53"	"138.1"	"68.5"	"93.4"	"48.67"	"32.76"	"44.38"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0005416"	"0.001241"	"2.85"	"41.53"
"37988"	"False"	"High"	"[R].ISGLIYEETR.[G]"	""	"0.0045546"	"0.0007621"	"1"	"1"	"1"	"P62806"	"P62806 [47-56]"	""	"0"	"1180.62083"	"1.842"	"1.531"	"0.97864233222105"	""	"66.31"	"66.53"	"57.6"	"119.6"	"122.8"	"43.99"	"236.45"	"34.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.000358"	"2.20"	"36.46"
"33346"	"False"	"High"	"[K].LHKPPVDVGVDSR.[E]"	"1xBiotin [K3]"	"0.00281127"	"0.0007621"	"1"	"1"	"2"	"P57787"	"P57787 [434-446]"	"P57787 1xBiotin [K436]"	"0"	"1644.85264"	"0.927"	"2.201"	"0.925138005747468"	"0.964569500372465"	"97.01"	"103.78"	"65.6"	"66.0"	"168.4"	"100.09"	"30.34"	"60.42"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002289"	"4.01"	"37.74"
"33566"	"False"	"High"	"[K].LKDLLAEK.[E]"	"1xBiotin [K2]"	"0.00672412"	"0.0007621"	"1"	"1"	"12"	"B1AVY7"	"B1AVY7 [669-676]"	"B1AVY7 1xBiotin [K670]"	"1"	"1155.64421"	"0.094"	"0.767"	"0.00618834630488763"	"0.906515362333117"	"68.05"	"46.40"	"154.9"	"14.0"	"131.1"	"41.08"	"57.94"	"19.50"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005086"	"3.04"	"43.58"
"38423"	"False"	"High"	"[K].ISTSLPVLDLIDAIQPGSINYDLLK.[T]"	""	"0.0131024"	"0.0007621"	"1"	"1"	"4"	"Q61233"	"Q61233 [546-570]"	""	"0"	"2698.49132"	"0.717"	"0.859"	""	"0.906515362333117"	"59.51"	"56.67"	"111.7"	"83.6"	"104.7"	"43.03"	"36.04"	"57.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009325"	"3.58"	"68.12"
"38436"	"False"	"High"	"[K].LSVDLTAPLGVLQSK.[Q]"	""	"0.00415106"	"0.0007621"	"1"	"1"	"1"	"Q7TPV4"	"Q7TPV4 [1098-1112]"	""	"0"	"1540.89448"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0003278"	"3.26"	""
"70300"	"False"	"High"	"[K].WGLAWVSSQFYNK.[-]"	""	"0.00353438"	"0.0007621"	"1"	"1"	"3"	"O88597"	"O88597 [436-448]"	""	"0"	"1585.77979"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002822"	"2.36"	""
"32693"	"False"	"High"	"[R].LFYLALPPTVYEAVTK.[N]"	""	"0.0136805"	"0.0007621"	"1"	"1"	"9"	"Q00612"	"Q00612 [137-152]"	""	"0"	"1825.01460"	"31.265"	"1.929"	"0.925138005747468"	"0.978732356642279"	"143.24"	"65.96"	"7.5"	"278.7"	"13.8"	"47.72"	"122.66"	"47.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003479"	"0.0009722"	"3.27"	"62.90"
"32686"	"False"	"High"	"[R].IFVWDWQR.[H]"	""	"0.0335352"	"0.0007621"	"1"	"2"	"2"	"Q63836"	"Q63836 [228-235]"	""	"0"	"1149.58399"	"87.874"	"2.165"	"0.488903359827608"	""	"143.88"	"82.94"	"2.9"	"290.8"	"6.3"	"71.65"	"95.51"	"36.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002244"	"1.75"	"53.71"
"19429"	"False"	"High"	"[K].GALQYLVPILTQTLTK.[Q]"	""	"0.0027767"	"0.0007621"	"1"	"1"	"12"	"P70168"	"P70168 [317-332]"	""	"0"	"1759.03640"	"0.978"	"4.665"	"0.925138005747468"	"0.906515362333117"	"107.77"	"45.44"	"51.3"	"42.4"	"206.3"	"32.51"	"173.32"	"32.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002266"	"3.42"	"67.04"
"38533"	"False"	"High"	"[K].LTAVSVGVQGSGWGWLGFNK.[E]"	""	"0.0300439"	"0.0007621"	"1"	"1"	"5"	"P09671"	"P09671 [135-154]"	""	"0"	"2063.07089"	"6.981"	"1.800"	"0.991386006245675"	""	"248.35"	"36.37"	"34.1"	"203.7"	"62.2"	"34.51"	"130.12"	"17.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.0006486"	"0.002016"	"2.45"	"59.72"
"70306"	"False"	"High"	"[R].WGLVPSWFK.[E]"	""	"0.00369078"	"0.0007621"	"1"	"1"	"16"	"Q8R1M0"	"Q8R1M0 [75-83]"	""	"0"	"1119.59858"	"87.373"	"1.846"	"0.997465361987486"	"0.981281916820826"	"78.42"	"75.24"	"4.0"	"289.1"	"6.9"	"54.34"	"50.32"	"50.49"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002943"	"2.47"	"60.11"
"32663"	"False"	"High"	"[R].IFTNLYGR.[H]"	""	"0.0121673"	"0.0007621"	"1"	"1"	"16"	"Q91YT0"	"Q91YT0 [41-48]"	""	"0"	"983.53089"	"239.801"	"5.187"	"0.925138005747468"	"0.906515362333117"	"63.67"	"80.23"	"1.1"	"291.8"	"7.1"	"73.61"	"49.71"	"39.18"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003095"	"0.0008725"	"2.02"	"37.12"
"70323"	"False"	"High"	"[R].WGTFPLGR.[L]"	""	"0.0280885"	"0.0007621"	"1"	"2"	"11"	"A2BE28"	"A2BE28 [688-695]"	""	"0"	"933.49411"	"132.918"	"2.751"	"0.929016530787821"	"0.916215054610739"	"26.61"	"21.53"	"2.2"	"291.9"	"5.9"	"15.14"	"30.59"	"77.00"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0006486"	"0.001881"	"2.00"	"44.29"
"67780"	"False"	"High"	"[K].VIAVYDLGGGTFDISILEIQK.[G]"	""	"0.0333312"	"0.0007621"	"1"	"1"	"1"	"P38647"	"P38647 [239-259]"	""	"0"	"2251.22203"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0006486"	"0.002232"	"2.18"	""
"38604"	"False"	"High"	"[K].LTFSVIWK.[L]"	""	"0.0168701"	"0.0007621"	"1"	"2"	"3"	"Q8CI75"	"Q8CI75 [460-467]"	""	"0"	"993.57678"	"29.383"	"1.151"	"0.925138005747468"	"0.906515362333117"	"124.22"	"95.45"	"9.2"	"279.7"	"11.1"	"31.94"	"76.70"	"63.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0005064"	"0.001175"	"1.67"	"52.71"
"32653"	"False"	"High"	"[R].LFTAYLQLYR.[G]"	""	"0.00310379"	"0.0007621"	"1"	"1"	"4"	"O35134"	"O35134 [791-800]"	""	"0"	"1287.70958"	"54.735"	"0.767"	"0.925138005747468"	""	"59.42"	"71.17"	"6.3"	"289.6"	"4.1"	"28.08"	"63.07"	"51.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002505"	"2.42"	"54.53"
"32640"	"False"	"High"	"[R].LFSSKSSGK.[S]"	"1xBiotin [K5]"	"0.00710881"	"0.0007621"	"1"	"1"	"29"	"Q9EP72"	"Q9EP72 [216-224]"	"Q9EP72 1xBiotin [K220]"	"1"	"1166.58742"	"0.003"	"0.915"	"4.55724695780368E-07"	"0.906515362333117"	"55.55"	"20.01"	"154.0"	"0.5"	"145.5"	"29.12"	"54.51"	"15.76"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005373"	"2.23"	"32.29"
"32612"	"False"	"High"	"[R].LFRPWLNMDR.[M]"	"1xOxidation [M8]"	"0.0185022"	"0.0007621"	"1"	"1"	"5"	"O35855"	"O35855 [118-127]"	""	"0"	"1363.69395"	"316.131"	"4.236"	"0.925138005747468"	"0.906515362333117"	"41.75"	"41.19"	"0.9"	"295.3"	"3.8"	"34.51"	"29.83"	"25.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005416"	"0.001273"	"2.63"	"39.71"
"32611"	"False"	"High"	"[R].LFRPWLNMDR.[M]"	""	"0.00449861"	"0.0007621"	"1"	"1"	"3"	"O35855"	"O35855 [118-127]"	""	"0"	"1347.69904"	"40.597"	"6.264"	"0.563876479871168"	"0.906515362333117"	"142.92"	"57.86"	"6.8"	"252.8"	"40.4"	"33.21"	"114.11"	"43.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003542"	"2.48"	"45.55"
"19431"	"False"	"High"	"[R].GALTGGYYDTR.[K]"	""	"0.0124714"	"0.0007621"	"1"	"1"	"2"	"Q9CW03"	"Q9CW03 [662-672]"	""	"0"	"1173.55348"	"192.400"	"4.109"	"0.391538127159586"	"0.906515362333117"	"66.18"	"60.03"	"1.4"	"292.2"	"6.5"	"61.28"	"33.63"	"31.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0008931"	"2.20"	"29.43"
"32697"	"False"	"High"	"[K].LFYIPWR.[H]"	""	"0.0168701"	"0.0007621"	"1"	"1"	"16"	"P56477"	"P56477 [42-48]"	""	"0"	"994.55090"	"102.789"	"2.420"	"0.953730823665515"	"0.94306020666367"	"73.94"	"73.30"	"3.3"	"290.5"	"6.2"	"51.02"	"40.85"	"45.57"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005064"	"0.001171"	"1.69"	"55.17"
"18003"	"False"	"High"	"[K].FLRPHYGK.[L]"	""	"0.0204157"	"0.0007621"	"1"	"1"	"4"	"Q8VDM4"	"Q8VDM4 [98-105]"	""	"0"	"1017.56286"	"198.017"	"3.877"	"0.925138005747468"	"0.906515362333117"	"45.99"	"59.65"	"1.4"	"293.1"	"5.5"	"41.66"	"73.43"	"56.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.000628"	"0.001395"	"2.33"	"20.29"
"70293"	"False"	"High"	"[K].WGGKSESIHVTLNVEQACYTR.[D]"	"1xBiotin [K4]; 1xCarbamidomethyl [C18]"	"0.00281127"	"0.0007621"	"1"	"1"	"6"	"E9Q634"	"E9Q634 [332-352]"	"E9Q634 1xBiotin [K335]"	"1"	"2661.25482"	"0.736"	"1.556"	"0.945201280199396"	"0.939158492962313"	"51.91"	"60.23"	"97.1"	"67.2"	"135.7"	"35.86"	"40.36"	"43.61"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002294"	"2.97"	"48.14"
"19362"	"False"	"High"	"[K].GAHSVGLMWWMLAR.[E]"	"2xOxidation [M8; M11]"	"0.00441591"	"0.0007621"	"1"	"1"	"33"	"P14206"	"P14206 [167-180]"	""	"0"	"1646.79301"	"131.530"	"1.497"	"0.925138005747468"	"0.957287483848178"	"61.59"	"49.04"	"2.3"	"294.3"	"3.4"	"45.06"	"93.50"	"46.55"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003478"	"3.57"	"49.29"
"32954"	"False"	"High"	"[K].LGKTAAFK.[A]"	"1xBiotin [K3]"	"0.003448"	"0.0007621"	"1"	"1"	"13"	"O35857"	"O35857 [170-177]"	"O35857 1xBiotin [K172]"	"1"	"1061.58121"	"0.046"	"0.973"	"0.000218033299216399"	"0.912705333843446"	"37.23"	"21.70"	"148.4"	"6.6"	"144.9"	"9.15"	"31.74"	"21.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002768"	"2.92"	"36.75"
"67799"	"False"	"High"	"[R].VLDELTLAR.[AT]"	""	"0.0124714"	"0.0007621"	"1"	"5"	"1"	"Q61781"	"Q61781 [230-238]"	""	"0"	"1029.59389"	"1.986"	"1.584"	"0.391538127159586"	""	"59.99"	"58.84"	"59.5"	"121.6"	"118.9"	"45.67"	"239.56"	"31.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0008941"	"2.51"	"39.83"
"32927"	"False"	"High"	"[R].LGKDGQENGHITTK.[A]"	"1xBiotin [K3]"	"0.0245458"	"0.0007621"	"1"	"1"	"5"	"Q07113"	"Q07113 [2371-2384]"	"Q07113 1xBiotin [K2373]"	"1"	"1723.84319"	"0.606"	"0.497"	"0.952905080717326"	"0.906515362333117"	"80.87"	"79.11"	"143.6"	"75.8"	"80.7"	"61.46"	"22.89"	"39.73"	""	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001655"	"3.45"	"27.40"
"32900"	"False"	"High"	"[R].IGGSFKHPSSFEGK.[G]"	"1xBiotin [K6]"	"0.00369078"	"0.0007621"	"1"	"1"	"3"	"O88822"	"O88822 [250-263]"	"O88822 1xBiotin [K255]"	"1"	"1703.82100"	"0.098"	"0.709"	"0.00921141667143777"	"0.906515362333117"	"33.01"	"29.13"	"166.9"	"16.2"	"116.9"	"35.80"	"22.60"	"36.49"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002951"	"2.72"	"37.72"
"19351"	"False"	"High"	"[R].GAGWLFGAK.[V]"	""	"0.0186164"	"0.0007621"	"1"	"1"	"14"	"Q9CQR6"	"Q9CQR6 [211-219]"	""	"0"	"906.48321"	"146.899"	"4.027"	"0.925138005747468"	"0.906515362333117"	"74.22"	"39.67"	"2.7"	"288.1"	"9.2"	"51.04"	"39.79"	"19.91"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001287"	"2.42"	"45.55"
"38473"	"False"	"High"	"[K].ISVSDLINGIASLK.[M]"	""	"0.00651945"	"0.0007621"	"1"	"2"	"5"	"Q61735-1"	"Q61735-1 [86-99]"	""	"0"	"1429.82607"	"1.609"	"1.660"	"0.925138005747468"	"0.989642441585414"	"69.41"	"69.26"	"77.0"	"106.6"	"116.3"	"45.95"	"166.59"	"59.23"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.000497"	"2.74"	"65.16"
"32875"	"False"	"High"	"[K].IGGIFAFK.[V]"	""	"0.0296787"	"0.0007621"	"1"	"2"	"8"	"P32020"	"P32020 [455-462]"	""	"0"	"852.49780"	"148.783"	"4.005"	"0.925138005747468"	"0.906515362333117"	"62.50"	"62.33"	"1.9"	"291.1"	"7.0"	"64.82"	"38.14"	"33.24"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001987"	"1.92"	"46.79"
"32967"	"False"	"High"	"[R].LGLALNYSVFYYEIQNAPEQACHLAK.[T]"	"1xCarbamidomethyl [C22]"	"0.00428144"	"0.0007621"	"1"	"1"	"6"	"P61982"	"P61982 [173-198]"	""	"0"	"3012.49240"	"1.423"	"3.801"	"0.992801922882858"	"0.906515362333117"	"104.47"	"100.86"	"47.2"	"60.4"	"192.4"	"47.27"	"172.29"	"69.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.0003377"	"4.69"	"61.84"
"1288"	"False"	"High"	"[K].AGFAGDDAPR.[A]"	""	"0.00804417"	"0.0007621"	"1"	"6"	"2"	"P60710"	"P60710 [19-28]"	""	"0"	"976.44828"	"58.625"	"1.068"	"0.490302156448734"	"0.906515362333117"	"145.57"	"34.33"	"5.9"	"287.9"	"6.3"	"25.95"	"110.03"	"34.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005995"	"2.24"	"21.42"
"32849"	"False"	"High"	"[K].LGFMSAFVK.[A]"	"1xOxidation [M4]"	"0.0162579"	"0.0007621"	"1"	"2"	"11"	"Q9D2G2-1"	"Q9D2G2-1 [279-287]"	""	"0"	"1015.52812"	"352.059"	"4.159"	"0.896585727780077"	"0.906515362333117"	"78.44"	"84.11"	"0.8"	"295.1"	"4.1"	"70.11"	"27.33"	"37.69"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0005064"	"0.001135"	"1.65"	"41.67"
"32848"	"False"	"High"	"[K].LGFMSAFVK.[A]"	""	"0.00770359"	"0.0007621"	"1"	"2"	"3"	"Q9D2G2-1"	"Q9D2G2-1 [279-287]"	""	"0"	"999.53320"	"60.768"	"3.677"	"0.950441584255777"	"0.906515362333117"	"58.42"	"38.49"	"4.9"	"279.0"	"16.1"	"28.47"	"61.77"	"31.70"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005755"	"2.09"	"51.54"
"32773"	"False"	"High"	"[R].LGDAVEQGVINNSVLGYFIGR.[I]"	""	"0.0024535"	"0.0007621"	"1"	"1"	"2"	"Q9CZD3"	"Q9CZD3 [382-402]"	""	"0"	"2221.16116"	"0.885"	"0.862"	""	"0.906515362333117"	"51.66"	"61.88"	"108.0"	"102.6"	"89.3"	"35.91"	"40.70"	"47.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0001583"	"0.0002015"	"3.78"	"64.09"
"32766"	"False"	"High"	"[R].IGCYVTVFQNISNLR.[D]"	"1xCarbamidomethyl [C3]"	"0.00420273"	"0.0007621"	"1"	"1"	"4"	"D3Z6Q9"	"D3Z6Q9 [203-217]"	""	"0"	"1783.91597"	"5.840"	"2.964"	"0.928611703535518"	"0.916215054610739"	"134.19"	"57.99"	"36.0"	"149.9"	"114.1"	"43.18"	"109.07"	"50.37"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003316"	"2.88"	"56.46"
"32757"	"False"	"High"	"[K].LGCEVLGVSVDSQFTHLAWINTPR.[K]"	"1xCarbamidomethyl [C3]"	"0.00956345"	"0.0007621"	"1"	"1"	"2"	"Q61171"	"Q61171 [68-91]"	""	"0"	"2699.36100"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0002502"	"0.0007022"	"3.59"	""
"18024"	"False"	"High"	"[K].FLSILCSR.[N]"	"1xCarbamidomethyl [C6]"	"0.0206683"	"0.0007621"	"1"	"1"	"8"	"P97429"	"P97429 [193-200]"	""	"0"	"995.53426"	"112.570"	"3.528"	"0.952905080717326"	"0.906515362333117"	"37.09"	"26.26"	"2.6"	"288.6"	"8.9"	"19.10"	"37.04"	"45.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000628"	"0.001411"	"1.78"	"44.62"
"19361"	"False"	"High"	"[K].GAHSVGLMWWMLAR.[E]"	"1xOxidation [M]"	"0.00555131"	"0.0007621"	"1"	"1"	"37"	"P14206"	"P14206 [167-180]"	""	"0"	"1630.79810"	"50.992"	"1.391"	"0.933706226644844"	"0.937945192250145"	"66.51"	"75.23"	"6.3"	"286.1"	"7.5"	"70.43"	"24.28"	"39.48"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004294"	"3.10"	"53.71"
"32851"	"False"	"High"	"[K].IGFPWSEIR.[N]"	""	"0.00569033"	"0.0007621"	"3"	"3"	"17"	"P26043; P26041; P26040"	"P26043 [238-246]; P26041 [238-246]; P26040 [238-246]"	""	"0"	"1104.58366"	"305.861"	"6.650"	"0.925138005747468"	"0.906515362333117"	"94.35"	"97.38"	"1.2"	"292.2"	"6.6"	"91.49"	"51.28"	"59.53"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004376"	"2.21"	"53.49"
"33579"	"False"	"High"	"[R].LKDSWAER.[L]"	"1xBiotin [K2]"	"0.0300439"	"0.0007621"	"1"	"1"	"9"	"Q8K0C4"	"Q8K0C4 [411-418]"	"Q8K0C4 1xBiotin [K412]"	"1"	"1230.59357"	"0.186"	"0.923"	"0.925138005747468"	"0.906515362333117"	"41.25"	"30.75"	"142.7"	"27.4"	"129.9"	"26.71"	"33.97"	"20.88"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0006486"	"0.002016"	"2.76"	"37.83"
"2125"	"False"	"High"	"[K].ALFKPGAWFK.[G]"	""	"0.0046399"	"0.0007621"	"1"	"1"	"31"	"O54825"	"O54825 [278-287]"	""	"0"	"1164.65643"	"77.410"	"1.981"	"0.992801922882858"	"0.906515362333117"	"62.40"	"60.49"	"3.6"	"289.1"	"7.3"	"55.74"	"23.51"	"46.64"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.000363"	"2.45"	"46.86"
"19106"	"False"	"High"	"[K].FYGPAGPYGIFAGR.[D]"	""	"0.00318156"	"0.0007621"	"1"	"1"	"9"	"Q80UU9"	"Q80UU9 [130-143]"	""	"0"	"1472.73211"	"72.634"	"2.427"	"0.469916101417075"	"0.913565512658592"	"45.87"	"35.56"	"4.4"	"285.0"	"10.6"	"27.63"	"43.90"	"21.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0002571"	"2.41"	"51.51"
"33704"	"False"	"High"	"[R].IKHVAGSTQTR.[H]"	"1xBiotin [K2]"	"0.00664149"	"0.0007621"	"1"	"4"	"2"	"Q80TI0-1"	"Q80TI0-1 [595-605]"	"Q80TI0-1 1xBiotin [K596]"	"1"	"1423.74744"	"0.281"	"0.616"	"0.925138005747468"	"0.906515362333117"	"66.23"	"72.71"	"155.9"	"48.2"	"96.0"	"49.97"	"47.76"	"51.12"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0002502"	"0.0005043"	"3.10"	"23.20"
"18066"	"False"	"High"	"[K].FIVKGMVER.[F]"	"1xBiotin [K4]"	"0.00240837"	"0.0007621"	"1"	"1"	"12"	"Q9CY18"	"Q9CY18 [100-108]"	"Q9CY18 1xBiotin [K103]"	"1"	"1304.68536"	"0.095"	"1.103"	"0.00503160111106151"	"0.906515362333117"	"37.30"	"35.34"	"131.5"	"13.2"	"155.3"	"18.06"	"34.43"	"27.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0001982"	"2.42"	"45.51"
"67903"	"False"	"High"	"[R].VLGLVLLR.[G]"	""	"0.0125486"	"0.0007621"	"1"	"2"	"9"	"P27048"	"P27048 [66-73]"	""	"0"	"882.61350"	"129.581"	"2.443"	"0.427089858136149"	"0.923587691079208"	"78.27"	"58.29"	"2.5"	"291.5"	"6.1"	"54.25"	"58.19"	"33.16"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0003479"	"0.0008951"	"2.15"	"52.31"
"33920"	"False"	"High"	"[R].LKSLALDIDR.[D]"	"1xBiotin [K2]"	"0.00472679"	"0.0007621"	"1"	"1"	"3"	"O35153"	"O35153 [35-44]"	"O35153 1xBiotin [K36]"	"1"	"1369.75080"	"0.183"	"0.824"	"0.925138005747468"	"0.906515362333117"	"48.13"	"46.28"	"143.3"	"29.5"	"127.3"	"35.08"	"35.02"	"27.64"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0003694"	"2.75"	"48.65"
"33906"	"False"	"High"	"[K].LKSELVANNVTLPAGEQR.[K]"	"1xBiotin [K2]"	"0.0262584"	"0.0007621"	"1"	"6"	"9"	"Q61029"	"Q61029 [16-33]"	"Q61029 1xBiotin [K17]"	"1"	"2165.13831"	"0.581"	"1.311"	"0.925138005747468"	"0.916215054610739"	"92.72"	"86.93"	"101.5"	"63.2"	"135.3"	"74.23"	"21.51"	"46.45"	""	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.0006427"	"0.001768"	"3.13"	"44.98"
"33884"	"False"	"High"	"[R].IKQQIALDR.[A]"	"1xBiotin [K2]"	"0.002594"	"0.0007621"	"1"	"1"	"9"	"Q8VCH8"	"Q8VCH8 [267-275]"	"Q8VCH8 1xBiotin [K268]"	"1"	"1310.72492"	"0.119"	"0.773"	"0.925138005747468"	"0.906515362333117"	"86.54"	"44.97"	"159.4"	"18.4"	"122.2"	"22.05"	"64.90"	"37.66"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002122"	"2.27"	"37.29"
"33869"	"False"	"High"	"[K].LKQFDAYPK.[T]"	"1xBiotin [K2]"	"0.00452652"	"0.0007621"	"1"	"2"	"5"	"Q9CQE7"	"Q9CQE7 [7-15]"	"Q9CQE7 1xBiotin [K8]"	"1"	"1335.67657"	"4.570"	"1.002"	"0.471781850843532"	"0.906515362333117"	"142.66"	"66.92"	"95.6"	"118.8"	"85.6"	"67.14"	"128.46"	"51.91"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0003561"	"2.42"	"40.76"
"19064"	"False"	"High"	"[R].FWYFVSQLK.[K]"	""	"0.00680777"	"0.0007621"	"1"	"1"	"4"	"P62717"	"P62717 [44-52]"	""	"0"	"1217.63536"	"70.379"	"2.481"	"0.980716034276262"	"0.923587691079208"	"63.69"	"63.19"	"2.9"	"288.6"	"8.5"	"49.21"	"41.81"	"33.35"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0005148"	"2.69"	"55.75"
"38120"	"False"	"High"	"[K].ISLIQIFR.[A]"	""	"0.027409"	"0.0007621"	"1"	"1"	"11"	"Q99PV0"	"Q99PV0 [1571-1578]"	""	"0"	"989.61423"	"135.126"	"1.930"	"0.925138005747468"	"0.998316466510713"	"62.00"	"90.81"	"2.1"	"292.7"	"5.2"	"65.88"	"20.67"	"68.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0006486"	"0.001842"	"1.82"	"56.67"
"69981"	"False"	"High"	"[R].VYGALMWSLGK.[VI]"	"1xOxidation [M6]"	"0.00531614"	"0.0007621"	"2"	"3"	"6"	"Q9EQP2; Q9QXY6"	"Q9EQP2 [235-245]; Q9QXY6 [232-242]"	""	"0"	"1240.63946"	"92.295"	"1.471"	"0.447282673531665"	"0.916215054610739"	"61.53"	"66.84"	"3.2"	"293.2"	"3.6"	"49.05"	"28.90"	"62.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0001583"	"0.0004107"	"2.56"	"47.17"
"33692"	"False"	"High"	"[K].IKGVSPQGAIMDR.[M]"	"1xBiotin [K2]; 1xOxidation [M11]"	"0.00444331"	"0.0007621"	"1"	"1"	"4"	"P97369"	"P97369 [157-169]"	"P97369 1xBiotin [K158]"	"1"	"1613.81381"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0003493"	"2.03"	""
"69985"	"False"	"High"	"[R].VYGLYSVTNSR.[E]"	""	"0.00360058"	"0.0007621"	"1"	"3"	"9"	"P29351"	"P29351 [373-383]"	""	"0"	"1258.64263"	"171.395"	"2.253"	"0.471884213090806"	"0.921247934720747"	"47.67"	"95.09"	"1.9"	"293.8"	"4.4"	"36.95"	"40.19"	"85.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0001583"	"0.0002877"	"2.52"	"37.00"
"38026"	"False"	"High"	"[R].LSKEDIER.[M]"	"1xBiotin [K3]"	"0.00668268"	"0.0007621"	"1"	"1"	"13"	"P63017"	"P63017 [510-517]"	"P63017 1xBiotin [K512]"	"1"	"1215.60380"	"0.799"	"0.900"	"0.0391467039251758"	"0.906515362333117"	"96.82"	"75.60"	"111.4"	"87.4"	"101.2"	"39.31"	"90.70"	"68.49"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0005077"	"2.85"	"37.86"
"33748"	"False"	"High"	"[K].IKIIAPPER.[K]"	"1xBiotin [K2]"	"0.0167665"	"0.0007621"	"1"	"7"	"10"	"P60710"	"P60710 [327-335]"	"P60710 1xBiotin [K328]"	"1"	"1262.72894"	"0.111"	"0.920"	"0.0163629287467111"	"0.906515362333117"	"36.84"	"38.27"	"149.8"	"18.7"	"131.5"	"28.80"	"24.89"	"31.07"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0005064"	"0.001169"	"2.54"	"41.42"
"33849"	"False"	"High"	"[R].LKPQLLQGVYAMGFNRPSK.[I]"	"1xOxidation [M12]"	"0.0134297"	"0.0007621"	"1"	"1"	"1"	"Q61655"	"Q61655 [98-116]"	""	"0"	"2163.17431"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0003479"	"0.0009556"	"4.14"	""
"1634"	"False"	"High"	"[R].AHHKFSETHADPHNSR.[R]"	"1xBiotin [K4]"	"0.00346939"	"0.0007621"	"2"	"4"	"3"	"P13011; P13516"	"P13011 [158-173]; P13516 [155-170]"	"P13011 1xBiotin [K161]; P13516 1xBiotin [K158]"	"1"	"2096.94676"	"0.288"	"0.521"	"0.925138005747468"	"0.906515362333117"	"101.14"	"93.13"	"172.1"	"45.6"	"82.3"	"66.16"	"45.69"	"23.98"	"NotUnique"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0001583"	"0.0002778"	"2.32"	"20.91"
"33830"	"False"	"High"	"[R].LKPGYLEATVDWFR.[R]"	""	"0.00746917"	"0.0007621"	"1"	"1"	"1"	"Q9D819"	"Q9D819 [178-191]"	""	"0"	"1694.89007"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0002502"	"0.0005615"	"3.06"	""
"70002"	"False"	"High"	"[K].VYLPNKQR.[T]"	"1xBiotin [K6]"	"0.0180522"	"0.0007621"	"1"	"1"	"22"	"P04627"	"P04627 [23-30]"	"P04627 1xBiotin [K28]"	"1"	"1243.66159"	"0.007"	"0.771"	"3.76579232759415E-06"	"0.906515362333117"	"48.85"	"56.71"	"173.5"	"1.3"	"125.2"	"39.30"	"27.89"	"36.37"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.00125"	"1.96"	"36.40"
"19060"	"False"	"High"	"[R].FWSFFLR.[D]"	""	"0.00893515"	"0.0007621"	"1"	"1"	"23"	"Q6ZQ58-1"	"Q6ZQ58-1 [895-901]"	""	"0"	"1002.51960"	"72.966"	"1.347"	"0.998769547666767"	"0.998099211977233"	"60.58"	"95.04"	"3.7"	"290.5"	"5.7"	"57.82"	"42.33"	"88.56"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0002502"	"0.0006595"	"2.31"	"60.47"
"33584"	"False"	"High"	"[R].IKDYLLMEEEFIR.[N]"	"1xBiotin [K2]"	"0.0190803"	"0.0007621"	"1"	"1"	"1"	"P62192"	"P62192 [68-80]"	"P62192 1xBiotin [K69]"	"1"	"1924.95472"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0005416"	"0.001313"	"2.34"	""
"2330"	"False"	"High"	"[R].ALLLAQWAWR.[E]"	""	"0.0204157"	"0.0007621"	"1"	"1"	"1"	"Q8C4J7"	"Q8C4J7 [87-96]"	""	"0"	"1227.69969"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.000628"	"0.001398"	"1.85"	""
"18067"	"False"	"High"	"[K].FIVKGMVER.[F]"	"1xBiotin [K4]; 1xOxidation [M6]"	"0.00512251"	"0.0007621"	"1"	"1"	"9"	"Q9CY18"	"Q9CY18 [100-108]"	"Q9CY18 1xBiotin [K103]"	"1"	"1320.68028"	"0.135"	"0.849"	"0.0161538924979164"	"0.906515362333117"	"44.40"	"32.75"	"148.9"	"21.3"	"129.8"	"34.71"	"32.37"	"25.61"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0001583"	"0.000397"	"2.48"	"39.49"
"2309"	"False"	"High"	"[R].ALLFIPR.[R]"	""	"0.0193165"	"0.0007621"	"1"	"1"	"20"	"P11499"	"P11499 [331-337]"	""	"0"	"829.52944"	"137.330"	"3.379"	"0.925138005747468"	"0.906515362333117"	"47.68"	"45.62"	"1.9"	"291.9"	"6.3"	"38.49"	"28.98"	"16.14"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001326"	"2.17"	"46.55"
"19032"	"False"	"High"	"[K].FWAFLK.[Y]"	""	"0.0279171"	"0.0007621"	"1"	"1"	"32"	"Q6ZQ58-1"	"Q6ZQ58-1 [970-975]"	""	"0"	"811.45012"	"93.364"	"3.545"	"0.952905080717326"	"0.906515362333117"	"65.67"	"84.86"	"3.0"	"286.5"	"10.5"	"52.93"	"47.15"	"62.70"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006486"	"0.001868"	"2.19"	"51.97"
"33934"	"False"	"High"	"[K].IKSQDFYEK.[D]"	"1xBiotin [K2]"	"0.00558575"	"0.0007621"	"1"	"1"	"4"	"Q59J78"	"Q59J78 [100-108]"	"Q59J78 1xBiotin [K101]"	"1"	"1383.66131"	"19.266"	"0.754"	"0.925138005747468"	"0.906515362333117"	"72.69"	"74.55"	"12.9"	"276.5"	"10.7"	"31.42"	"72.05"	"60.09"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0001583"	"0.0004312"	"2.03"	"35.40"
"19069"	"False"	"High"	"[R].FYALSAK.[F]"	""	"0.0230848"	"0.0007621"	"1"	"1"	"27"	"P14211"	"P14211 [74-80]"	""	"0"	"799.43487"	"108.345"	"3.018"	"0.929320212853233"	"0.906515362333117"	"42.27"	"33.04"	"2.9"	"288.2"	"9.0"	"28.56"	"41.38"	"21.90"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0006427"	"0.001563"	"2.03"	"30.51"
"33607"	"False"	"High"	"[R].LKEEQKEEEER.[K]"	"1xBiotin [K2]"	"0.012783"	"0.0007621"	"1"	"1"	"5"	"Q80WW9"	"Q80WW9 [166-176]"	"Q80WW9 1xBiotin [K167]"	"2"	"1672.78468"	"0.348"	"0.495"	"0.925138005747468"	"0.906515362333117"	"48.26"	"62.94"	"158.8"	"60.5"	"80.7"	"50.62"	"17.53"	"47.37"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0003479"	"0.0009111"	"2.15"	"22.40"
"19001"	"False"	"High"	"[K].FVPYYDLFMPSLK.[H]"	""	"0.0172908"	"0.0007621"	"1"	"2"	"6"	"Q8BKC5-1"	"Q8BKC5-1 [527-539]"	""	"0"	"1619.81781"	"2.075"	"1.828"	"0.925138005747468"	"0.974397579791771"	"58.35"	"58.08"	"57.3"	"122.6"	"120.1"	"45.18"	"176.25"	"60.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0005416"	"0.001199"	"2.64"	"63.15"
"34118"	"False"	"High"	"[R].ILAQATSDLVNAIK.[A]"	""	"0.0221136"	"0.0007621"	"1"	"1"	"2"	"P26039"	"P26039 [828-841]"	""	"0"	"1456.83697"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0006427"	"0.001501"	"2.76"	""
"19095"	"False"	"High"	"[R].FYFLEAYNSK.[T]"	""	"0.0132651"	"0.0007621"	"1"	"2"	"3"	"P13864"	"P13864 [1086-1095]"	""	"0"	"1281.61502"	"35.136"	"1.446"	"0.925138005747468"	"0.916215054610739"	"138.01"	"63.64"	"7.4"	"282.0"	"10.6"	"28.18"	"98.79"	"53.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0003479"	"0.0009446"	"2.34"	"49.25"
"67973"	"False"	"High"	"[R].VLIAAHGNSLR.[G]"	""	"0.0137652"	"0.0007621"	"1"	"2"	"3"	"Q9DBJ1"	"Q9DBJ1 [181-191]"	""	"0"	"1150.66912"	"129.005"	"3.327"	"0.925138005747468"	"0.906515362333117"	"83.72"	"40.12"	"2.7"	"288.8"	"8.5"	"33.17"	"113.48"	"23.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0003479"	"0.0009775"	"2.03"	"25.00"
"19002"	"False"	"High"	"[K].FVPYYDLFMPSLK.[H]"	"1xOxidation [M9]"	"0.0331284"	"0.0007621"	"1"	"2"	"2"	"Q8BKC5-1"	"Q8BKC5-1 [527-539]"	""	"0"	"1635.81273"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0006486"	"0.002217"	"1.80"	""
"33612"	"False"	"High"	"[K].LKEGAENLR.[RK]"	"1xBiotin [K2]"	"0.00562039"	"0.0007621"	"1"	"5"	"14"	"P70268"	"P70268 [52-60]"	"P70268 1xBiotin [K53]"	"1"	"1255.64633"	"0.027"	"0.799"	"5.1926043445364E-05"	"0.906515362333117"	"54.45"	"57.69"	"161.3"	"5.4"	"133.3"	"31.74"	"40.96"	"49.33"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004338"	"2.34"	"32.14"
"19094"	"False"	"High"	"[R].FYFHLGDAMQR.[V]"	"1xOxidation [M9]"	"0.0262584"	"0.0007621"	"1"	"1"	"1"	"Q8BSY0"	"Q8BSY0 [510-520]"	""	"0"	"1400.64158"	"8.177"	"0.893"	"0.94218192752743"	"0.906515362333117"	"310.12"	"36.05"	"32.0"	"238.0"	"30.0"	"20.99"	"112.99"	"38.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0006427"	"0.001766"	"2.07"	"40.93"
"33691"	"False"	"High"	"[K].IKGVSPQGAIMDR.[M]"	"1xBiotin [K2]"	"0.00724187"	"0.0007621"	"1"	"1"	"2"	"P97369"	"P97369 [157-169]"	"P97369 1xBiotin [K158]"	"1"	"1597.81889"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.0002502"	"0.0005447"	"2.36"	""
"2334"	"False"	"High"	"[K].AIIIFVPVPQLK.[S]"	""	"0.00351258"	"0.0007621"	"1"	"1"	"24"	"P62082"	"P62082 [59-70]"	""	"0"	"1337.85552"	"208.193"	"5.833"	"0.925138005747468"	"0.906515362333117"	"84.04"	"94.27"	"1.5"	"289.4"	"9.1"	"102.77"	"67.21"	"37.08"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0002812"	"2.93"	"59.72"
"69948"	"False"	"High"	"[R].VWQVTIGTR.[-]"	""	"0.0119441"	"0.0007621"	"1"	"1"	"14"	"P68040"	"P68040 [309-317]"	""	"0"	"1059.59455"	"710.037"	"25.218"	"0.528768931692346"	"0.506240900514598"	"108.13"	"109.09"	"0.4"	"285.6"	"14.0"	"134.39"	"78.33"	"65.27"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0003095"	"0.0008582"	"2.10"	"39.20"
"69949"	"False"	"High"	"[K].VWQYITLMR.[R]"	"1xOxidation [M8]"	"0.0272416"	"0.0007621"	"1"	"1"	"7"	"Q99LH1"	"Q99LH1 [347-355]"	""	"0"	"1225.63979"	"131.038"	"2.149"	"0.302799965003341"	"0.970525080472744"	"65.17"	"47.27"	"2.2"	"292.5"	"5.3"	"41.21"	"54.38"	"37.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0006486"	"0.001833"	"1.79"	"45.21"
"18060"	"False"	"High"	"[K].FLVFDWNWR.[D]"	""	"0.00565525"	"0.0007621"	"1"	"1"	"13"	"Q9CZT6"	"Q9CZT6 [229-237]"	""	"0"	"1282.63675"	"197.021"	"7.287"	"0.390217367865002"	"0.906515362333117"	"78.70"	"73.92"	"1.4"	"287.3"	"11.2"	"58.77"	"46.24"	"45.34"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0001583"	"0.0004368"	"2.31"	"63.12"
"70014"	"False"	"High"	"[K].VYNYNHLMPTR.[Y]"	"1xOxidation [M8]"	"0.0026263"	"0.0007621"	"1"	"1"	"9"	"P61358"	"P61358 [74-84]"	""	"0"	"1423.67870"	"388.768"	"5.430"	"0.8990699468149"	"0.906515362333117"	"76.34"	"72.31"	"0.9"	"295.1"	"3.9"	"75.35"	"52.25"	"36.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0001583"	"0.0002141"	"2.31"	"26.29"
"34014"	"False"	"High"	"[K].LKYFFAVDTAYVAK.[K]"	"1xBiotin [K2]"	"0.0186164"	"0.0007621"	"1"	"1"	"4"	"Q91XB7"	"Q91XB7 [91-104]"	"Q91XB7 1xBiotin [K92]"	"1"	"1861.95570"	"0.822"	"1.579"	"0.949662611758987"	"0.97278318745796"	"76.83"	"86.37"	"74.8"	"63.4"	"161.8"	"60.19"	"34.24"	"35.90"	""	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0005416"	"0.001283"	"2.11"	"58.23"
"19065"	"False"	"High"	"[R].FWYFVSQLKK.[M]"	""	"0.00998601"	"0.0007621"	"1"	"1"	"26"	"P62717"	"P62717 [44-53]"	""	"1"	"1345.73032"	"88.402"	"1.572"	"0.967871122183686"	"0.937945192250145"	"83.29"	"82.23"	"3.7"	"290.9"	"5.4"	"64.12"	"56.24"	"60.73"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0002502"	"0.0007294"	"2.45"	"48.58"
"1681"	"False"	"High"	"[R].AHVTGASSSSSSSTKGTYFPAILNPPPSPATER.[S]"	"1xBiotin [K15]"	"0.0223869"	"0.0007621"	"1"	"1"	"3"	"O88572"	"O88572 [1463-1495]"	"O88572 1xBiotin [K1477]"	"1"	"3528.70637"	"1.519"	"1.250"	""	"0.906515362333117"	"59.15"	"80.99"	"76.3"	"119.0"	"104.6"	"34.27"	"46.81"	"85.24"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0006427"	"0.001519"	"3.52"	"50.05"
"1526"	"False"	"High"	"[K].AGSKGGNLR.[D]"	"1xBiotin [K4]"	"0.0152863"	"0.0007621"	"1"	"1"	"10"	"Q922Q8"	"Q922Q8 [4-12]"	"Q922Q8 1xBiotin [K7]"	"1"	"1085.55204"	"0.066"	"0.804"	"0.00556263292220494"	"0.906515362333117"	"47.26"	"39.44"	"162.5"	"9.4"	"128.1"	"25.09"	"32.56"	"28.39"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0004044"	"0.001074"	"2.88"	"25.20"
"14728"	"False"	"High"	"[K].ENQKFDVFK.[A]"	"1xBiotin [K4]"	"0.0356432"	"0.00113207"	"1"	"1"	"2"	"Q62426"	"Q62426 [31-39]"	"Q62426 1xBiotin [K34]"	"1"	"1380.66165"	"0.981"	"0.811"	"0.962122454074805"	"0.906515362333117"	"56.34"	"55.65"	"114.4"	"105.3"	"80.3"	"37.46"	"39.53"	"47.06"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.000718"	"0.002388"	"2.15"	"48.01"
"46371"	"False"	"High"	"[-].MPDPAKSAPAPK.[K]"	"1xBiotin [K6]; 1xMet-loss [N-Term]"	"0.0365221"	"0.00113207"	"1"	"1"	"4"	"Q64525"	"Q64525 [1-12]"	"Q64525 1xBiotin [K6]; 1xMet-loss [N-Term]"	"1"	"1304.66673"	"0.422"	"0.452"	"0.925138005747468"	"0.906515362333117"	"51.51"	"70.02"	"163.6"	"76.5"	"59.9"	"43.84"	"38.94"	"47.61"	""	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002451"	"2.20"	"27.20"
"29896"	"False"	"High"	"[R].KTDLSSHSQTSGILLSSMPSTSKMG.[-]"	"1xBiotin [K23]; 1xOxidation [M18]"	"0.0374222"	"0.00113207"	"1"	"1"	"1"	"Q61549"	"Q61549 [907-931]"	"Q61549 1xBiotin [K929]"	"2"	"2822.33689"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.00251"	"4.68"	""
"8804"	"False"	"High"	"[K].DNPKVVHAFDMEDLGDK.[A]"	"1xBiotin [K4]"	"0.0388131"	"0.00113207"	"1"	"1"	"3"	"Q91WS0"	"Q91WS0 [52-68]"	"Q91WS0 1xBiotin [K55]"	"1"	"2155.97870"	"0.629"	"0.959"	"0.925138005747468"	"0.906515362333117"	"68.43"	"75.41"	"110.4"	"72.3"	"117.3"	"55.98"	"24.96"	"43.13"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007557"	"0.002596"	"2.42"	"48.99"
"24244"	"False"	"High"	"[R].HFWGLR.[V]"	""	"0.0381115"	"0.00113207"	"1"	"1"	"44"	"P62270"	"P62270 [125-130]"	""	"0"	"815.43112"	"111.557"	"2.433"	"0.928611703535518"	"0.906515362333117"	"59.10"	"76.34"	"3.1"	"288.4"	"8.5"	"33.82"	"46.45"	"56.44"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007557"	"0.002555"	"2.00"	"35.23"
"32628"	"False"	"High"	"[K].IFSKHVAHVLNDETQR.[K]"	"1xBiotin [K4]"	"0.0367452"	"0.00113207"	"1"	"1"	"1"	"Q8BM39-1"	"Q8BM39-1 [297-312]"	"Q8BM39-1 1xBiotin [K300]"	"1"	"2120.07057"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002459"	"3.18"	""
"72063"	"False"	"High"	"[K].YNDTFWK.[E]"	""	"0.0374222"	"0.00113207"	"1"	"1"	"9"	"P08113"	"P08113 [480-486]"	""	"0"	"973.44141"	"195.225"	"5.243"	"0.925138005747468"	"0.906515362333117"	"74.74"	"60.99"	"1.7"	"289.7"	"8.6"	"58.81"	"51.29"	"27.31"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.000718"	"0.002512"	"1.61"	"38.12"
"2310"	"False"	"High"	"[R].ALLFVPR.[R]"	""	"0.0378804"	"0.00113207"	"1"	"1"	"14"	"P07901"	"P07901 [340-346]"	""	"0"	"815.51379"	"141.331"	"3.748"	"0.925138005747468"	"0.906515362333117"	"49.28"	"41.53"	"2.0"	"290.4"	"7.6"	"34.08"	"66.68"	"34.24"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000718"	"0.002544"	"2.12"	"43.26"
"18892"	"False"	"High"	"[K].FTPKYVLR.[A]"	"1xBiotin [K4]"	"0.0356432"	"0.00113207"	"1"	"2"	"13"	"P21619"	"P21619 [493-500]"	"P21619 1xBiotin [K496]"	"1"	"1249.67618"	"0.033"	"1.012"	"3.32855222149461E-05"	"0.916215054610739"	"64.16"	"61.75"	"142.8"	"5.2"	"152.0"	"41.90"	"61.11"	"54.36"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.00238"	"2.02"	"45.39"
"39736"	"False"	"High"	"[R].LYSVSYLLK.[D]"	""	"0.0356432"	"0.00113207"	"1"	"1"	"1"	"Q8BTM8"	"Q8BTM8 [2613-2621]"	""	"0"	"1085.62412"	"97.239"	"2.132"	"0.391538127159586"	"0.972080525334499"	"42.44"	"62.38"	"3.2"	"290.1"	"6.7"	"38.48"	"21.08"	"42.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000718"	"0.002379"	"1.36"	"47.87"
"56806"	"False"	"High"	"[R].RKPQQQYAKK.[T]"	"1xBiotin [K]"	"0.0392878"	"0.00113207"	"1"	"1"	"7"	"Q8VBT0"	"Q8VBT0 [212-221]"	"Q8VBT0 1xBiotin [K]"	"2"	"1500.81038"	"0.172"	"0.627"	"0.390636537541388"	"0.906515362333117"	"65.70"	"65.59"	"162.5"	"30.7"	"106.8"	"53.38"	"26.33"	"36.92"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007557"	"0.002645"	"3.33"	"17.91"
"22633"	"False"	"High"	"[K].GQQGWWR.[G]"	""	"0.0385778"	"0.00113207"	"1"	"1"	"9"	"P27870"	"P27870 [816-822]"	""	"0"	"917.43766"	"148.854"	"4.877"	"0.925138005747468"	"0.906515362333117"	"44.19"	"59.25"	"2.1"	"289.7"	"8.2"	"28.62"	"38.25"	"43.43"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007557"	"0.002581"	"1.94"	"35.29"
"63011"	"False"	"High"	"[K].SWDIFFR.[N]"	""	"0.0390497"	"0.00113207"	"1"	"4"	"3"	"Q60597"	"Q60597 [75-81]"	""	"0"	"970.47813"	"125.971"	"3.866"	"0.929016530787821"	"0.906515362333117"	"61.72"	"67.32"	"2.4"	"288.5"	"9.1"	"70.97"	"25.53"	"25.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007557"	"0.002615"	"2.08"	"56.34"
"39498"	"False"	"High"	"[R].LWGWASPLR.[Q]"	""	"0.0365221"	"0.00113207"	"1"	"2"	"1"	"E9PZJ8-1"	"E9PZJ8-1 [1121-1129]"	""	"0"	"1085.58908"	"77.924"	"3.195"	"0.958614650351576"	"0.906515362333117"	"130.77"	"109.23"	"3.6"	"286.0"	"10.4"	"38.31"	"83.21"	"85.37"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.000718"	"0.00244"	"2.45"	"52.63"
"36528"	"False"	"High"	"[K].INVNEIFYDLVR.[Q]"	""	"0.0363004"	"0.00113207"	"1"	"2"	"3"	"Q99JI6"	"Q99JI6 [152-163]"	""	"0"	"1494.79510"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.000718"	"0.002433"	"2.18"	""
"67205"	"False"	"High"	"[K].VFVSVTKYPDEK.[R]"	"1xBiotin [K7]"	"0.0392878"	"0.00113207"	"1"	"2"	"1"	"Q9D6K9"	"Q9D6K9 [95-106]"	"Q9D6K9 1xBiotin [K101]"	"1"	"1637.82436"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007557"	"0.002639"	"2.52"	""
"60049"	"False"	"High"	"[R].SKFIGYTLGSDTNTVVGLPRPIHESIK.[T]"	"1xBiotin [K2]"	"0.0376506"	"0.00113207"	"1"	"3"	"3"	"Q8C079"	"Q8C079 [442-468]"	"Q8C079 1xBiotin [K443]"	"1"	"3155.65578"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002528"	"2.60"	""
"67737"	"False"	"High"	"[K].VLAAVYK.[A]"	""	"0.0381115"	"0.00113207"	"2"	"3"	"3"	"P05063; P05064"	"P05063 [209-215]; P05064 [209-215]"	""	"0"	"763.47125"	"90.552"	"2.483"	"0.97864233222105"	"0.915242122105656"	"43.19"	"33.73"	"3.3"	"288.8"	"8.0"	"24.92"	"36.42"	"21.47"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000718"	"0.002551"	"1.84"	"25.57"
"50500"	"False"	"High"	"[R].NIGKTLVTR.[T]"	"1xBiotin [K4]"	"0.0381115"	"0.00113207"	"1"	"1"	"2"	"P97351"	"P97351 [43-51]"	"P97351 1xBiotin [K46]"	"1"	"1227.68780"	"0.250"	"0.714"	"0.925138005747468"	"0.906515362333117"	"87.80"	"96.71"	"157.5"	"30.1"	"112.4"	"62.42"	"64.71"	"43.10"	""	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.000718"	"0.002551"	"2.05"	"39.00"
"28721"	"False"	"High"	"[K].KPAAAAGAKK.[AV]"	"1xBiotin [K9]"	"0.0367452"	"0.00113207"	"1"	"2"	"3"	"P43277"	"P43277 [161-170]"	"P43277 1xBiotin [K169]"	"1"	"1138.64012"	"0.409"	"0.748"	"0.925138005747468"	"0.906515362333117"	"55.02"	"57.73"	"144.7"	"57.2"	"98.0"	"40.25"	"34.16"	"40.74"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000718"	"0.002459"	"2.77"	"16.52"
"69960"	"False"	"High"	"[K].VYAYGLALK.[H]"	""	"0.0392878"	"0.00113207"	"1"	"1"	"9"	"Q9JKX6"	"Q9JKX6 [196-204]"	""	"0"	"997.57169"	"162.667"	"3.288"	"0.925138005747468"	"0.906515362333117"	"84.48"	"76.33"	"1.7"	"293.2"	"5.1"	"53.35"	"59.72"	"51.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007557"	"0.002638"	"1.62"	"40.51"
"34157"	"False"	"High"	"[K].LLCGLLSDR.[L]"	"1xCarbamidomethyl [C3]"	"0.0354267"	"0.00113207"	"1"	"1"	"4"	"P34884"	"P34884 [79-87]"	""	"0"	"1046.56629"	"66.426"	"1.506"	"0.558644691043429"	"0.916215054610739"	"64.41"	"52.50"	"4.5"	"288.6"	"6.9"	"36.34"	"56.16"	"40.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.000718"	"0.002377"	"2.07"	"43.64"
"32987"	"False"	"High"	"[K].LGLHSLR.[HQ]"	""	"0.0388131"	"0.00113207"	"1"	"3"	"8"	"P61205"	"P61205 [143-149]"	""	"0"	"795.48355"	"143.338"	"4.005"	"0.925138005747468"	"0.906515362333117"	"59.70"	"47.26"	"1.7"	"290.6"	"7.7"	"45.46"	"43.82"	"26.21"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007557"	"0.002607"	"1.93"	"25.48"
"52556"	"False"	"High"	"[K].QDGPLPKPHSVSLNDTETR.[K]"	"1xBiotin [K7]"	"0.0383439"	"0.00113207"	"1"	"1"	"2"	"Q9WV55"	"Q9WV55 [155-173]"	"Q9WV55 1xBiotin [K161]"	"0"	"2317.12412"	"1.072"	"1.850"	"0.925138005747468"	"0.977260755902588"	"67.22"	"61.55"	"77.7"	"94.3"	"128.0"	"44.61"	"39.96"	"31.74"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0007557"	"0.002578"	"2.56"	"39.62"
"19451"	"False"	"High"	"[R].GANFITQILLRPGASDLTGSFR.[L]"	""	"0.035861"	"0.00113207"	"1"	"1"	"2"	"O70152"	"O70152 [167-188]"	""	"0"	"2334.25645"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.0024"	"2.51"	""
"10634"	"False"	"High"	"[K].EAQTSFLHLGYLPNQLFR.[T]"	""	"0.0383439"	"0.00113207"	"1"	"1"	"1"	"Q91VR5"	"Q91VR5 [721-738]"	""	"0"	"2134.10800"	"0.905"	"1.464"	""	"0.906777072223237"	"68.06"	"78.71"	"93.2"	"92.8"	"114.0"	"45.15"	"48.01"	"71.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007557"	"0.002567"	"3.24"	"58.89"
"61000"	"False"	"High"	"[K].SMLALLLGR.[T]"	""	"0.0392878"	"0.00113207"	"1"	"1"	"2"	"Q9CXV9"	"Q9CXV9 [164-172]"	""	"0"	"973.58630"	"72.256"	"1.572"	"0.486459598296651"	"0.916215054610739"	"68.10"	"68.72"	"4.0"	"289.6"	"6.4"	"22.78"	"76.23"	"62.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"0.0007557"	"0.002634"	"1.65"	"59.98"
"71652"	"False"	"High"	"[K].YKDGTELELK.[E]"	"1xBiotin [K2]"	"0.035861"	"0.00113207"	"1"	"1"	"1"	"Q3U9G9"	"Q3U9G9 [41-50]"	"Q3U9G9 1xBiotin [K42]"	"1"	"1421.69809"	"0.391"	"0.596"	"0.925138005747468"	"0.906515362333117"	"89.06"	"82.94"	"144.1"	"55.9"	"99.9"	"68.89"	"48.71"	"32.73"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002405"	"2.03"	"40.51"
"68158"	"False"	"High"	"[K].VLPIFYFAR.[E]"	""	"0.0367452"	"0.00113207"	"1"	"2"	"10"	"Q3UJD6"	"Q3UJD6 [724-732]"	""	"0"	"1125.64553"	"102.164"	"3.096"	"0.427089858136149"	"0.906515362333117"	"77.94"	"73.89"	"3.2"	"287.1"	"9.7"	"57.05"	"41.98"	"51.63"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002455"	"1.82"	"60.52"
"27082"	"False"	"High"	"[R].KGNYSER.[V]"	"1xBiotin [K1]"	"0.035861"	"0.00113207"	"1"	"5"	"5"	"Q8BFU2"	"Q8BFU2 [37-43]"	"Q8BFU2 1xBiotin [K37]"	"1"	"1079.49385"	"0.098"	"0.696"	"0.925138005747468"	"0.906515362333117"	"71.58"	"66.68"	"171.1"	"15.8"	"113.1"	"29.85"	"60.76"	"76.94"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.000718"	"0.002401"	"1.70"	"22.86"
"41608"	"False"	"High"	"[-].MAVSTGVKVPR.[N]"	"1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"0.0367452"	"0.00113207"	"1"	"2"	"5"	"Q9D2M8"	"Q9D2M8 [1-11]"	"Q9D2M8 1xBiotin [K8]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1281.69837"	"0.368"	"0.632"	"0.925138005747468"	"0.906515362333117"	"92.10"	"83.77"	"170.3"	"45.0"	"84.6"	"57.46"	"53.14"	"72.11"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.000718"	"0.002459"	"2.10"	"41.09"
"43618"	"False"	"High"	"[K].MGFAVLLVNYR.[G]"	""	"0.0392878"	"0.00113207"	"1"	"2"	"1"	"Q8R146"	"Q8R146 [528-538]"	""	"0"	"1282.69764"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007557"	"0.002636"	"1.89"	""
"63970"	"False"	"High"	"[R].TGKTSTWSGESK.[T]"	"1xBiotin [K3]"	"0.03608"	"0.00113207"	"1"	"1"	"1"	"P09405"	"P09405 [476-487]"	"P09405 1xBiotin [K478]"	"1"	"1494.68932"	"0.828"	"0.653"	"0.945683295219289"	"0.906515362333117"	"52.56"	"86.59"	"112.0"	"99.4"	"88.7"	"52.84"	"20.54"	"64.58"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002416"	"2.72"	"31.92"
"70957"	"False"	"High"	"[K].YAISMAR.[K]"	""	"0.0376506"	"0.00113207"	"1"	"1"	"5"	"Q61233"	"Q61233 [585-591]"	""	"0"	"811.41309"	"114.532"	"16.474"	"0.948231728421465"	"0.906515362333117"	"96.07"	"65.11"	"2.3"	"263.9"	"33.8"	"78.27"	"57.87"	"44.13"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000718"	"0.002522"	"1.82"	"28.69"
"31312"	"False"	"High"	"[R].LAYAIIQFLHGQLR.[H]"	""	"0.035861"	"0.00113207"	"1"	"2"	"4"	"Q8BJU0-1"	"Q8BJU0-1 [7-20]"	""	"0"	"1642.94277"	"1.500"	"1.575"	"0.925138005747468"	"0.923750342545975"	"92.54"	"59.82"	"79.0"	"108.3"	"112.7"	"34.94"	"191.08"	"52.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.000718"	"0.002403"	"2.49"	"59.64"
"21186"	"False"	"High"	"[K].GKNEDIDR.[V]"	"1xBiotin [K2]"	"0.0369695"	"0.00113207"	"1"	"2"	"8"	"Q3UPF5-1"	"Q3UPF5-1 [381-388]"	"Q3UPF5-1 1xBiotin [K382]"	"1"	"1172.53645"	"0.204"	"0.723"	"0.925138005747468"	"0.906515362333117"	"39.06"	"74.22"	"149.5"	"31.9"	"118.6"	"34.27"	"24.34"	"61.54"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.000718"	"0.002478"	"2.06"	"26.55"
"2605"	"False"	"High"	"[K].ALSSKADSLLLK.[S]"	"1xBiotin [K5]"	"0.0374222"	"0.00113207"	"1"	"3"	"7"	"A6PWY4-1"	"A6PWY4-1 [101-112]"	"A6PWY4-1 1xBiotin [K105]"	"1"	"1471.81888"	"0.441"	"0.693"	"0.925138005747468"	"0.906515362333117"	"96.25"	"108.43"	"137.9"	"67.4"	"94.6"	"76.04"	"32.86"	"89.34"	""	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.000718"	"0.002513"	"2.77"	"49.98"
"46901"	"False"	"High"	"[R].MQHLIAR.[E]"	"1xOxidation [M1]"	"0.0381115"	"0.00113207"	"1"	"2"	"3"	"P52480"	"P52480 [377-383]"	""	"0"	"884.47708"	"13.114"	"0.895"	"0.922948428525857"	"0.906515362333117"	"461.21"	"58.75"	"22.3"	"259.5"	"18.2"	"24.86"	"116.80"	"51.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0007557"	"0.002561"	"1.90"	"15.18"
"70266"	"False"	"High"	"[R].WFPFLYPNQVYR.[L]"	""	"0.0363004"	"0.00113207"	"1"	"3"	"5"	"Q5SUQ9-1"	"Q5SUQ9-1 [802-813]"	""	"0"	"1629.82126"	"72.021"	"1.735"	"0.463973682624453"	"0.970525080472744"	"44.97"	"41.40"	"4.0"	"288.8"	"7.2"	"35.50"	"46.38"	"24.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000718"	"0.002428"	"2.09"	"61.37"
"16328"	"False"	"High"	"[K].ETYKTAK.[L]"	"1xBiotin [K4]"	"0.0371952"	"0.00113207"	"1"	"1"	"24"	"Q7TQ95"	"Q7TQ95 [127-133]"	"Q7TQ95 1xBiotin [K130]"	"1"	"1066.52376"	"0.009"	"0.967"	"6.39887481190815E-06"	"0.909618829834038"	"50.83"	"34.17"	"143.8"	"1.4"	"154.8"	"47.01"	"31.91"	"27.12"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002489"	"2.08"	"24.90"
"72231"	"False"	"High"	"[R].YQGSYWK.[A]"	""	"0.0363004"	"0.00113207"	"1"	"2"	"8"	"Q3TBT3"	"Q3TBT3 [77-83]"	""	"0"	"931.43084"	"184.193"	"4.561"	"0.925138005747468"	"0.906515362333117"	"75.00"	"75.06"	"1.8"	"290.4"	"7.9"	"69.09"	"24.15"	"31.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002431"	"1.41"	"27.95"
"39469"	"False"	"High"	"[R].IVYLYTK.[K]"	""	"0.0363004"	"0.00113207"	"1"	"1"	"12"	"Q9D1R9"	"Q9D1R9 [30-36]"	""	"0"	"899.52368"	"215.627"	"5.012"	"0.925138005747468"	"0.906515362333117"	"68.76"	"90.27"	"1.2"	"293.0"	"5.8"	"56.99"	"31.94"	"86.48"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002428"	"1.44"	"33.30"
"37257"	"False"	"High"	"[R].LQKDTACK.[E]"	"1xBiotin [K3]; 1xCarbamidomethyl [C7]"	"0.03608"	"0.00113207"	"1"	"2"	"4"	"Q64281"	"Q64281 [308-315]"	"Q64281 1xBiotin [K310]"	"1"	"1189.57039"	"0.154"	"0.607"	"0.925138005747468"	"0.906515362333117"	"68.62"	"51.51"	"173.4"	"24.1"	"102.5"	"37.39"	"53.94"	"42.69"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.000718"	"0.002418"	"2.44"	"25.21"
"70262"	"False"	"High"	"[R].WFLQHRPQVGYIR.[V]"	""	"0.0363004"	"0.00113207"	"1"	"2"	"2"	"Q9Z1T2"	"Q9Z1T2 [885-897]"	""	"0"	"1699.91795"	"7.302"	"2.269"	"0.925138005747468"	"0.937072062058245"	"168.44"	"81.84"	"38.9"	"189.7"	"71.4"	"40.59"	"161.83"	"96.56"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000718"	"0.002435"	"2.44"	"40.56"
"70265"	"False"	"High"	"[R].WFNTCVR.[Q]"	"1xCarbamidomethyl [C5]"	"0.035861"	"0.00113207"	"1"	"1"	"13"	"Q9Z1Q9"	"Q9Z1Q9 [190-196]"	""	"0"	"982.45635"	"98.214"	"3.578"	"0.947989303413716"	"0.906515362333117"	"47.18"	"38.21"	"2.9"	"288.2"	"8.9"	"24.55"	"37.50"	"31.79"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002407"	"1.62"	"35.45"
"30302"	"False"	"High"	"[R].KVLQLLR.[L]"	""	"0.0390497"	"0.00113207"	"1"	"1"	"7"	"P14148"	"P14148 [129-135]"	""	"1"	"869.59310"	"408.652"	"11.930"	"0.925138005747468"	"0.906515362333117"	"49.60"	"72.58"	"0.8"	"289.2"	"10.0"	"102.95"	"34.80"	"61.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007557"	"0.002621"	"2.23"	"31.54"
"64980"	"False"	"High"	"[R].TMNNFLDR.[E]"	"1xOxidation [M2]"	"0.0385778"	"0.00113207"	"1"	"4"	"1"	"Q61495"	"Q61495 [220-227]"	""	"0"	"1026.46731"	"1.008"	"0.901"	"0.994201151226993"	""	"52.04"	"46.28"	"111.3"	"99.7"	"88.9"	"30.72"	"231.50"	"27.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007557"	"0.002586"	"2.21"	"28.23"
"1066"	"False"	"High"	"[R].AFGSGYR.[R]"	""	"0.0354267"	"0.00113207"	"1"	"1"	"18"	"Q8BGD9"	"Q8BGD9 [280-286]"	""	"0"	"757.36276"	"100.310"	"2.458"	"0.944967096116098"	"0.906515362333117"	"60.69"	"62.48"	"3.1"	"287.5"	"9.4"	"47.04"	"60.65"	"39.86"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.000718"	"0.002375"	"1.53"	"21.12"
"21954"	"False"	"High"	"[R].GMITKQAK.[K]"	"1xBiotin [K5]; 1xOxidation [M2]"	"0.0367452"	"0.00113207"	"1"	"1"	"11"	"P63087"	"P63087 [315-322]"	"P63087 1xBiotin [K319]"	"1"	"1118.56966"	"0.138"	"1.036"	"0.0124809189051884"	"0.906515362333117"	"90.25"	"52.07"	"143.3"	"16.2"	"140.5"	"50.83"	"236.21"	"16.46"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000718"	"0.002454"	"2.73"	"25.17"
"20001"	"False"	"High"	"[R].GEALSALDSKANNLSSLSKK.[Y]"	"1xBiotin [K10]"	"0.0397681"	"0.00151174"	"1"	"1"	"2"	"O08547"	"O08547 [160-179]"	"O08547 1xBiotin [K169]"	"2"	"2259.16492"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0007894"	"0.002667"	"2.23"	""
"70659"	"False"	"High"	"[R].WQFLTLR.[E]"	""	"0.0400104"	"0.00151174"	"1"	"1"	"4"	"Q8BMJ2"	"Q8BMJ2 [222-228]"	""	"0"	"963.54106"	"179.881"	"5.091"	"0.925138005747468"	"0.906515362333117"	"59.35"	"53.03"	"2.1"	"288.8"	"9.1"	"38.37"	"48.38"	"37.19"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002691"	"1.72"	"52.42"
"69766"	"False"	"High"	"[K].VVITKVVTHPFK.[T]"	"1xBiotin [K5]"	"0.0397681"	"0.00151174"	"1"	"1"	"2"	"Q61093"	"Q61093 [295-306]"	"Q61093 1xBiotin [K299]"	"1"	"1593.91853"	"0.522"	"0.845"	"0.925138005747468"	"0.906515362333117"	"63.11"	"64.18"	"121.0"	"70.9"	"108.0"	"48.50"	"43.92"	"59.45"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002668"	"2.29"	"43.85"
"17371"	"False"	"High"	"[K].FGGAFCR.[Y]"	"1xCarbamidomethyl [C6]"	"0.0395272"	"0.00151174"	"1"	"1"	"7"	"O35295"	"O35295 [280-286]"	""	"0"	"814.36647"	"126.282"	"4.892"	"0.929016530787821"	"0.906515362333117"	"89.35"	"81.10"	"2.4"	"287.3"	"10.3"	"57.92"	"78.44"	"49.87"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002659"	"1.88"	"27.28"
"39610"	"False"	"High"	"[R].LYFSTCPFR.[Q]"	"1xCarbamidomethyl [C6]"	"0.0395272"	"0.00151174"	"1"	"1"	"10"	"Q99P88"	"Q99P88 [368-376]"	""	"0"	"1190.56629"	"157.083"	"4.038"	"0.925138005747468"	"0.906515362333117"	"53.28"	"42.36"	"2.0"	"290.6"	"7.4"	"49.02"	"30.11"	"18.95"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002662"	"1.85"	"45.71"
"67131"	"False"	"High"	"[R].VFIGNLNTLVVK.[K]"	""	"0.0400104"	"0.00151174"	"1"	"5"	"5"	"Q9Z204"	"Q9Z204 [18-29]"	""	"0"	"1316.79365"	"59.828"	"1.472"	"0.925138005747468"	"0.909223670800027"	"76.42"	"65.01"	"3.9"	"290.7"	"5.4"	"30.82"	"57.62"	"61.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002696"	"2.44"	"50.35"
"37971"	"False"	"High"	"[K].LSGFWQLVVDEK.[R]"	""	"0.0397681"	"0.00151174"	"1"	"1"	"3"	"E9PVA8"	"E9PVA8 [510-521]"	""	"0"	"1420.74709"	"35.037"	"1.096"	"0.925138005747468"	"0.906515362333117"	"48.38"	"43.05"	"9.6"	"281.6"	"8.8"	"24.41"	"87.54"	"36.38"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.002674"	"2.24"	"58.92"
"69434"	"False"	"High"	"[K].VTEKCPK.[L]"	"1xBiotin [K4]; 1xCarbamidomethyl [C5]"	"0.0397681"	"0.00151174"	"1"	"1"	"12"	"Q9D0T2"	"Q9D0T2 [186-192]"	"Q9D0T2 1xBiotin [K189]"	"1"	"1087.52746"	"0.185"	"0.746"	"0.00377588650983478"	"0.906515362333117"	"202.36"	"27.15"	"140.7"	"47.2"	"112.1"	"76.26"	"122.55"	"17.73"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002678"	"1.99"	"22.62"
"72631"	"False"	"High"	"[R].YVYYYSYLLK.[N]"	""	"0.0454434"	"0.00184333"	"1"	"1"	"3"	"O08586"	"O08586 [174-183]"	""	"0"	"1374.69802"	"69.818"	"1.194"	"0.473434885252538"	"0.906515362333117"	"81.71"	"70.14"	"5.3"	"289.2"	"5.5"	"50.09"	"68.26"	"60.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003073"	"2.06"	"52.23"
"21953"	"False"	"High"	"[R].GMITKQAK.[K]"	"1xBiotin [K5]"	"0.0420013"	"0.00184333"	"1"	"1"	"10"	"P63087"	"P63087 [315-322]"	"P63087 1xBiotin [K319]"	"1"	"1102.57475"	"0.039"	"0.644"	"0.000268276722094823"	"0.906515362333117"	"50.83"	"30.44"	"180.4"	"6.7"	"112.9"	"18.58"	"42.00"	"22.66"	""	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002828"	"2.17"	"31.59"
"67431"	"False"	"High"	"[K].VHFFNSFFYDK.[L]"	""	"0.0440883"	"0.00184333"	"1"	"1"	"1"	"Q9EP97"	"Q9EP97 [416-426]"	""	"0"	"1450.67901"	"45.231"	"1.382"	"0.925138005747468"	"0.906515362333117"	"29.05"	"36.00"	"6.7"	"284.6"	"8.7"	"17.38"	"21.81"	"28.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.002987"	"2.62"	"49.96"
"22005"	"False"	"High"	"[K].GMTGIWR.[Y]"	""	"0.0412437"	"0.00184333"	"1"	"1"	"26"	"Q9QYB1"	"Q9QYB1 [213-219]"	""	"0"	"820.41342"	"44.049"	"5.997"	"0.925138005747468"	"0.906515362333117"	"63.73"	"45.67"	"6.2"	"257.1"	"36.7"	"25.33"	"80.91"	"37.53"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.00277"	"1.84"	"35.94"
"39532"	"False"	"High"	"[R].IWPLYLR.[F]"	""	"0.0404994"	"0.00184333"	"1"	"1"	"9"	"Q9DCD2"	"Q9DCD2 [148-154]"	""	"0"	"960.56655"	"112.411"	"3.435"	"0.949662611758987"	"0.906515362333117"	"48.07"	"31.98"	"2.5"	"288.3"	"9.2"	"33.62"	"40.62"	"16.72"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002728"	"1.50"	"51.57"
"39396"	"False"	"High"	"[R].LVSYYYFLR.[F]"	""	"0.0404994"	"0.00184333"	"1"	"1"	"3"	"Q8R3H7"	"Q8R3H7 [170-178]"	""	"0"	"1223.64592"	"86.071"	"1.379"	"0.500128584021012"	"0.906515362333117"	"74.14"	"56.71"	"3.0"	"293.0"	"4.0"	"46.79"	"59.52"	"43.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.002723"	"2.04"	"53.24"
"38032"	"False"	"High"	"[R].LSKEYDR.[L]"	"1xBiotin [K3]"	"0.0427724"	"0.00184333"	"1"	"1"	"7"	"Q61334"	"Q61334 [214-220]"	"Q61334 1xBiotin [K216]"	"1"	"1136.54047"	"0.165"	"0.566"	"0.53012019938047"	"0.906515362333117"	"96.48"	"100.12"	"178.4"	"25.1"	"96.4"	"65.80"	"34.38"	"80.68"	""	"High"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.0007894"	"0.002884"	"1.75"	"31.07"
"18128"	"False"	"High"	"[K].FMDQHPEMDFSKAK.[F]"	"1xBiotin [K]; 2xOxidation [M2; M8]"	"0.0440883"	"0.00184333"	"1"	"1"	"7"	"O35685"	"O35685 [317-330]"	"O35685 1xBiotin [K]"	"1"	"1968.82887"	"0.325"	"0.885"	"0.925138005747468"	"0.906515362333117"	"55.89"	"39.16"	"133.7"	"47.8"	"118.4"	"39.43"	"37.64"	"25.47"	""	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0007894"	"0.002987"	"2.05"	"33.97"
"72639"	"False"	"High"	"[K].YWETKQAFIK.[A]"	"1xBiotin [K5]"	"0.0454434"	"0.00184333"	"1"	"2"	"1"	"P97411-1"	"P97411-1 [29-38]"	"P97411-1 1xBiotin [K33]"	"1"	"1539.76645"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003083"	"1.74"	""
"23792"	"False"	"High"	"[K].GYGFGLIK.[L]"	""	"0.0402542"	"0.00184333"	"1"	"2"	"11"	"Q60932-1"	"Q60932-1 [34-41]"	""	"0"	"854.47707"	"135.278"	"3.187"	"0.925138005747468"	"0.906515362333117"	"44.65"	"50.05"	"1.9"	"291.2"	"6.8"	"42.15"	"25.20"	"23.00"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002713"	"1.57"	"43.41"
"72074"	"False"	"High"	"[R].YNGLIHR.[K]"	""	"0.040746"	"0.00184333"	"1"	"1"	"14"	"P41105"	"P41105 [40-46]"	""	"0"	"872.47371"	"117.442"	"4.428"	"0.947989303413716"	"0.906515362333117"	"76.13"	"69.56"	"2.9"	"282.1"	"15.0"	"58.90"	"75.45"	"34.13"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002738"	"1.75"	"20.53"
"18055"	"False"	"High"	"[R].FLTVMMK.[H]"	"2xOxidation [M5; M6]"	"0.043822"	"0.00184333"	"1"	"1"	"3"	"P62245"	"P62245 [37-43]"	""	"0"	"901.45217"	"322.921"	"1.922"	"0.925138005747468"	"0.991421065300711"	"72.85"	"46.82"	"1.0"	"297.3"	"1.7"	"34.12"	"53.81"	"40.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002952"	"1.58"	"26.42"
"38107"	"False"	"High"	"[K].LSIIFPLWK.[L]"	""	"0.0430325"	"0.00184333"	"1"	"2"	"4"	"Q61194-1"	"Q61194-1 [1473-1481]"	""	"0"	"1116.68158"	"19.567"	"0.880"	"0.925138005747468"	"0.906515362333117"	"113.06"	"64.27"	"14.9"	"273.9"	"11.2"	"38.71"	"83.91"	"42.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.002904"	"1.88"	"62.60"
"67866"	"False"	"High"	"[R].VLFGFLYR.[K]"	""	"0.0435573"	"0.00184333"	"1"	"3"	"3"	"Q8R1N4"	"Q8R1N4 [29-36]"	""	"0"	"1014.57711"	"84.901"	"1.304"	"0.47240665661602"	"0.920195905108535"	"77.35"	"66.12"	"4.3"	"289.3"	"6.4"	"36.26"	"77.86"	"48.95"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002939"	"1.60"	"57.06"
"17907"	"False"	"High"	"[R].FINFFR.[R]"	""	"0.0457192"	"0.00184333"	"1"	"1"	"18"	"Q8BGQ7"	"Q8BGQ7 [14-19]"	""	"0"	"843.45119"	"108.994"	"3.001"	"0.929016530787821"	"0.906515362333117"	"54.90"	"63.01"	"2.8"	"289.8"	"7.4"	"44.85"	"22.66"	"23.44"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003105"	"1.61"	"49.22"
"138"	"False"	"High"	"[K].AAGQKAAPPAK.[G]"	"1xBiotin [K5]"	"0.043822"	"0.00184333"	"1"	"1"	"1"	"Q9CR57"	"Q9CR57 [185-195]"	"Q9CR57 1xBiotin [K189]"	"1"	"1235.65650"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002967"	"2.46"	""
"72311"	"False"	"High"	"[R].YRPGTVALREIRR.[Y]"	""	"0.0432941"	"0.00184333"	"1"	"4"	"3"	"P84244"	"P84244 [42-54]"	""	"2"	"1586.92377"	"219.039"	"1.273"	"0.925138005747468"	"0.906515362333117"	"147.58"	"58.70"	"1.9"	"296.2"	"1.9"	"32.47"	"110.75"	"110.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.002918"	"2.58"	"28.17"
"23726"	"False"	"High"	"[R].GWLTINNISLMK.[G]"	"1xOxidation [M11]"	"0.0432941"	"0.00184333"	"1"	"2"	"1"	"P39054-1"	"P39054-1 [524-535]"	""	"0"	"1405.75080"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002927"	"2.06"	""
"38708"	"False"	"High"	"[R].LTLKGTQK.[K]"	"1xBiotin [K4]"	"0.0427724"	"0.00184333"	"1"	"1"	"7"	"O35166"	"O35166 [156-163]"	"O35166 1xBiotin [K159]"	"1"	"1114.62889"	"0.127"	"0.733"	"0.0990400127560103"	"0.906515362333117"	"26.95"	"32.29"	"164.2"	"20.8"	"115.0"	"24.44"	"19.71"	"23.88"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002885"	"2.51"	"34.89"
"72656"	"False"	"High"	"[K].YWSCCR.[R]"	"2xCarbamidomethyl [C4; C5]"	"0.0435573"	"0.00184333"	"1"	"1"	"15"	"Q9D1P4"	"Q9D1P4 [191-196]"	""	"0"	"931.35492"	"68.388"	"3.191"	"0.989440770281069"	"0.906515362333117"	"62.62"	"42.92"	"4.8"	"280.1"	"15.2"	"38.01"	"47.02"	"21.72"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002938"	"0.95"	"21.83"
"7536"	"False"	"High"	"[K].DGEKSAIRV.[-]"	"1xBiotin [K4]"	"0.0440883"	"0.00184333"	"1"	"1"	"9"	"Q8BLX4"	"Q8BLX4 [355-363]"	"Q8BLX4 1xBiotin [K358]"	"2"	"1200.60413"	"0.110"	"1.040"	"0.00605946209573384"	"0.906515362333117"	"55.48"	"40.43"	"139.8"	"15.0"	"145.3"	"47.17"	"39.59"	"36.55"	""	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002976"	"2.80"	"39.24"
"23756"	"False"	"High"	"[K].GYAFIEFASFEDAK.[E]"	""	"0.0451692"	"0.00184333"	"1"	"1"	"2"	"P09405"	"P09405 [525-538]"	""	"0"	"1594.74240"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003051"	"2.20"	""
"27626"	"False"	"High"	"[R].KLDELYGTWR.[K]"	""	"0.0402542"	"0.00184333"	"1"	"1"	"7"	"Q9D8E6"	"Q9D8E6 [259-268]"	""	"1"	"1280.66336"	"84.185"	"2.948"	"0.466031980976297"	"0.906515362333117"	"71.86"	"69.94"	"4.3"	"285.9"	"9.8"	"29.10"	"72.63"	"65.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.002705"	"2.81"	"38.85"
"12044"	"False"	"High"	"[K].EFLSKPTV.[-]"	"1xBiotin [K5]"	"0.0446255"	"0.00184333"	"1"	"1"	"9"	"P47713"	"P47713 [741-748]"	"P47713 1xBiotin [K745]"	"0"	"1146.58636"	"0.073"	"0.869"	"0.00544405587547966"	"0.906515362333117"	"77.90"	"24.73"	"150.1"	"10.9"	"139.0"	"20.88"	"144.22"	"17.47"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003019"	"1.92"	"51.84"
"20646"	"False"	"High"	"[R].GGFNTFR.[D]"	""	"0.0430325"	"0.00184333"	"1"	"1"	"7"	"Q61656"	"Q61656 [503-509]"	""	"0"	"798.38931"	"143.863"	"4.390"	"0.925138005747468"	"0.906515362333117"	"56.76"	"84.24"	"2.0"	"288.5"	"9.6"	"47.62"	"40.91"	"57.20"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002909"	"2.04"	"28.62"
"43282"	"False"	"High"	"[K].MFIGGLSWDTTKK.[D]"	""	"0.0448966"	"0.00184333"	"1"	"4"	"2"	"Q60668-1"	"Q60668-1 [99-111]"	""	"1"	"1483.76136"	"0.836"	"2.084"	""	"0.969054191468458"	"55.60"	"79.32"	"83.9"	"61.1"	"155.0"	"39.21"	"48.53"	"63.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003047"	"2.73"	"46.06"
"16938"	"False"	"High"	"[K].FAQKIGGSER.[C]"	"1xBiotin [K4]"	"0.0427724"	"0.00184333"	"1"	"1"	"5"	"P97315"	"P97315 [109-118]"	"P97315 1xBiotin [K112]"	"1"	"1318.65723"	"0.205"	"0.529"	"0.925138005747468"	"0.906515362333117"	"91.08"	"90.07"	"186.9"	"32.7"	"80.4"	"64.34"	"64.18"	"87.20"	""	"High"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.00288"	"2.35"	"33.46"
"57944"	"False"	"High"	"[K].RSIQFVDWCPTGFK.[V]"	"1xCarbamidomethyl [C9]"	"0.0446255"	"0.00184333"	"1"	"2"	"1"	"P05213"	"P05213 [339-352]"	""	"1"	"1740.85264"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003027"	"3.03"	""
"17326"	"False"	"High"	"[K].FGANAILGVSLAVCKAGAVEKGVPLYR.[H]"	"1xCarbamidomethyl [C14]"	"0.0412437"	"0.00184333"	"1"	"1"	"1"	"P17182"	"P17182 [106-132]"	""	"2"	"2760.52292"	"1.035"	"1.872"	"0.206429832141868"	""	"47.62"	"43.55"	"74.9"	"73.1"	"152.1"	"31.88"	"241.65"	"32.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002779"	"2.39"	"56.51"
"28152"	"False"	"High"	"[K].KLSSAEETAFQTPKPSQTPSVPPLVK.[T]"	"1xBiotin [K]"	"0.0425139"	"0.00184333"	"1"	"1"	"6"	"Q8VCB1"	"Q8VCB1 [404-429]"	"Q8VCB1 1xBiotin [K]"	"1"	"2993.56523"	"0.510"	"0.993"	"0.947989303413716"	"0.916215054610739"	"45.37"	"59.49"	"116.4"	"62.0"	"121.6"	"52.89"	"37.02"	"44.50"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0007894"	"0.002869"	"2.64"	"45.86"
"20567"	"False"	"High"	"[R].GFYYYQR.[H]"	""	"0.0448966"	"0.00184333"	"1"	"2"	"6"	"P58281-1"	"P58281-1 [859-865]"	""	"0"	"996.45739"	"189.130"	"5.799"	"0.925138005747468"	"0.906515362333117"	"60.81"	"86.87"	"1.4"	"290.8"	"7.8"	"59.42"	"27.24"	"58.67"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003046"	"1.78"	"33.47"
"13934"	"False"	"High"	"[K].ELQSTFK.[-]"	"1xBiotin [K7]"	"0.0435573"	"0.00184333"	"1"	"1"	"20"	"Q9D8Y0"	"Q9D8Y0 [234-240]"	"Q9D8Y0 1xBiotin [K240]"	"0"	"1078.52376"	"0.029"	"0.721"	"5.72452664558786E-05"	"0.906515362333117"	"73.74"	"44.73"	"165.3"	"7.0"	"127.7"	"48.81"	"53.87"	"41.44"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002937"	"1.74"	"42.80"
"28189"	"False"	"High"	"[K].KLTSFFR.[G]"	""	"0.0402542"	"0.00184333"	"1"	"1"	"9"	"P70677"	"P70677 [138-144]"	""	"1"	"898.51451"	"140.066"	"5.368"	"0.925138005747468"	"0.906515362333117"	"77.61"	"90.50"	"2.0"	"288.0"	"10.0"	"62.47"	"35.27"	"84.17"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002699"	"2.14"	"34.70"
"3818"	"False"	"High"	"[R].ASGLVPNVVVLVATVR.[A]"	""	"0.043822"	"0.00184333"	"1"	"1"	"1"	"Q3V3R1"	"Q3V3R1 [729-744]"	""	"0"	"1593.96865"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002962"	"2.65"	""
"67036"	"False"	"High"	"[R].VEPSHKSK.[I]"	"1xBiotin [K6]"	"0.0427724"	"0.00184333"	"1"	"3"	"7"	"O55143-1"	"O55143-1 [678-685]"	"O55143-1 1xBiotin [K683]"	"1"	"1137.57210"	"0.067"	"0.695"	"0.00204679601758981"	"0.906515362333117"	"57.31"	"26.69"	"172.2"	"11.5"	"116.3"	"17.56"	"48.20"	"20.44"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002876"	"1.72"	"16.30"
"70121"	"False"	"High"	"[K].WASQYLK.[I]"	""	"0.040746"	"0.00184333"	"1"	"1"	"12"	"P57759"	"P57759 [200-206]"	""	"0"	"895.46723"	"134.693"	"3.527"	"0.925138005747468"	"0.906515362333117"	"46.33"	"57.43"	"2.5"	"288.6"	"8.9"	"37.55"	"36.81"	"43.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002734"	"2.42"	"33.08"
"28650"	"False"	"High"	"[R].KNPGVGNGDDEAAELMQQVK.[V]"	"1xBiotin [K1]"	"0.0409941"	"0.00184333"	"1"	"1"	"2"	"Q61166"	"Q61166 [182-201]"	"Q61166 1xBiotin [K182]"	"1"	"2326.08021"	"0.479"	"0.944"	"0.925138005747468"	"0.906515362333117"	"67.52"	"75.74"	"112.8"	"58.5"	"128.7"	"53.75"	"38.04"	"55.41"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.002751"	"3.06"	"47.33"
"64126"	"False"	"High"	"[R].TGWFPSNYVR.[E]"	""	"0.0404994"	"0.00184333"	"1"	"9"	"11"	"Q8K4I3"	"Q8K4I3 [205-214]"	""	"0"	"1226.59528"	"195.133"	"5.507"	"0.925138005747468"	"0.906515362333117"	"57.69"	"52.94"	"1.5"	"289.9"	"8.7"	"46.77"	"31.05"	"16.07"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002731"	"2.50"	"45.73"
"34610"	"False"	"High"	"[R].ILGTKQGEHRPSLHR.[F]"	"1xBiotin [K5]"	"0.0409941"	"0.00184333"	"1"	"1"	"8"	"Q60664"	"Q60664 [391-405]"	"Q60664 1xBiotin [K395]"	"1"	"1955.03921"	"0.031"	"0.593"	"6.55629500612738E-05"	"0.906515362333117"	"56.82"	"95.06"	"139.6"	"5.3"	"155.0"	"104.61"	"27.45"	"56.73"	""	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002757"	"1.80"	"28.55"
"71403"	"False"	"High"	"[K].YGAFVLGR.[S]"	""	"0.0425139"	"0.00184333"	"1"	"1"	"1"	"Q6NS46"	"Q6NS46 [1722-1729]"	""	"0"	"882.48321"	"78.025"	"2.207"	"0.478573781684308"	"0.959887698267764"	"54.89"	"56.40"	"3.5"	"287.5"	"9.0"	"33.83"	"78.01"	"52.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.002858"	"1.58"	"38.87"
"34304"	"False"	"High"	"[R].LLEEHAKLQASVR.[G]"	"1xBiotin [K7]"	"0.040746"	"0.00184333"	"1"	"1"	"2"	"Q61335"	"Q61335 [225-237]"	"Q61335 1xBiotin [K231]"	"1"	"1719.92105"	"0.435"	"0.779"	"0.925138005747468"	"0.906515362333117"	"45.71"	"38.21"	"134.3"	"58.4"	"107.3"	"32.24"	"35.19"	"21.46"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.002734"	"2.12"	"37.27"
"53057"	"False"	"High"	"[R].QFLWSFR.[L]"	""	"0.0430325"	"0.00184333"	"1"	"7"	"5"	"Q9QX11"	"Q9QX11 [147-153]"	""	"0"	"983.50976"	"70.354"	"2.170"	"0.925138005747468"	"0.975839779844258"	"58.74"	"68.85"	"4.4"	"286.3"	"9.2"	"46.15"	"39.57"	"60.75"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0007894"	"0.002911"	"1.99"	"52.80"
"1134"	"False"	"High"	"[R].AFPSYFSK.[G]"	""	"0.040746"	"0.00184333"	"1"	"1"	"4"	"Q9CQ69"	"Q9CQ69 [26-33]"	""	"0"	"946.46689"	"158.501"	"3.771"	"0.425904733810833"	"0.906515362333117"	"37.75"	"29.97"	"1.8"	"291.4"	"6.7"	"31.58"	"25.17"	"44.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.002739"	"1.97"	"39.03"
"69943"	"False"	"High"	"[R].VWNWQSR.[T]"	""	"0.0435573"	"0.00184333"	"1"	"1"	"3"	"Q8CIE6"	"Q8CIE6 [119-125]"	""	"0"	"975.47953"	"112.261"	"3.270"	"0.939160161221265"	"0.906515362333117"	"60.41"	"56.07"	"2.5"	"289.0"	"8.5"	"41.86"	"42.29"	"41.29"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.002951"	"1.74"	"36.39"
"34165"	"False"	"High"	"[R].LLCNFMR.[Q]"	"1xCarbamidomethyl [C3]"	"0.0451692"	"0.00184333"	"1"	"1"	"7"	"Q9R1P4"	"Q9R1P4 [83-89]"	""	"0"	"953.46955"	"46.799"	"5.721"	"0.716607214650224"	"0.906515362333117"	"82.86"	"62.47"	"6.1"	"254.9"	"39.1"	"43.77"	"87.93"	"60.70"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003056"	"1.87"	"39.82"
"66628"	"False"	"High"	"[R].VAVLFPTLRPGGFQAHYR.[D]"	""	"0.0427724"	"0.00184333"	"1"	"2"	"3"	"Q64337"	"Q64337 [51-68]"	""	"0"	"2029.11303"	"122.897"	"4.011"	"0.621234785638754"	"0.906515362333117"	"36.67"	"36.41"	"2.3"	"287.4"	"10.4"	"46.00"	"24.81"	"21.57"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.002891"	"2.08"	"47.29"
"30230"	"False"	"High"	"[K].KVGMLWR.[E]"	"1xOxidation [M4]"	"0.043822"	"0.00184333"	"1"	"2"	"10"	"Q6NZJ6"	"Q6NZJ6 [1391-1397]"	""	"1"	"905.50257"	"147.840"	"2.637"	"0.925138005747468"	"0.906515362333117"	"61.76"	"56.55"	"1.8"	"292.0"	"6.2"	"82.52"	"40.17"	"27.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002963"	"2.16"	"26.52"
"54234"	"False"	"High"	"[R].QLWWGHR.[I]"	""	"0.0402542"	"0.00184333"	"1"	"1"	"1"	"Q9Z1Q9"	"Q9Z1Q9 [723-729]"	""	"0"	"982.50059"	"109.950"	"3.620"	"0.947989303413716"	"0.906515362333117"	"72.80"	"79.31"	"2.8"	"287.4"	"9.8"	"72.52"	"27.09"	"59.25"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002706"	"2.02"	"35.90"
"66556"	"False"	"High"	"[K].VAPAPARPSGPSKALK.[L]"	"1xBiotin [K]"	"0.0417473"	"0.00184333"	"1"	"1"	"12"	"Q5XJY5"	"Q5XJY5 [212-227]"	"Q5XJY5 1xBiotin [K]"	"1"	"1772.98398"	"0.032"	"0.715"	"6.79483419096732E-05"	"0.906515362333117"	"44.59"	"32.81"	"173.5"	"5.8"	"120.8"	"24.97"	"40.19"	"16.22"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002818"	"2.59"	"30.78"
"33848"	"False"	"High"	"[R].LKPQLLQGVYAMGFNRPSK.[I]"	""	"0.0402542"	"0.00184333"	"1"	"1"	"1"	"Q61655"	"Q61655 [98-116]"	""	"0"	"2147.17939"	"0.661"	"1.262"	"0.925138005747468"	"0.906515362333117"	"83.69"	"40.40"	"99.8"	"69.8"	"130.5"	"24.43"	"212.30"	"30.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.002701"	"3.07"	"46.68"
"13018"	"False"	"High"	"[K].EKLQCLKDFHK.[D]"	"1xBiotin [K7]; 1xCarbamidomethyl [C5]"	"0.0448966"	"0.00184333"	"1"	"1"	"1"	"O35316"	"O35316 [5-15]"	"O35316 1xBiotin [K11]"	"2"	"1671.83454"	"0.409"	"0.875"	"0.055108618901273"	"0.906515362333117"	"141.92"	"114.86"	"162.7"	"53.7"	"83.6"	"44.84"	"160.71"	"96.40"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003045"	"2.37"	"37.21"
"53916"	"False"	"High"	"[KR].QLIAKK.[RL]"	"1xBiotin [K5]"	"0.0430325"	"0.00184333"	"1"	"2"	"20"	"Q61263"	"Q61263 [36-41]"	"Q61263 1xBiotin [K40]"	"1"	"926.54918"	"0.006"	"1.153"	"2.88709468858934E-06"	"0.94657271490649"	"31.05"	"24.37"	"136.2"	"0.8"	"163.0"	"14.33"	"49.28"	"22.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002905"	"2.50"	"32.57"
"60440"	"False"	"High"	"[R].SLKLFQK.[L]"	"1xBiotin [K3]"	"0.043822"	"0.00184333"	"1"	"1"	"2"	"Q3UDP0"	"Q3UDP0 [442-448]"	"Q3UDP0 1xBiotin [K444]"	"1"	"1089.61251"	"0.140"	"0.724"	"0.919824836454052"	"0.906515362333117"	"38.91"	"48.23"	"164.5"	"22.0"	"113.5"	"13.42"	"37.82"	"49.42"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002962"	"2.11"	"44.59"
"58623"	"False"	"High"	"[K].SAIKTVGLQTR.[T]"	"1xBiotin [K4]"	"0.0414947"	"0.00184333"	"1"	"2"	"3"	"O70503-1"	"O70503-1 [258-268]"	"O70503-1 1xBiotin [K261]"	"1"	"1399.77259"	"0.436"	"0.952"	"0.929016530787821"	"0.906515362333117"	"73.37"	"70.74"	"112.1"	"59.4"	"128.5"	"50.73"	"42.11"	"56.46"	""	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.002795"	"1.96"	"38.95"
"46653"	"False"	"High"	"[-].MPPYTIVYFPVR.[G]"	"1xMet-loss [N-Term]"	"0.0420013"	"0.00184333"	"1"	"1"	"3"	"P19157"	"P19157 [1-12]"	"P19157 1xMet-loss [N-Term]"	"0"	"1351.74088"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002838"	"2.18"	""
"27080"	"False"	"High"	"[R].KGNYAER.[V]"	"1xBiotin [K1]"	"0.0420013"	"0.00184333"	"2"	"4"	"7"	"Q64523; Q64522"	"Q64523 [37-43]; Q64522 [37-43]"	"Q64523 1xBiotin [K37]; Q64522 1xBiotin [K37]"	"1"	"1063.49894"	"0.112"	"0.816"	"0.925138005747468"	"0.906515362333117"	"69.53"	"48.61"	"142.7"	"20.7"	"136.6"	"41.94"	"50.51"	"27.19"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002827"	"1.79"	"23.98"
"49941"	"False"	"High"	"[R].NFSPQIKVNLNYR.[K]"	"1xBiotin [K7]"	"0.0451692"	"0.00184333"	"1"	"1"	"2"	"Q9WTR1"	"Q9WTR1 [45-57]"	"Q9WTR1 1xBiotin [K51]"	"1"	"1818.93195"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.003066"	"2.66"	""
"32520"	"False"	"High"	"[K].IFINLPR.[S]"	""	"0.0414947"	"0.00184333"	"1"	"1"	"9"	"Q8CDN6"	"Q8CDN6 [196-202]"	""	"0"	"872.53525"	"246.958"	"4.509"	"0.925138005747468"	"0.906515362333117"	"39.57"	"51.35"	"1.2"	"293.0"	"5.8"	"43.88"	"29.53"	"36.12"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.002794"	"1.98"	"43.98"
"36596"	"False"	"High"	"[R].LPAYLTIQMVR.[F]"	"1xOxidation [M9]"	"0.0404994"	"0.00184333"	"1"	"1"	"1"	"Q9JMA1"	"Q9JMA1 [320-330]"	""	"0"	"1320.73442"	"107.840"	"0.912"	"0.383470198252838"	"0.906515362333117"	"51.96"	"68.82"	"3.4"	"293.7"	"2.9"	"36.54"	"39.19"	"65.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.002729"	"2.33"	"44.87"
"2661"	"False"	"High"	"[K].ALVAYYQK.[Y]"	""	"0.0440883"	"0.00184333"	"1"	"1"	"9"	"P14131"	"P14131 [91-98]"	""	"0"	"955.52474"	"181.950"	"4.573"	"0.925138005747468"	"0.906515362333117"	"65.84"	"58.21"	"1.5"	"291.4"	"7.0"	"58.85"	"50.19"	"30.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002982"	"2.09"	"29.59"
"67196"	"False"	"High"	"[K].VFVEKSR.[R]"	"1xBiotin [K5]"	"0.0440883"	"0.00184333"	"1"	"3"	"6"	"Q3V0J1-1"	"Q3V0J1-1 [201-207]"	"Q3V0J1-1 1xBiotin [K205]"	"1"	"1090.57138"	"0.062"	"0.846"	"0.0035053791055101"	"0.906515362333117"	"45.95"	"56.67"	"156.2"	"8.8"	"135.0"	"47.69"	"32.14"	"35.26"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002978"	"2.06"	"34.40"
"36420"	"False"	"High"	"[K].INNHTHIWGSYWK.[E]"	""	"0.0422568"	"0.00184333"	"1"	"1"	"3"	"Q8BHJ9"	"Q8BHJ9 [425-437]"	""	"0"	"1655.80774"	"83.940"	"2.004"	"0.478597253695619"	"0.971511797192901"	"143.21"	"94.48"	"3.1"	"290.5"	"6.5"	"46.24"	"96.26"	"70.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.00285"	"3.31"	"37.48"
"39767"	"False"	"High"	"[R].LYYLGMPYGSR.[E]"	"1xOxidation [M6]"	"0.0430325"	"0.00184333"	"1"	"1"	"3"	"Q8BVG4-1"	"Q8BVG4-1 [71-81]"	""	"0"	"1335.64018"	"191.483"	"2.525"	"0.325037679497299"	"0.906515362333117"	"46.14"	"61.18"	"1.5"	"294.7"	"3.8"	"42.48"	"29.76"	"69.21"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002908"	"1.93"	"39.88"
"70549"	"False"	"High"	"[K].WMGIAFR.[I]"	"1xOxidation [M2]"	"0.0427724"	"0.00184333"	"1"	"2"	"22"	"Q8VDM6"	"Q8VDM6 [352-358]"	""	"0"	"896.44472"	"140.247"	"2.720"	"0.925138005747468"	"0.906515362333117"	"78.94"	"59.79"	"1.9"	"292.5"	"5.6"	"48.59"	"52.39"	"30.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002877"	"1.97"	"41.17"
"71859"	"False"	"High"	"[R].YLNFFTK.[A]"	""	"0.0440883"	"0.00184333"	"1"	"1"	"36"	"P17918"	"P17918 [211-217]"	""	"0"	"932.48763"	"103.973"	"2.471"	"0.93728173323651"	"0.906515362333117"	"53.06"	"42.26"	"3.4"	"288.6"	"8.0"	"41.36"	"32.13"	"19.82"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002988"	"1.51"	"45.75"
"59684"	"False"	"High"	"[R].SGMFSHALDMKSGPLPPGGWDDSRR.[D]"	"1xBiotin [K11]; 2xOxidation [M3; M10]"	"0.0448966"	"0.00184333"	"1"	"1"	"1"	"Q99J27"	"Q99J27 [16-40]"	"Q99J27 1xBiotin [K26]"	"2"	"2959.32839"	"0.661"	"0.949"	"0.925138005747468"	"0.906515362333117"	"62.74"	"51.54"	"112.5"	"71.7"	"115.8"	"33.75"	"47.47"	"58.87"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003045"	"2.47"	"43.69"
"40174"	"False"	"High"	"[-].MAAYKLVLIR.[H]"	"1xMet-loss+Acetyl [N-Term]"	"0.0425139"	"0.00184333"	"1"	"1"	"1"	"Q9DBJ1"	"Q9DBJ1 [1-10]"	"Q9DBJ1 1xMet-loss+Acetyl [N-Term]"	"1"	"1088.68264"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.002872"	"1.77"	""
"59734"	"False"	"High"	"[K].SGQWWR.[Q]"	""	"0.0432941"	"0.00184333"	"1"	"1"	"17"	"Q8BMD8"	"Q8BMD8 [191-196]"	""	"0"	"819.38965"	"134.545"	"4.488"	"0.925138005747468"	"0.906515362333117"	"34.97"	"62.48"	"2.2"	"287.8"	"10.1"	"30.49"	"12.17"	"55.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002917"	"2.11"	"34.79"
"65909"	"False"	"High"	"[K].TTKAFLPR.[M]"	"1xBiotin [K3]"	"0.043822"	"0.00184333"	"1"	"1"	"4"	"O88876-2"	"O88876-2 [88-95]"	"O88876-2 1xBiotin [K90]"	"1"	"1159.62923"	"0.479"	"1.150"	"0.925138005747468"	"0.916215054610739"	"48.92"	"31.70"	"115.1"	"52.6"	"132.4"	"63.39"	"41.50"	"19.17"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002953"	"2.09"	"41.74"
"18506"	"False"	"High"	"[R].FQTVHFFR.[D]"	""	"0.0435573"	"0.00184333"	"1"	"2"	"1"	"Q9CPV4-1"	"Q9CPV4-1 [17-24]"	""	"0"	"1081.55778"	"95.797"	"3.593"	"0.478597253695619"	"0.906515362333117"	"44.71"	"44.60"	"2.8"	"286.9"	"10.3"	"16.72"	"63.60"	"44.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.002935"	"1.71"	"39.15"
"40758"	"False"	"High"	"[-].MAKWGEGDPR.[W]"	"1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"0.0435573"	"0.00184333"	"1"	"1"	"3"	"Q8BK64"	"Q8BK64 [1-10]"	"Q8BK64 1xBiotin [K3]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1283.58373"	"0.131"	"0.809"	"0.0108693228562237"	"0.906515362333117"	"52.45"	"45.80"	"148.4"	"21.6"	"130.0"	"23.77"	"38.70"	"43.04"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.002944"	"1.66"	"43.24"
"19288"	"False"	"High"	"[R].GAEPSGGAKR.[H]"	"1xBiotin [K9]"	"0.0432941"	"0.00184333"	"1"	"1"	"5"	"Q9DAV9"	"Q9DAV9 [277-286]"	"Q9DAV9 1xBiotin [K285]"	"1"	"1155.55752"	"0.336"	"0.935"	"0.925138005747468"	"0.906515362333117"	"70.61"	"46.25"	"142.1"	"38.4"	"119.5"	"39.23"	"39.09"	"28.98"	""	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.002924"	"1.87"	"20.96"
"35852"	"False"	"High"	"[K].LIYFQLHR.[A]"	""	"0.0443561"	"0.00184333"	"1"	"2"	"1"	"Q62318"	"Q62318 [368-375]"	""	"0"	"1089.62038"	"211.792"	"6.825"	"0.925138005747468"	"0.906515362333117"	"92.37"	"72.29"	"1.4"	"291.1"	"7.5"	"38.85"	"69.25"	"56.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003009"	"1.75"	"41.15"
"1260"	"False"	"High"	"[K].AGDSLMVMIAMKMEHTIK.[A]"	"1xBiotin [K12]; 3xOxidation [M6; M8; M11]"	"0.0547875"	"0.00206303"	"1"	"1"	"3"	"Q99MR8"	"Q99MR8 [666-683]"	"Q99MR8 1xBiotin [K677]"	"1"	"2280.05650"	"0.492"	"1.688"	"0.925138005747468"	"0.964144949231137"	"65.14"	"60.82"	"83.4"	"48.1"	"168.5"	"47.34"	"45.81"	"55.31"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003792"	"3.64"	"56.59"
"70609"	"False"	"High"	"[K].WNWLTR.[R]"	""	"0.0578297"	"0.00206303"	"1"	"2"	"11"	"Q810A7-1"	"Q810A7-1 [485-490]"	""	"0"	"875.45225"	"136.181"	"3.335"	"0.925138005747468"	"0.906515362333117"	"97.90"	"99.72"	"2.1"	"289.7"	"8.2"	"90.89"	"59.75"	"32.70"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.00403"	"1.95"	"45.02"
"72746"	"False"	"High"	"[R].YYTALYR.[K]"	""	"0.0518993"	"0.00206303"	"1"	"1"	"8"	"P53569"	"P53569 [544-550]"	""	"0"	"949.47779"	"246.736"	"7.188"	"0.925138005747468"	"0.906515362333117"	"64.37"	"68.07"	"1.4"	"288.6"	"10.0"	"205.06"	"43.96"	"47.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.00358"	"1.57"	"32.46"
"70584"	"False"	"High"	"[K].WNFNCQFFIK.[D]"	"1xCarbamidomethyl [C5]"	"0.0471227"	"0.00206303"	"1"	"1"	"1"	"Q9Z0R6-1"	"Q9Z0R6-1 [1578-1587]"	""	"0"	"1403.65650"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003207"	"2.07"	""
"70662"	"False"	"High"	"[R].WQFTLPMMSTLYR.[L]"	"2xOxidation [M7; M8]"	"0.048862"	"0.00206303"	"1"	"1"	"2"	"Q99PV0"	"Q99PV0 [228-240]"	""	"0"	"1705.80766"	"86.435"	"1.273"	"0.462423360752735"	""	"120.22"	"59.65"	"1.9"	"295.7"	"2.4"	"54.78"	"59.07"	"25.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003328"	"1.83"	"53.45"
"70454"	"False"	"High"	"[K].WLFPTSMR.[S]"	"1xOxidation [M7]"	"0.0581775"	"0.00206303"	"1"	"1"	"8"	"O35448"	"O35448 [151-158]"	""	"0"	"1053.51861"	"151.628"	"2.723"	"0.434853540501642"	"0.90875862466505"	"50.80"	"51.51"	"1.9"	"292.7"	"5.5"	"44.07"	"12.82"	"29.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004075"	"2.28"	"44.61"
"3282"	"False"	"High"	"[R].APSKGFVVR.[D]"	"1xBiotin [K4]"	"0.0500558"	"0.00206303"	"1"	"1"	"1"	"Q8VDJ3"	"Q8VDJ3 [1221-1229]"	"Q8VDJ3 1xBiotin [K1224]"	"1"	"1186.64012"	"0.217"	"0.436"	"0.925138005747468"	"0.906515362333117"	"104.70"	"98.53"	"193.9"	"30.9"	"75.2"	"66.60"	"53.25"	"74.46"	""	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003429"	"1.57"	"39.17"
"1626"	"False"	"High"	"[K].AHGGYSVFAGVGER.[T]"	""	"0.0503586"	"0.00206303"	"1"	"1"	"5"	"P56480"	"P56480 [226-239]"	""	"0"	"1406.68114"	"82.541"	"1.766"	"0.455626807867515"	"0.935866453494337"	"129.05"	"71.36"	"4.2"	"288.7"	"7.1"	"27.58"	"92.59"	"70.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003453"	"2.46"	"34.92"
"65980"	"False"	"High"	"[K].TTSPSMFFSLFSR.[F]"	""	"0.0585274"	"0.00206303"	"1"	"2"	"1"	"Q9JL26"	"Q9JL26 [975-987]"	""	"0"	"1507.72498"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004107"	"1.79"	""
"72716"	"False"	"High"	"[K].YYIGFR.[Y]"	""	"0.0621381"	"0.00206303"	"1"	"1"	"6"	"P22315"	"P22315 [156-161]"	""	"0"	"818.41955"	"193.977"	"4.503"	"0.925138005747468"	"0.906515362333117"	"92.10"	"88.56"	"1.5"	"291.6"	"6.8"	"74.08"	"44.45"	"45.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.00439"	"1.57"	"40.79"
"72713"	"False"	"High"	"[K].YYLFGR.[N]"	""	"0.0551178"	"0.00206303"	"1"	"1"	"1"	"Q8R3G1"	"Q8R3G1 [48-53]"	""	"0"	"818.41955"	"175.531"	"3.525"	"0.925138005747468"	"0.906515362333117"	"65.92"	"60.94"	"1.5"	"292.5"	"6.0"	"59.96"	"50.67"	"46.65"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003829"	"1.33"	"40.79"
"1473"	"False"	"High"	"[K].AGPIWDLR.[L]"	""	"0.0522128"	"0.00206303"	"1"	"2"	"1"	"Q7TMK9"	"Q7TMK9 [185-192]"	""	"0"	"927.50468"	"63.040"	"1.769"	"0.512201402444023"	"0.958214957610858"	"58.47"	"48.74"	"4.7"	"287.3"	"8.1"	"14.71"	"57.83"	"46.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003597"	"1.72"	"44.05"
"70529"	"False"	"High"	"[R].WLVQVPR.[L]"	""	"0.060669"	"0.00206303"	"1"	"1"	"4"	"Q9DBT5"	"Q9DBT5 [490-496]"	""	"0"	"897.53050"	"98.079"	"2.554"	"0.975052343286225"	"0.935866453494337"	"119.90"	"123.97"	"2.8"	"289.0"	"8.3"	"117.95"	"53.96"	"53.81"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004273"	"1.35"	"42.81"
"70890"	"False"	"High"	"[R].WYHPTCFVK.[K]"	"1xCarbamidomethyl [C6]"	"0.0515876"	"0.00206303"	"1"	"1"	"7"	"P11103"	"P11103 [157-165]"	""	"0"	"1237.58228"	"167.234"	"5.811"	"0.925138005747468"	"0.906515362333117"	"73.88"	"87.56"	"1.8"	"287.2"	"10.9"	"54.34"	"55.31"	"93.75"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003551"	"2.30"	"35.97"
"70053"	"False"	"High"	"[R].VYYLSWLR.[N]"	""	"0.0476957"	"0.00206303"	"1"	"6"	"8"	"Q9JM52"	"Q9JM52 [1060-1067]"	""	"0"	"1099.59349"	"140.502"	"2.626"	"0.925138005747468"	"0.916215054610739"	"66.39"	"61.19"	"2.2"	"292.4"	"5.4"	"51.98"	"44.00"	"46.11"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003246"	"1.54"	"54.91"
"70054"	"False"	"High"	"[K].VYYYNAR.[T]"	""	"0.0599469"	"0.00206303"	"1"	"3"	"7"	"Q8CGF7-1"	"Q8CGF7-1 [147-153]"	""	"0"	"948.45739"	"148.202"	"4.495"	"0.925138005747468"	"0.906515362333117"	"88.66"	"85.56"	"2.2"	"288.0"	"9.8"	"74.58"	"62.14"	"13.14"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.00422"	"1.31"	"24.84"
"1438"	"False"	"High"	"[K].AGLYWGYTVR.[L]"	""	"0.0503586"	"0.00206303"	"1"	"2"	"2"	"Q3UHX9-1"	"Q3UHX9-1 [257-266]"	""	"0"	"1185.60512"	"124.750"	"3.608"	"0.925138005747468"	"0.906515362333117"	"56.39"	"42.29"	"2.6"	"287.8"	"9.6"	"41.23"	"34.92"	"19.64"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003459"	"1.82"	"45.66"
"70660"	"False"	"High"	"[R].WQFTLPMMSTLYR.[L]"	""	"0.05714"	"0.00206303"	"1"	"1"	"5"	"Q99PV0"	"Q99PV0 [228-240]"	""	"0"	"1673.81783"	"1.347"	"1.996"	"0.925138005747468"	"0.936688300042187"	"72.23"	"48.33"	"78.2"	"85.5"	"136.3"	"27.00"	"164.56"	"40.17"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003979"	"2.01"	"63.75"
"1159"	"False"	"High"	"[K].AFSTWLK.[L]"	""	"0.0567981"	"0.00206303"	"1"	"1"	"29"	"P26041"	"P26041 [54-60]"	""	"0"	"852.46142"	"128.436"	"4.364"	"0.925138005747468"	"0.906515362333117"	"67.18"	"76.08"	"2.0"	"288.3"	"9.7"	"75.25"	"26.75"	"42.66"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003954"	"1.73"	"41.76"
"4678"	"False"	"High"	"[K].AYFLYMYSR.[Y]"	"1xOxidation [M6]"	"0.05545"	"0.00206303"	"1"	"1"	"1"	"Q8BGZ4"	"Q8BGZ4 [114-122]"	""	"0"	"1229.56596"	"47.930"	"1.388"	"0.925138005747468"	""	"140.28"	"61.32"	"4.7"	"287.9"	"7.4"	"49.26"	"76.39"	"33.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003849"	"1.92"	"43.69"
"66199"	"False"	"High"	"[K].TVQTAVFLYSLYK.[E]"	""	"0.0628853"	"0.00206303"	"1"	"1"	"1"	"Q6PDQ2"	"Q6PDQ2 [751-763]"	""	"0"	"1532.83591"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004446"	"1.96"	""
"70242"	"False"	"High"	"[K].WFAFFK.[Y]"	""	"0.0494554"	"0.00206303"	"1"	"1"	"24"	"P97821"	"P97821 [101-106]"	""	"0"	"845.43447"	"74.909"	"1.706"	"0.997996716763913"	"0.969054191468458"	"78.27"	"60.86"	"3.9"	"289.7"	"6.4"	"50.90"	"52.79"	"39.35"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003377"	"1.84"	"55.67"
"70809"	"False"	"High"	"[K].WTIQYNK.[L]"	""	"0.0551178"	"0.00206303"	"1"	"1"	"4"	"Q922D8"	"Q922D8 [303-309]"	""	"0"	"952.48869"	"183.429"	"4.871"	"0.394018969875957"	"0.906515362333117"	"56.65"	"89.29"	"1.6"	"291.7"	"6.8"	"43.44"	"44.81"	"70.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003831"	"1.69"	"33.48"
"67792"	"False"	"High"	"[R].VLDALVFHFLAFR.[T]"	""	"0.0613993"	"0.00206303"	"1"	"1"	"1"	"O54825"	"O54825 [355-367]"	""	"0"	"1547.87330"	"1.327"	"1.469"	"0.925138005747468"	""	"43.12"	"31.07"	"77.2"	"100.7"	"122.1"	"31.38"	"208.48"	"26.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004322"	"2.11"	"64.41"
"67650"	"False"	"High"	"[R].VKNFGIWLR.[Y]"	""	"0.0506632"	"0.00206303"	"1"	"1"	"15"	"P62717"	"P62717 [75-83]"	""	"1"	"1132.66257"	"58.061"	"1.480"	"0.953254752288654"	"0.963188257025838"	"59.25"	"36.21"	"4.9"	"287.8"	"7.3"	"24.03"	"75.00"	"40.46"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003466"	"2.00"	"43.33"
"70248"	"False"	"High"	"[R].WFDFPFTR.[E]"	""	"0.0625106"	"0.00206303"	"1"	"3"	"5"	"A2AN08"	"A2AN08 [2382-2389]"	""	"0"	"1115.53089"	"56.224"	"1.265"	"0.925138005747468"	"0.906515362333117"	"79.06"	"62.04"	"4.3"	"288.3"	"7.4"	"55.92"	"61.69"	"36.07"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"0.0007894"	"0.004428"	"1.82"	"58.90"
"68385"	"False"	"High"	"[R].VIWLIGQWISVK.[F]"	""	"0.0585274"	"0.00206303"	"1"	"2"	"2"	"Q8K2V6-1"	"Q8K2V6-1 [496-507]"	""	"0"	"1441.85658"	"1.166"	"0.595"	"0.925138005747468"	"0.906515362333117"	"61.38"	"35.02"	"109.2"	"127.3"	"63.5"	"18.71"	"137.71"	"30.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.004084"	"1.93"	"65.31"
"63005"	"False"	"High"	"[R].SWAMLFASGGFK.[V]"	""	"0.0500558"	"0.00206303"	"1"	"1"	"1"	"Q99KP3"	"Q99KP3 [20-31]"	""	"0"	"1301.63470"	"6.323"	"2.324"	"0.962122454074805"	"0.960422171904683"	"218.25"	"61.06"	"24.5"	"211.4"	"64.0"	"33.59"	"115.20"	"52.55"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003419"	"2.35"	"58.40"
"71776"	"False"	"High"	"[K].YLFTGLK.[L]"	""	"0.0547875"	"0.00206303"	"1"	"1"	"13"	"Q9JMA1"	"Q9JMA1 [285-291]"	""	"0"	"841.48182"	"156.179"	"3.841"	"0.925138005747468"	"0.906515362333117"	"62.56"	"44.47"	"1.6"	"292.6"	"5.8"	"43.49"	"66.22"	"27.55"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003797"	"1.21"	"41.61"
"72310"	"False"	"High"	"[R].YRPGTVALR.[E]"	""	"0.0479848"	"0.00206303"	"1"	"4"	"17"	"P84244"	"P84244 [42-50]"	""	"0"	"1032.59489"	"149.378"	"4.150"	"0.925138005747468"	"0.906515362333117"	"70.62"	"69.55"	"1.7"	"290.9"	"7.4"	"60.37"	"29.16"	"31.04"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003258"	"2.38"	"23.50"
"69141"	"False"	"High"	"[K].VSDILHSIFSSYK.[E]"	""	"0.0476957"	"0.00206303"	"1"	"2"	"2"	"Q8BKC5-1"	"Q8BKC5-1 [842-854]"	""	"0"	"1495.77912"	"49.030"	"3.031"	"0.925138005747468"	"0.906515362333117"	"140.52"	"91.49"	"5.3"	"282.8"	"11.9"	"56.00"	"102.33"	"85.40"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003243"	"2.61"	"53.66"
"63776"	"False"	"High"	"[R].TFFYWR.[L]"	""	"0.0541327"	"0.00206303"	"1"	"3"	"12"	"Q5SWU9-1"	"Q5SWU9-1 [2212-2217]"	""	"0"	"919.44610"	"70.091"	"2.089"	"0.992871679916025"	"0.906515362333117"	"50.67"	"46.41"	"4.2"	"287.0"	"8.9"	"61.50"	"29.24"	"33.20"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003744"	"1.77"	"48.65"
"67159"	"False"	"High"	"[R].VFNVFCLYGNVEK.[V]"	"1xCarbamidomethyl [C6]"	"0.0465564"	"0.00206303"	"1"	"1"	"4"	"Q8R081"	"Q8R081 [396-408]"	""	"0"	"1588.78283"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003163"	"2.91"	""
"67167"	"False"	"High"	"[K].VFPWAQIR.[L]"	""	"0.0494554"	"0.00206303"	"1"	"1"	"3"	"Q8C129"	"Q8C129 [160-167]"	""	"0"	"1016.56761"	"100.970"	"3.123"	"0.382153176583616"	"0.906515362333117"	"37.44"	"31.88"	"2.8"	"287.7"	"9.5"	"25.86"	"28.95"	"23.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003377"	"1.33"	"48.76"
"71881"	"False"	"High"	"[K].YIQELWR.[K]"	""	"0.0468387"	"0.00206303"	"1"	"1"	"4"	"Q9CZM2"	"Q9CZM2 [6-12]"	""	"0"	"1007.53089"	"151.613"	"5.133"	"0.925138005747468"	"0.906515362333117"	"77.69"	"81.62"	"1.5"	"289.7"	"8.8"	"85.23"	"39.96"	"38.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003186"	"1.32"	"41.27"
"71769"	"False"	"High"	"[K].YLFFMK.[N]"	""	"0.0592331"	"0.00206303"	"1"	"2"	"2"	"Q3UFB2-1"	"Q3UFB2-1 [296-301]"	""	"0"	"848.43751"	"0.711"	"1.394"	""	"0.906515362333117"	"31.72"	"43.66"	"95.2"	"70.0"	"134.8"	"24.13"	"31.16"	"37.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.004145"	"1.61"	"50.58"
"396"	"False"	"High"	"[R].AAVPSGASTGIYEALELR.[D]"	""	"0.0621381"	"0.00206303"	"1"	"3"	"1"	"P17182"	"P17182 [33-50]"	""	"0"	"1804.94395"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004404"	"2.09"	""
"1984"	"False"	"High"	"[R].ALANSLACQGK.[Y]"	"1xCarbamidomethyl [C8]"	"0.0592331"	"0.00206303"	"1"	"1"	"2"	"P05064"	"P05064 [332-342]"	""	"0"	"1132.57792"	"10.805"	"1.638"	"0.925138005747468"	"0.927892136092816"	"206.25"	"42.46"	"30.5"	"216.7"	"52.7"	"40.70"	"113.05"	"25.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.004155"	"2.14"	"23.77"
"67181"	"False"	"High"	"[R].VFSGVVSTGLK.[V]"	""	"0.0581775"	"0.00206303"	"1"	"1"	"4"	"P58252"	"P58252 [416-426]"	""	"0"	"1093.62519"	"132.778"	"2.422"	"0.430383505746853"	"0.906515362333117"	"72.48"	"82.47"	"2.4"	"291.1"	"6.6"	"55.35"	"35.80"	"53.67"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.004072"	"1.69"	"36.42"
"71955"	"False"	"High"	"[R].YLYYTGR.[I]"	""	"0.0574838"	"0.00206303"	"1"	"1"	"17"	"P14685"	"P14685 [284-290]"	""	"0"	"935.46214"	"135.869"	"2.755"	"0.925138005747468"	"0.916215054610739"	"56.27"	"31.16"	"2.4"	"291.5"	"6.1"	"38.91"	"41.76"	"18.14"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004011"	"1.66"	"30.81"
"331"	"False"	"High"	"[K].AASEKSCNCLLLK.[V]"	"1xBiotin [K5]; 2xCarbamidomethyl [C7; C9]"	"0.0497547"	"0.00206303"	"1"	"1"	"1"	"P17182"	"P17182 [331-343]"	"P17182 1xBiotin [K335]"	"1"	"1719.82266"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003405"	"2.68"	""
"71997"	"False"	"High"	"[K].YMHSGPVVAMVWEGLNVVK.[T]"	"2xOxidation [M2; M10]"	"0.0561202"	"0.00206303"	"1"	"1"	"4"	"P15532"	"P15532 [67-85]"	""	"0"	"2148.06164"	"1.011"	"1.033"	"0.942870059534198"	"0.906515362333117"	"67.82"	"75.30"	"107.0"	"92.2"	"100.8"	"36.19"	"228.97"	"97.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003905"	"2.66"	"51.13"
"68547"	"False"	"High"	"[R].VNHLYSDLSDALVIFQLYEK.[I]"	""	"0.0468387"	"0.00206303"	"1"	"1"	"1"	"Q61233"	"Q61233 [413-432]"	""	"0"	"2367.22309"	"1.107"	"0.962"	""	"0.906515362333117"	"62.09"	"60.59"	"80.9"	"119.4"	"99.7"	"45.90"	"33.27"	"44.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003193"	"3.62"	"66.17"
"68474"	"False"	"High"	"[R].VMNTGSQFVMEGVKNLVLK.[Q]"	"1xBiotin [K]"	"0.0522128"	"0.00206303"	"1"	"2"	"3"	"Q8BRF7"	"Q8BRF7 [520-538]"	"Q8BRF7 1xBiotin [K]"	"1"	"2320.18619"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"0.0007894"	"0.003585"	"3.06"	""
"72127"	"False"	"High"	"[K].YNWSAK.[A]"	""	"0.0541327"	"0.00206303"	"1"	"1"	"29"	"Q9D823"	"Q9D823 [47-52]"	""	"0"	"768.36752"	"120.349"	"3.410"	"0.925138005747468"	"0.906515362333117"	"41.94"	"43.66"	"3.0"	"286.3"	"10.7"	"33.70"	"36.88"	"29.15"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003752"	"1.56"	"23.83"
"69355"	"False"	"High"	"[K].VSTVFWK.[S]"	""	"0.0534853"	"0.00206303"	"1"	"1"	"2"	"P23116"	"P23116 [279-285]"	""	"0"	"866.47707"	"186.563"	"4.680"	"0.925138005747468"	"0.906515362333117"	"52.83"	"67.47"	"1.6"	"290.9"	"7.5"	"39.00"	"39.48"	"55.10"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003703"	"1.89"	"39.76"
"2178"	"False"	"High"	"[R].ALGLQGIYR.[V]"	""	"0.0557841"	"0.00206303"	"1"	"2"	"3"	"Q6PGG2"	"Q6PGG2 [578-586]"	""	"0"	"990.57309"	"37.610"	"0.673"	"0.925138005747468"	"0.906515362333117"	"143.66"	"60.20"	"7.7"	"287.9"	"4.5"	"32.31"	"91.91"	"51.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003865"	"1.94"	"39.99"
"64378"	"False"	"High"	"[K].TKPIWTR.[N]"	""	"0.0541327"	"0.00206303"	"2"	"2"	"32"	"P07901; P11499"	"P07901 [294-300]; P11499 [285-291]"	""	"0"	"901.52541"	"76.479"	"2.559"	"0.994201151226993"	"0.906515362333117"	"75.80"	"69.31"	"4.0"	"284.8"	"11.1"	"58.39"	"51.09"	"38.31"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003733"	"1.22"	"24.56"
"3041"	"False"	"High"	"[K].ANSFTVSSVSAPSWLHR.[F]"	""	"0.0494554"	"0.00206303"	"1"	"1"	"1"	"Q8VDJ3"	"Q8VDJ3 [361-377]"	""	"0"	"1845.92422"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003376"	"2.36"	""
"66723"	"False"	"High"	"[K].VDCKGAGTNGLPTKGPTEVSDK.[K]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.0515876"	"0.00206303"	"1"	"1"	"1"	"Q91WE4"	"Q91WE4 [48-69]"	"Q91WE4 1xBiotin [K51]"	"2"	"2457.17483"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003543"	"3.33"	""
"68110"	"False"	"High"	"[R].VLNFLIR.[N]"	""	"0.0522128"	"0.00206303"	"1"	"1"	"1"	"Q8C7V3"	"Q8C7V3 [421-427]"	""	"0"	"874.55090"	"111.860"	"2.545"	"0.480827169233252"	"0.916215054610739"	"59.51"	"55.10"	"2.8"	"289.7"	"7.5"	"46.46"	"29.43"	"20.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003583"	"1.57"	"48.15"
"69928"	"False"	"High"	"[K].VWEVCFGKK.[G]"	"1xBiotin [K8]; 1xCarbamidomethyl [C5]"	"0.0509695"	"0.00206303"	"1"	"1"	"2"	"Q9R099"	"Q9R099 [251-259]"	"Q9R099 1xBiotin [K258]"	"1"	"1378.66462"	"0.847"	"0.777"	"0.925138005747468"	"0.906515362333117"	"62.94"	"64.72"	"114.1"	"93.5"	"92.4"	"51.02"	"17.26"	"30.54"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003487"	"2.02"	"48.98"
"64862"	"False"	"High"	"[K].TLSSFFTPR.[K]"	""	"0.0585274"	"0.00206303"	"1"	"1"	"1"	"P37913"	"P37913 [226-234]"	""	"0"	"1055.55202"	"103.580"	"1.830"	"0.925138005747468"	"0.998316466510713"	"58.18"	"62.23"	"2.7"	"291.3"	"6.0"	"58.24"	"42.44"	"61.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.004097"	"1.52"	"44.61"
"71450"	"False"	"High"	"[K].YGGFYINTGTLQFR.[Q]"	""	"0.0515876"	"0.00206303"	"1"	"4"	"1"	"Q80WC1"	"Q80WC1 [220-233]"	""	"0"	"1636.81182"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003555"	"1.89"	""
"64571"	"False"	"High"	"[R].TLGVLYWK.[L]"	""	"0.0525282"	"0.00206303"	"1"	"1"	"3"	"Q99JT9"	"Q99JT9 [33-40]"	""	"0"	"979.56113"	"61.229"	"1.452"	"0.566517837336986"	"0.906515362333117"	"63.73"	"57.53"	"5.0"	"288.9"	"6.1"	"29.54"	"64.88"	"45.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003607"	"1.55"	"47.57"
"69569"	"False"	"High"	"[R].VTTNVKR.[G]"	"1xBiotin [K6]"	"0.0465564"	"0.00206303"	"1"	"3"	"5"	"Q9DBR4-1"	"Q9DBR4-1 [735-741]"	"Q9DBR4-1 1xBiotin [K740]"	"1"	"1043.56663"	"0.386"	"1.090"	"0.925138005747468"	"0.93655893674966"	"50.62"	"61.77"	"115.7"	"46.0"	"138.3"	"44.79"	"37.46"	"48.51"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.00316"	"1.95"	"24.94"
"71473"	"False"	"High"	"[K].YGKIETIEVMEDR.[Q]"	"1xBiotin [K3]"	"0.0599469"	"0.00206303"	"1"	"2"	"3"	"Q8BG05"	"Q8BG05 [149-161]"	"Q8BG05 1xBiotin [K151]"	"1"	"1808.85573"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.004218"	"2.10"	""
"64450"	"False"	"High"	"[R].TLAHFRPIEDNEKSKDVNGPEPLNSR.[S]"	"2xBiotin [K13; K15]"	"0.0518993"	"0.00206303"	"1"	"1"	"4"	"P61022"	"P61022 [86-111]"	"P61022 2xBiotin [K98; K100]"	"2"	"3415.65217"	"0.536"	"0.955"	"0.0655069324877287"	"0.906515362333117"	"66.54"	"86.02"	"123.5"	"66.5"	"110.1"	"101.87"	"38.98"	"74.38"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0007894"	"0.003558"	"4.04"	"43.88"
"64441"	"False"	"High"	"[K].TIAFLLPMFR.[H]"	"1xOxidation [M8]"	"0.0541327"	"0.00206303"	"1"	"2"	"2"	"Q569Z5-1"	"Q569Z5-1 [423-432]"	""	"0"	"1224.68093"	"152.031"	"2.254"	"0.345690041633958"	"0.906515362333117"	"60.04"	"44.54"	"1.7"	"294.6"	"3.7"	"31.77"	"57.82"	"41.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.00374"	"2.01"	"58.74"
"1059"	"False"	"High"	"[R].AFFSGSQR.[F]"	""	"0.0632621"	"0.00206303"	"1"	"3"	"1"	"Q8BHN3"	"Q8BHN3 [603-610]"	""	"0"	"899.43699"	"180.329"	"3.983"	"0.925138005747468"	"0.906515362333117"	"62.34"	"45.84"	"1.6"	"292.4"	"6.0"	"56.17"	"33.50"	"15.83"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004508"	"1.72"	"26.74"
"69482"	"False"	"High"	"[KR].VTIAQGGVLPNIQAVLLPKK.[T]"	"1xBiotin [K20]"	"0.0581775"	"0.00206303"	"2"	"8"	"4"	"Q64523; Q8BFU2"	"Q64523 [101-120]; Q8BFU2 [101-120]"	"Q64523 1xBiotin [K120]; Q8BFU2 1xBiotin [K120]"	"1"	"2285.34137"	"0.944"	"0.804"	"0.925138005747468"	"0.906515362333117"	"46.39"	"83.84"	"115.3"	"102.7"	"82.1"	"27.80"	"35.94"	"77.96"	"NotUnique"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.0007894"	"0.004066"	"3.25"	"61.49"
"67507"	"False"	"High"	"[K].VHVFYIDYGNR.[E]"	""	"0.0525282"	"0.00206303"	"1"	"1"	"2"	"Q78PY7"	"Q78PY7 [759-769]"	""	"0"	"1382.68516"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003618"	"1.75"	""
"67109"	"False"	"High"	"[K].VFGFQPR.[K]"	""	"0.0625106"	"0.00206303"	"1"	"1"	"4"	"Q9JK23"	"Q9JK23 [154-160]"	""	"0"	"850.45700"	"143.248"	"4.072"	"0.925138005747468"	"0.906515362333117"	"68.83"	"40.98"	"2.2"	"289.6"	"8.3"	"30.38"	"68.46"	"30.12"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.004437"	"1.69"	"37.23"
"68210"	"False"	"High"	"[K].VLQLYPSNK.[A]"	""	"0.0503586"	"0.00206303"	"1"	"1"	"1"	"P30416"	"P30416 [379-387]"	""	"0"	"1061.59897"	"91.280"	"1.411"	"0.433180228049634"	"0.906515362333117"	"142.51"	"65.14"	"3.0"	"293.4"	"3.6"	"42.61"	"88.56"	"50.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.00345"	"1.80"	"33.72"
"71572"	"False"	"High"	"[K].YGWFWVCPGGGDNCMYR.[H]"	"2xCarbamidomethyl [C7; C14]; 1xOxidation [M15]"	"0.0531644"	"0.00206303"	"1"	"1"	"2"	"Q3TIV5-1"	"Q3TIV5-1 [192-208]"	""	"0"	"2140.84625"	"1.051"	"0.544"	"0.925138005747468"	""	"90.56"	"38.43"	"116.3"	"121.1"	"62.7"	"11.62"	"159.43"	"47.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003663"	"2.15"	"56.99"
"70986"	"False"	"High"	"[R].YASLKLR.[N]"	"1xBiotin [K5]"	"0.0632621"	"0.00206303"	"1"	"3"	"9"	"Q9DBR4-1"	"Q9DBR4-1 [391-397]"	"Q9DBR4-1 1xBiotin [K395]"	"1"	"1076.59211"	"0.110"	"0.980"	"0.00472417018594241"	"0.906515362333117"	"48.42"	"35.33"	"145.8"	"17.4"	"136.9"	"26.23"	"39.94"	"23.05"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.004502"	"1.54"	"39.47"
"66126"	"False"	"High"	"[K].TVLGVPEVLLGILPGAGGTQR.[L]"	""	"0.0574838"	"0.00206303"	"1"	"1"	"1"	"Q8BMS1"	"Q8BMS1 [167-187]"	""	"0"	"2047.19100"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004025"	"2.75"	""
"22619"	"False"	"High"	"[R].GQPLLVFR.[A]"	""	"0.0613993"	"0.00206303"	"1"	"1"	"7"	"Q61753"	"Q61753 [462-469]"	""	"0"	"929.55671"	"316.982"	"8.681"	"0.925138005747468"	"0.906515362333117"	"73.36"	"68.72"	"0.9"	"291.7"	"7.3"	"86.42"	"38.73"	"21.30"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004346"	"1.72"	"43.30"
"39729"	"False"	"High"	"[R].LYSNWR.[K]"	""	"0.0603069"	"0.00206303"	"1"	"1"	"3"	"Q920B9"	"Q920B9 [17-22]"	""	"0"	"838.42061"	"1000.000"	"4.128"	"9.75666666666667E-15"	"0.906515362333117"	"43.20"	"186.96"	"0.2"	"298.9"	"0.9"	"33.85"	"45.95"	"101.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004248"	"1.77"	"29.12"
"39394"	"False"	"High"	"[R].IVSWWMTGR.[S]"	""	"0.0497547"	"0.00206303"	"1"	"2"	"5"	"O88508-1"	"O88508-1 [306-314]"	""	"0"	"1135.57171"	"7.174"	"2.582"	"0.998769547666767"	"0.925487989474001"	"218.78"	"86.25"	"24.9"	"188.4"	"86.7"	"43.94"	"121.84"	"52.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003414"	"2.08"	"49.51"
"55302"	"False"	"High"	"[K].QTFGYGAR.[L]"	""	"0.05545"	"0.00206303"	"1"	"1"	"3"	"Q8BK64"	"Q8BK64 [329-336]"	""	"0"	"899.43699"	"126.320"	"2.517"	"0.430383505746853"	"0.913565512658592"	"65.09"	"55.71"	"3.0"	"289.3"	"7.7"	"43.75"	"52.29"	"35.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003852"	"1.75"	"24.21"
"26703"	"False"	"High"	"[R].KFFNKEFLSKPTV.[-]"	"1xBiotin [K]"	"0.0632621"	"0.00206303"	"1"	"1"	"8"	"P47713"	"P47713 [736-748]"	"P47713 1xBiotin [K]"	"2"	"1810.95604"	"0.274"	"0.990"	"0.925138005747468"	"0.916215054610739"	"56.92"	"40.73"	"128.8"	"36.1"	"135.1"	"51.33"	"38.51"	"27.44"	""	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004505"	"2.84"	"49.72"
"24297"	"False"	"High"	"[R].HGLINFGIYK.[R]"	""	"0.0468387"	"0.00206303"	"1"	"1"	"3"	"Q6ZQ88"	"Q6ZQ88 [260-269]"	""	"0"	"1161.64150"	"91.714"	"0.813"	"0.454924058924831"	""	"66.25"	"65.85"	"3.1"	"294.2"	"2.7"	"48.76"	"39.51"	"38.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003186"	"2.55"	"42.92"
"18641"	"False"	"High"	"[K].FSFGLLDSPFR.[V]"	""	"0.0471227"	"0.00206303"	"1"	"1"	"2"	"Q6P5D8"	"Q6P5D8 [826-836]"	""	"0"	"1285.65755"	"32.099"	"0.873"	"0.925138005747468"	"0.906515362333117"	"55.06"	"53.62"	"8.9"	"283.5"	"7.7"	"40.73"	"53.01"	"31.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003212"	"1.64"	"59.76"
"35771"	"False"	"High"	"[K].IIVLGLLPR.[G]"	""	"0.0557841"	"0.00206303"	"1"	"1"	"1"	"Q61206"	"Q61206 [134-142]"	""	"0"	"993.68191"	"75.033"	"1.198"	"0.481285487216449"	"0.906515362333117"	"67.87"	"76.70"	"5.6"	"290.2"	"4.2"	"53.59"	"33.80"	"59.64"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.003874"	"2.23"	"54.47"
"30814"	"False"	"High"	"[R].LAFLMHSWK.[D]"	""	"0.0482755"	"0.00206303"	"1"	"2"	"5"	"Q9ER72"	"Q9ER72 [514-522]"	""	"0"	"1132.59720"	"62.744"	"7.827"	"0.576830489652474"	"0.906515362333117"	"109.25"	"50.63"	"3.7"	"266.0"	"30.3"	"60.41"	"98.06"	"15.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003285"	"2.06"	"44.83"
"53629"	"False"	"High"	"[R].QKTFDWK.[R]"	"1xBiotin [K2]"	"0.0491578"	"0.00206303"	"1"	"2"	"8"	"Q60898"	"Q60898 [201-207]"	"Q60898 1xBiotin [K202]"	"1"	"1178.56629"	"0.137"	"1.084"	"0.925138005747468"	"0.906515362333117"	"36.94"	"38.38"	"138.1"	"18.9"	"143.1"	"25.54"	"37.33"	"69.05"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.00335"	"2.15"	"43.14"
"53043"	"False"	"High"	"[R].QFLFRPWDVTK.[L]"	""	"0.0547875"	"0.00206303"	"1"	"1"	"2"	"Q02053"	"Q02053 [516-526]"	""	"0"	"1436.76850"	"79.770"	"5.765"	"0.478573781684308"	"0.906515362333117"	"144.94"	"36.58"	"3.3"	"276.9"	"19.8"	"33.00"	"88.43"	"22.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003806"	"2.55"	"49.62"
"26687"	"False"	"High"	"[R].KFDSLR.[R]"	"1xBiotin [K1]"	"0.053808"	"0.00206303"	"1"	"1"	"13"	"Q8K273"	"Q8K273 [125-130]"	"Q8K273 1xBiotin [K125]"	"1"	"991.50296"	"0.025"	"0.912"	"4.41467593311496E-05"	"0.906515362333117"	"58.39"	"29.60"	"156.8"	"4.0"	"139.2"	"20.07"	"205.20"	"28.56"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003709"	"2.16"	"37.30"
"35851"	"False"	"High"	"[K].LLYFNMR.[G]"	"1xOxidation [M6]"	"0.0585274"	"0.00206303"	"1"	"1"	"1"	"Q9JHF7"	"Q9JHF7 [6-12]"	""	"0"	"972.49715"	"20.750"	"2.051"	"0.925138005747468"	"0.943485193068069"	"748.24"	"128.30"	"17.2"	"257.3"	"25.4"	"37.15"	"116.85"	"114.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004085"	"1.99"	"38.49"
"52501"	"False"	"High"	"[K].QDAFANFANFSK.[-]"	"1xBiotin [K12]"	"0.0531644"	"0.00206303"	"1"	"1"	"9"	"Q99KN9-1"	"Q99KN9-1 [620-631]"	"Q99KN9-1 1xBiotin [K631]"	"0"	"1585.71039"	"0.534"	"0.485"	"0.925138005747468"	"0.906515362333117"	"22.46"	"89.11"	"146.9"	"82.8"	"70.3"	"15.00"	"35.91"	"72.14"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003673"	"2.69"	"58.20"
"52081"	"False"	"High"	"[K].NYLSLAPLFFK.[L]"	""	"0.0599469"	"0.00206303"	"1"	"1"	"9"	"O54774"	"O54774 [217-227]"	""	"0"	"1312.72999"	"34.457"	"0.916"	"0.925138005747468"	"0.906515362333117"	"37.24"	"53.03"	"8.0"	"285.0"	"7.0"	"29.70"	"18.44"	"41.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004226"	"1.44"	"62.44"
"35875"	"False"	"High"	"[R].ILYSLFQK.[H]"	""	"0.0544591"	"0.00206303"	"1"	"1"	"1"	"Q9ERD8"	"Q9ERD8 [308-315]"	""	"0"	"1011.58734"	"154.414"	"4.044"	"0.374340895208304"	"0.906515362333117"	"58.91"	"59.91"	"1.8"	"290.4"	"7.8"	"62.27"	"45.93"	"44.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003778"	"1.57"	"46.07"
"40166"	"False"	"High"	"[-].MAAVVAKR.[E]"	"1xBiotin [K7]; 1xMet-loss+Acetyl [N-Term]"	"0.060669"	"0.00206303"	"1"	"1"	"12"	"Q9CQW0"	"Q9CQW0 [1-8]"	"Q9CQW0 1xBiotin [K7]; 1xMet-loss+Acetyl [N-Term]"	"1"	"982.55025"	"0.286"	"0.791"	"0.925138005747468"	"0.906515362333117"	"52.21"	"26.71"	"141.4"	"37.9"	"120.7"	"21.60"	"41.36"	"15.92"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004281"	"2.14"	"39.36"
"56390"	"False"	"High"	"[R].RFPPYYMR.[R]"	""	"0.0494554"	"0.00206303"	"1"	"1"	"102"	"P62960"	"P62960 [190-197]"	""	"1"	"1129.56115"	"24.793"	"2.499"	"0.925138005747468"	"0.906515362333117"	"86.76"	"61.93"	"10.2"	"267.4"	"22.4"	"48.82"	"75.62"	"44.49"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.00337"	"2.32"	"36.80"
"56480"	"False"	"High"	"[R].RGGTWFAGFGR.[E]"	""	"0.048862"	"0.00206303"	"1"	"1"	"6"	"Q91YT0"	"Q91YT0 [257-267]"	""	"1"	"1211.60685"	"61.073"	"1.275"	"0.966090293805027"	"0.907108336447894"	"75.42"	"76.90"	"4.3"	"290.2"	"5.5"	"72.00"	"32.38"	"57.58"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003343"	"2.45"	"42.80"
"24245"	"False"	"High"	"[K].HFWQHR.[M]"	""	"0.0603069"	"0.00206303"	"1"	"1"	"20"	"Q99NB9"	"Q99NB9 [817-822]"	""	"0"	"910.44308"	"105.658"	"2.825"	"0.949662611758987"	"0.906515362333117"	"51.02"	"59.98"	"2.9"	"288.4"	"8.7"	"44.53"	"46.07"	"44.54"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004257"	"1.62"	"19.25"
"19935"	"False"	"High"	"[K].GDTYIPSLPKHYDVHR.[L]"	"1xBiotin [K10]"	"0.0528454"	"0.00206303"	"1"	"1"	"1"	"Q80TA9"	"Q80TA9 [1412-1427]"	"Q80TA9 1xBiotin [K1421]"	"1"	"2124.03312"	"0.879"	"0.965"	"0.925138005747468"	"0.906515362333117"	"61.44"	"70.60"	"112.0"	"82.2"	"105.7"	"42.45"	"43.96"	"52.99"	""	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.003647"	"2.56"	"42.33"
"44746"	"False"	"High"	"[R].MIAGQVLDINLAAEPK.[V]"	"1xBiotin [K16]; 1xOxidation [M1]"	"0.0617677"	"0.00206303"	"1"	"5"	"75"	"Q9Z204"	"Q9Z204 [74-89]"	"Q9Z204 1xBiotin [K89]"	"0"	"1924.98708"	"2.791"	"0.538"	"0.250578093242809"	"0.906515362333117"	"47.35"	"64.87"	"63.7"	"202.0"	"34.3"	"41.70"	"50.77"	"85.53"	""	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004368"	"3.00"	"50.51"
"19010"	"False"	"High"	"[K].FVSFLGK.[T]"	""	"0.0509695"	"0.00206303"	"1"	"1"	"5"	"P52293"	"P52293 [124-130]"	""	"0"	"797.45560"	"200.301"	"6.107"	"0.925138005747468"	"0.906515362333117"	"54.17"	"56.88"	"1.7"	"291.3"	"7.0"	"36.76"	"61.08"	"47.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003498"	"1.54"	"41.48"
"34166"	"False"	"High"	"[R].LLCNFMR.[Q]"	"1xCarbamidomethyl [C3]; 1xOxidation [M6]"	"0.0491578"	"0.00206303"	"1"	"1"	"9"	"Q9R1P4"	"Q9R1P4 [83-89]"	""	"0"	"969.46447"	"519.085"	"9.955"	"0.681427032898461"	"0.906515362333117"	"42.90"	"68.26"	"0.6"	"296.0"	"3.5"	"41.62"	"32.18"	"53.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003362"	"1.78"	"31.04"
"34195"	"False"	"High"	"[K].LLDFGSLSNLQVTQPTVGMNFK.[T]"	""	"0.0503586"	"0.00206303"	"1"	"1"	"4"	"P63276"	"P63276 [108-129]"	""	"0"	"2409.24826"	"1.819"	"2.393"	"0.925138005747468"	"0.937945192250145"	"82.29"	"90.32"	"53.8"	"102.1"	"144.0"	"62.89"	"197.29"	"102.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003445"	"3.44"	"60.33"
"34238"	"False"	"High"	"[R].LLDNLLALVR.[T]"	""	"0.0585274"	"0.00206303"	"1"	"2"	"1"	"Q924C1"	"Q924C1 [772-781]"	""	"0"	"1139.71467"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004103"	"2.25"	""
"57476"	"False"	"High"	"[R].RPKASDYQR.[L]"	"1xBiotin [K3]"	"0.0515876"	"0.00206303"	"1"	"2"	"2"	"Q62314"	"Q62314 [350-358]"	"Q62314 1xBiotin [K352]"	"1"	"1346.66338"	"0.403"	"0.826"	"0.925138005747468"	"0.906515362333117"	"70.25"	"62.65"	"133.7"	"54.3"	"112.0"	"38.60"	"56.47"	"75.68"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.00355"	"2.60"	"21.84"
"34437"	"False"	"High"	"[R].LLFGFLTLMR.[K]"	"1xOxidation [M9]"	"0.0512776"	"0.00206303"	"1"	"1"	"1"	"Q5XG71"	"Q5XG71 [2434-2443]"	""	"0"	"1226.69658"	"30.012"	"0.873"	"0.925138005747468"	""	"85.02"	"76.70"	"12.0"	"278.9"	"9.1"	"35.76"	"74.01"	"55.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.00353"	"2.19"	"62.68"
"38150"	"False"	"High"	"[K].LSLSEGGLIPSSKSPK.[R]"	"1xBiotin [K13]"	"0.0628853"	"0.00206303"	"1"	"1"	"3"	"Q8R1T1-1"	"Q8R1T1-1 [429-444]"	"Q8R1T1-1 1xBiotin [K441]"	"1"	"1825.97281"	"0.838"	"1.078"	"0.925138005747468"	"0.906515362333117"	"36.26"	"18.02"	"101.2"	"89.0"	"109.9"	"28.33"	"22.59"	"9.04"	""	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.004448"	"1.88"	"47.55"
"17608"	"False"	"High"	"[R].FKGQILMPNIGYGSNKK.[T]"	"1xOxidation [M7]"	"0.0468387"	"0.00206303"	"1"	"1"	"6"	"P62911"	"P62911 [49-65]"	""	"2"	"1911.01568"	"402.097"	"3.836"	"0.925138005747468"	"0.906515362333117"	"46.92"	"65.14"	"0.7"	"296.5"	"2.8"	"42.90"	"27.39"	"42.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003189"	"3.13"	"33.18"
"17645"	"False"	"High"	"[K].FKSEALLSTLTSDASK.[E]"	"1xBiotin [K2]"	"0.048862"	"0.00206303"	"1"	"1"	"2"	"Q8VEK6"	"Q8VEK6 [166-181]"	"Q8VEK6 1xBiotin [K167]"	"1"	"1923.97320"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003338"	"2.07"	""
"31085"	"False"	"High"	"[K].IANPVEGSSGRQVTITGSAASISLAQYLINAR.[L]"	""	"0.0497547"	"0.00206303"	"1"	"1"	"1"	"P60335"	"P60335 [315-346]"	""	"1"	"3244.72843"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003412"	"3.33"	""
"56986"	"False"	"High"	"[K].RLKSSTSFANIQENAT.[-]"	"1xBiotin [K3]"	"0.0610331"	"0.00206303"	"1"	"1"	"3"	"Q8BGT0"	"Q8BGT0 [323-338]"	"Q8BGT0 1xBiotin [K325]"	"2"	"1992.98075"	"0.235"	"0.383"	"0.925138005747468"	"0.906515362333117"	"68.44"	"89.98"	"191.6"	"42.7"	"65.7"	"57.52"	"24.63"	"74.02"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.004312"	"3.72"	"41.16"
"56780"	"False"	"High"	"[R].RKMCLFAGFQR.[K]"	"1xCarbamidomethyl [C4]; 1xOxidation [M3]"	"0.0485679"	"0.00206303"	"1"	"2"	"6"	"Q8VEK3"	"Q8VEK3 [567-577]"	""	"2"	"1429.71912"	"55.353"	"0.509"	"0.944967096116098"	"0.906515362333117"	"147.43"	"104.56"	"4.1"	"293.9"	"2.0"	"97.13"	"106.38"	"76.22"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0007894"	"0.003322"	"2.39"	"33.32"
"20379"	"False"	"High"	"[R].GFAFVQFK.[N]"	""	"0.0497547"	"0.00206303"	"1"	"1"	"14"	"Q8CGC6"	"Q8CGC6 [155-162]"	""	"0"	"943.50361"	"150.839"	"3.877"	"0.925138005747468"	"0.906515362333117"	"46.88"	"41.18"	"1.9"	"290.4"	"7.7"	"28.89"	"38.66"	"32.73"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003399"	"2.11"	"47.94"
"52045"	"False"	"High"	"[R].NWQWWR.[L]"	""	"0.0479848"	"0.00206303"	"1"	"6"	"30"	"Q8VDD5"	"Q8VDD5 [824-829]"	""	"0"	"975.45840"	"106.817"	"2.573"	"0.932172616415912"	"0.906515362333117"	"80.78"	"73.45"	"3.1"	"289.4"	"7.5"	"66.46"	"65.41"	"28.11"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003264"	"1.82"	"49.60"
"39508"	"False"	"High"	"[K].LWLFGK.[K]"	""	"0.0581775"	"0.00206303"	"1"	"2"	"4"	"Q8K012"	"Q8K012 [322-327]"	""	"0"	"763.45012"	"143.684"	"3.659"	"0.925138005747468"	"0.906515362333117"	"54.21"	"49.10"	"2.0"	"290.5"	"7.5"	"37.89"	"72.24"	"29.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004058"	"1.94"	"51.36"
"51982"	"False"	"High"	"[K].NVQQLAILGAGLMGAGIAQVSVDK.[G]"	""	"0.0528454"	"0.00206303"	"1"	"1"	"2"	"Q8BMS1"	"Q8BMS1 [360-383]"	""	"0"	"2353.29079"	"0.643"	"1.178"	""	"0.906515362333117"	"55.90"	"37.42"	"103.8"	"70.4"	"125.8"	"32.43"	"55.95"	"35.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003648"	"2.75"	"66.47"
"30479"	"False"	"High"	"[R].KWAALK.[E]"	"1xBiotin [K1]"	"0.0567981"	"0.00206303"	"1"	"2"	"1"	"Q0GNC1"	"Q0GNC1 [10-15]"	"Q0GNC1 1xBiotin [K10]"	"1"	"942.52297"	"0.317"	"0.921"	"0.925138005747468"	"0.906515362333117"	"51.66"	"31.68"	"134.8"	"42.6"	"122.6"	"19.20"	"47.17"	"26.92"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003965"	"2.22"	"39.57"
"50291"	"False"	"High"	"[K].NKIENK.[IM]"	"1xBiotin [K2]"	"0.0617677"	"0.00206303"	"2"	"2"	"17"	"Q9JIG8; Q8R5J9"	"Q9JIG8 [147-152]; Q8R5J9 [146-151]"	"Q9JIG8 1xBiotin [K148]; Q8R5J9 1xBiotin [K147]"	"1"	"971.49788"	"0.024"	"0.761"	"4.02695547418951E-05"	"0.906515362333117"	"47.65"	"17.47"	"168.9"	"3.6"	"127.6"	"17.59"	"44.82"	"7.03"	"NotUnique"	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004376"	"2.36"	"26.24"
"21400"	"False"	"High"	"[R].GIFPVLCK.[D]"	"1xCarbamidomethyl [C7]"	"0.0561202"	"0.00206303"	"1"	"2"	"22"	"P52480"	"P52480 [468-475]"	""	"0"	"933.52264"	"118.558"	"4.203"	"0.925138005747468"	"0.906515362333117"	"52.56"	"46.78"	"2.7"	"286.7"	"10.6"	"53.44"	"37.73"	"32.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003901"	"1.51"	"45.61"
"38627"	"False"	"High"	"[K].LTGMAFR.[V]"	"1xOxidation [M4]"	"0.0557841"	"0.00206303"	"1"	"2"	"44"	"P16858"	"P16858 [226-232]"	""	"0"	"811.41309"	"190.184"	"3.208"	"0.925138005747468"	"0.906515362333117"	"43.54"	"48.25"	"1.3"	"294.4"	"4.3"	"32.97"	"25.60"	"42.91"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003868"	"1.57"	"21.69"
"29218"	"False"	"High"	"[R].KQLATK.[A]"	"1xBiotin [K1]"	"0.05545"	"0.00206303"	"1"	"4"	"11"	"P84244"	"P84244 [19-24]"	"P84244 1xBiotin [K19]"	"1"	"914.51280"	"0.084"	"0.787"	"0.00625641360415653"	"0.906515362333117"	"29.37"	"46.86"	"148.1"	"12.8"	"139.2"	"35.43"	"21.82"	"39.35"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003862"	"2.08"	"25.16"
"37287"	"False"	"High"	"[K].IQLANEEYKR.[I]"	"1xBiotin [K9]"	"0.048862"	"0.00206303"	"1"	"1"	"5"	"Q5SYH2"	"Q5SYH2 [108-117]"	"Q5SYH2 1xBiotin [K116]"	"1"	"1489.74677"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003334"	"1.77"	""
"37532"	"False"	"High"	"[R].LQYFAR.[G]"	""	"0.0525282"	"0.00206303"	"1"	"1"	"1"	"O35841"	"O35841 [377-382]"	""	"0"	"797.43045"	"82.294"	"1.616"	"0.992801922882858"	"0.971511797192901"	"72.60"	"56.30"	"4.2"	"288.3"	"7.4"	"42.64"	"58.43"	"51.15"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003626"	"2.03"	"29.50"
"21431"	"False"	"High"	"[K].GLGNYLYNFASAATK.[K]"	""	"0.0500558"	"0.00206303"	"1"	"1"	"1"	"Q9D5V6"	"Q9D5V6 [70-84]"	""	"0"	"1589.79583"	"1.144"	"1.694"	"0.987000067345905"	"0.963994276545741"	"42.41"	"46.18"	"83.4"	"90.8"	"125.8"	"35.45"	"31.33"	"38.53"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003418"	"3.30"	"57.18"
"49297"	"False"	"High"	"[R].MYSYPAR.[V]"	"1xOxidation [M1]"	"0.0485679"	"0.00206303"	"1"	"5"	"14"	"Q9Z204"	"Q9Z204 [136-142]"	""	"0"	"903.40291"	"305.620"	"4.164"	"0.925138005747468"	"0.906515362333117"	"89.28"	"91.17"	"1.1"	"294.2"	"4.6"	"64.10"	"39.48"	"56.80"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003316"	"1.92"	"20.85"
"48182"	"False"	"High"	"[-].MSTFRLALIQLQVSSIKSDNLTR.[A]"	"1xMet-loss+Acetyl [N-Term]"	"0.0621381"	"0.00206303"	"1"	"1"	"1"	"Q9JHW2"	"Q9JHW2 [1-23]"	"Q9JHW2 1xMet-loss+Acetyl [N-Term]"	"2"	"2532.41441"	"1.498"	"1.705"	"0.925138005747468"	""	"84.69"	"76.71"	"61.8"	"98.3"	"139.9"	"62.09"	"225.03"	"41.62"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004412"	"2.64"	"59.16"
"48942"	"False"	"High"	"[-].MVNPTVFFDITADDEPLGR.[V]"	"1xMet-loss [N-Term]"	"0.0515876"	"0.00206303"	"1"	"1"	"1"	"P17742"	"P17742 [1-19]"	"P17742 1xMet-loss [N-Term]"	"0"	"2005.98655"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003553"	"2.23"	""
"37720"	"False"	"High"	"[K].LRQPFFQKR.[S]"	""	"0.0564581"	"0.00206303"	"1"	"2"	"1"	"Q9EQU5"	"Q9EQU5 [75-83]"	""	"2"	"1219.70584"	"87.460"	"1.315"	"0.479900168251546"	"0.916215054610739"	"115.02"	"89.34"	"2.7"	"293.2"	"4.1"	"61.76"	"71.82"	"118.19"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.003935"	"2.85"	"25.77"
"38362"	"False"	"High"	"[K].LSSLKDSVVFK.[T]"	"1xBiotin [K5]"	"0.0531644"	"0.00206303"	"1"	"1"	"1"	"Q924S8"	"Q924S8 [303-313]"	"Q924S8 1xBiotin [K307]"	"1"	"1448.78176"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003668"	"1.76"	""
"38278"	"False"	"High"	"[R].ISPWLLR.[V]"	""	"0.0491578"	"0.00206303"	"1"	"1"	"2"	"P08775"	"P08775 [1207-1213]"	""	"0"	"884.53525"	"111.746"	"2.367"	"0.478597253695619"	"0.957287483848178"	"54.06"	"38.65"	"3.6"	"287.9"	"8.5"	"37.67"	"38.57"	"9.97"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003351"	"1.49"	"45.84"
"29685"	"False"	"High"	"[K].KSMSLPSH.[-]"	"1xBiotin [K1]"	"0.0479848"	"0.00206303"	"1"	"1"	"3"	"Q8BGN6"	"Q8BGN6 [219-226]"	"Q8BGN6 1xBiotin [K219]"	"1"	"1112.52271"	"0.373"	"0.650"	"0.925138005747468"	"0.906515362333117"	"48.46"	"67.70"	"147.9"	"52.8"	"99.4"	"46.29"	"31.34"	"63.34"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003271"	"1.99"	"36.41"
"37701"	"False"	"High"	"[K].IRPLWR.[HS]"	""	"0.0574838"	"0.00206303"	"2"	"7"	"35"	"P61205; P62331"	"P61205 [74-79]; P62331 [70-75]"	""	"0"	"840.52027"	"78.413"	"2.596"	"0.989440770281069"	"0.906515362333117"	"54.00"	"32.52"	"3.9"	"286.3"	"9.8"	"21.53"	"47.69"	"25.07"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004014"	"1.86"	"31.44"
"18179"	"False"	"High"	"[R].FMLLFSR.[Q]"	"1xOxidation [M2]"	"0.0599469"	"0.00206303"	"1"	"1"	"4"	"P61967"	"P61967 [4-10]"	""	"0"	"929.49134"	"322.928"	"5.211"	"0.925138005747468"	"0.906515362333117"	"60.31"	"68.47"	"0.8"	"294.2"	"5.0"	"52.79"	"18.66"	"39.54"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004218"	"1.28"	"48.39"
"25358"	"False"	"High"	"[K].HVVFIAQR.[R]"	""	"0.0482755"	"0.00206303"	"1"	"1"	"9"	"P62082"	"P62082 [91-98]"	""	"0"	"969.56286"	"157.895"	"3.132"	"0.925138005747468"	"0.906515362333117"	"61.73"	"49.00"	"1.6"	"292.8"	"5.6"	"53.10"	"55.28"	"22.31"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003284"	"2.25"	"25.60"
"14946"	"False"	"High"	"[K].EPLETLKSYR.[L]"	"1xBiotin [K7]"	"0.0494554"	"0.00206303"	"1"	"2"	"1"	"Q922Q1"	"Q922Q1 [290-299]"	"Q922Q1 1xBiotin [K296]"	"1"	"1461.74063"	"0.296"	"0.816"	"0.925138005747468"	"0.906515362333117"	"70.71"	"59.14"	"137.3"	"46.9"	"115.8"	"74.29"	"50.19"	"32.61"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.00338"	"1.93"	"44.39"
"18431"	"False"	"High"	"[R].FPVPTYAAKQPAQFPSRPPPPQPK.[I]"	"1xBiotin [K9]"	"0.0462757"	"0.00206303"	"1"	"1"	"3"	"Q61072"	"Q61072 [799-822]"	"Q61072 1xBiotin [K807]"	"1"	"2872.49670"	"0.518"	"0.956"	"0.928611703535518"	"0.906515362333117"	"61.32"	"57.36"	"126.4"	"55.5"	"118.1"	"45.63"	"40.65"	"36.36"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0007894"	"0.003133"	"4.26"	"45.76"
"4720"	"False"	"High"	"[R].AYSSFGGGR.[G]"	""	"0.0544591"	"0.00206303"	"1"	"2"	"15"	"Q9WUK2-1"	"Q9WUK2-1 [11-19]"	""	"0"	"901.41626"	"135.911"	"3.138"	"0.925138005747468"	"0.906515362333117"	"49.85"	"97.71"	"2.0"	"286.8"	"11.2"	"59.26"	"44.39"	"54.34"	"MandatoryModificationMissing"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003764"	"2.11"	"21.19"
"51729"	"False"	"High"	"[K].NTGKMENYELIHSSR.[V]"	"1xBiotin [K4]"	"0.0632621"	"0.00206303"	"1"	"3"	"1"	"Q80TM9-1"	"Q80TM9-1 [1389-1403]"	"Q80TM9-1 1xBiotin [K1392]"	"1"	"2004.92661"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.004478"	"2.46"	""
"24872"	"False"	"High"	"[R].HPVVSESEVFQQFLNFR.[D]"	""	"0.0617677"	"0.00206303"	"1"	"1"	"1"	"Q91VH2"	"Q91VH2 [341-357]"	""	"0"	"2063.03450"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004364"	"2.42"	""
"47320"	"False"	"High"	"[-].MSAHLQWMVVR.[N]"	"1xOxidation [M8]; 1xMet-loss+Acetyl [N-Term]"	"0.0547875"	"0.00206303"	"1"	"1"	"2"	"P41105"	"P41105 [1-11]"	"P41105 1xMet-loss+Acetyl [N-Term]"	"0"	"1284.65175"	"107.989"	"1.120"	"0.925138005747468"	"0.906515362333117"	"96.50"	"87.65"	"3.0"	"294.7"	"2.3"	"33.78"	"75.99"	"78.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.003807"	"2.56"	"41.28"
"36670"	"False"	"High"	"[R].LPFSGFR.[V]"	""	"0.0459966"	"0.00206303"	"1"	"1"	"11"	"Q9DAR7"	"Q9DAR7 [41-47]"	""	"0"	"823.44610"	"435.121"	"19.684"	"0.925138005747468"	"0.906515362333117"	"60.29"	"78.31"	"0.8"	"287.6"	"11.6"	"64.94"	"31.51"	"43.81"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003114"	"1.48"	"40.96"
"51423"	"False"	"High"	"[R].NRPHICSFWVK.[G]"	"1xCarbamidomethyl [C6]"	"0.0468387"	"0.00206303"	"1"	"1"	"5"	"Q8BHS3"	"Q8BHS3 [160-170]"	""	"0"	"1443.73140"	"170.547"	"7.300"	"0.925138005747468"	"0.906515362333117"	"58.82"	"76.45"	"1.6"	"288.7"	"9.7"	"43.52"	"45.28"	"93.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003178"	"3.32"	"36.24"
"51079"	"False"	"High"	"[K].NNSYGKSLSNSK.[H]"	"1xBiotin [K6]"	"0.0459966"	"0.00206303"	"1"	"2"	"2"	"O35495"	"O35495 [457-468]"	"O35495 1xBiotin [K462]"	"1"	"1524.71112"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003126"	"2.44"	""
"17916"	"False"	"High"	"[R].FINNEVLK.[N]"	""	"0.0509695"	"0.00206303"	"1"	"1"	"3"	"D3YU32"	"D3YU32 [20-27]"	""	"0"	"976.54621"	"42.919"	"0.820"	"0.925138005747468"	"0.906515362333117"	"85.31"	"55.94"	"6.4"	"287.8"	"5.8"	"43.09"	"70.76"	"32.07"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003496"	"2.63"	"31.18"
"51028"	"False"	"High"	"[R].NNIFKK.[K]"	"1xBiotin [K5]"	"0.05714"	"0.00206303"	"1"	"1"	"8"	"Q9D8S4"	"Q9D8S4 [212-217]"	"Q9D8S4 1xBiotin [K216]"	"1"	"989.52370"	"0.019"	"0.764"	"2.73340848125914E-05"	"0.906515362333117"	"45.99"	"55.02"	"175.1"	"3.6"	"121.4"	"24.22"	"39.08"	"93.75"	""	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003998"	"1.93"	"35.68"
"25324"	"False"	"High"	"[R].HVIPMNPNTDDLFNAVGDGIVLCK.[M]"	"1xCarbamidomethyl [C23]"	"0.0474084"	"0.00206303"	"1"	"1"	"1"	"Q61233"	"Q61233 [142-165]"	""	"0"	"2639.29562"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.00322"	"3.18"	""
"36675"	"False"	"High"	"[K].LPFYFK.[R]"	""	"0.0544591"	"0.00206303"	"1"	"1"	"1"	"O88796"	"O88796 [133-138]"	""	"0"	"814.44979"	"152.033"	"3.173"	"0.925138005747468"	"0.906515362333117"	"45.25"	"56.06"	"2.2"	"291.5"	"6.3"	"35.39"	"43.87"	"43.67"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003773"	"1.43"	"45.38"
"20417"	"False"	"High"	"[K].GFGFGLVK.[L]"	""	"0.0613993"	"0.00206303"	"1"	"1"	"22"	"Q60930"	"Q60930 [33-40]"	""	"0"	"824.46650"	"120.275"	"3.653"	"0.925138005747468"	"0.906515362333117"	"41.48"	"41.35"	"2.5"	"288.5"	"9.0"	"34.60"	"25.13"	"18.12"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004329"	"1.64"	"45.52"
"36708"	"False"	"High"	"[R].LPHVLLLQLGTTFFK.[L]"	""	"0.0471227"	"0.00206303"	"1"	"1"	"2"	"Q9CQF3"	"Q9CQF3 [91-105]"	""	"0"	"1727.02544"	"0.758"	"1.217"	"0.925138005747468"	"0.906515362333117"	"59.89"	"62.50"	"92.9"	"79.9"	"127.2"	"38.05"	"228.82"	"50.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.003194"	"2.79"	"63.28"
"36736"	"False"	"High"	"[R].LPKTGETIHGHEFFIGFGGK.[G]"	"1xBiotin [K3]"	"0.0471227"	"0.00206303"	"1"	"1"	"2"	"Q8R1Q9"	"Q8R1Q9 [36-55]"	"Q8R1Q9 1xBiotin [K38]"	"1"	"2398.20125"	"0.596"	"1.010"	"0.925138005747468"	"0.906515362333117"	"66.80"	"40.67"	"126.5"	"57.2"	"116.3"	"30.86"	"56.48"	"20.57"	""	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003215"	"2.90"	"47.75"
"35966"	"False"	"High"	"[R].LMEPIYLVEIQCPEQVVGGIYGVLNR.[K]"	"1xCarbamidomethyl [C12]; 1xOxidation [M2]"	"0.0528454"	"0.00206303"	"1"	"1"	"1"	"P58252"	"P58252 [740-765]"	""	"0"	"3005.54748"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003654"	"3.55"	""
"22017"	"False"	"High"	"[K].GMVFSINLGFSDLTNK.[E]"	"1xOxidation [M2]"	"0.0522128"	"0.00206303"	"1"	"1"	"1"	"Q920B9"	"Q920B9 [374-389]"	""	"0"	"1758.87310"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003586"	"2.36"	""
"18057"	"False"	"High"	"[K].FLTYYPGR.[R]"	""	"0.0525282"	"0.00206303"	"1"	"2"	"11"	"P24788-1"	"P24788-1 [692-699]"	""	"0"	"1016.51999"	"145.819"	"4.398"	"0.925138005747468"	"0.906515362333117"	"70.65"	"63.34"	"2.5"	"287.1"	"10.5"	"56.58"	"57.36"	"16.43"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003625"	"2.34"	"37.49"
"27423"	"False"	"High"	"[K].KKLYCIYVAIGQK.[R]"	"1xCarbamidomethyl [C5]"	"0.0468387"	"0.00206303"	"1"	"1"	"2"	"Q03265"	"Q03265 [240-252]"	""	"2"	"1583.89780"	"118.098"	"2.916"	"0.466031980976297"	"0.906515362333117"	"63.08"	"91.48"	"2.9"	"286.7"	"10.3"	"47.72"	"34.54"	"60.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003189"	"2.46"	"37.15"
"59539"	"False"	"High"	"[R].SGCKVK.[K]"	"1xBiotin [K4]; 1xCarbamidomethyl [C3]"	"0.0534853"	"0.00206303"	"1"	"1"	"14"	"Q6Y685-2"	"Q6Y685-2 [56-61]"	"Q6Y685-2 1xBiotin [K59]"	"1"	"904.43792"	"0.069"	"0.882"	"0.000885021843887706"	"0.906515362333117"	"60.57"	"58.07"	"158.3"	"12.2"	"129.6"	"32.66"	"222.99"	"50.38"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.00369"	"2.17"	"20.71"
"17460"	"False"	"High"	"[R].FGNWLK.[E]"	""	"0.0610331"	"0.00206303"	"1"	"1"	"9"	"Q8BU30"	"Q8BU30 [445-450]"	""	"0"	"764.40899"	"126.505"	"8.509"	"0.925138005747468"	"0.906515362333117"	"61.90"	"77.67"	"2.4"	"278.9"	"18.6"	"50.25"	"65.68"	"54.59"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0007894"	"0.004313"	"1.73"	"39.26"
"22154"	"False"	"High"	"[R].GNSLFFR.[K]"	""	"0.0561202"	"0.00206303"	"1"	"1"	"6"	"Q791V5"	"Q791V5 [281-287]"	""	"0"	"840.43626"	"164.486"	"3.181"	"0.925138005747468"	"0.906515362333117"	"45.78"	"65.64"	"1.5"	"291.8"	"6.7"	"46.64"	"25.65"	"48.63"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003909"	"1.99"	"39.45"
"17304"	"False"	"High"	"[R].FFSGYGR.[L]"	""	"0.0506632"	"0.00206303"	"1"	"1"	"29"	"Q3TWW8"	"Q3TWW8 [21-27]"	""	"0"	"833.39406"	"125.103"	"4.234"	"0.925138005747468"	"0.906515362333117"	"58.31"	"57.80"	"2.6"	"287.1"	"10.3"	"42.84"	"46.75"	"40.40"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003474"	"1.68"	"30.34"
"61609"	"False"	"High"	"[R].SPTWFGIPR.[L]"	""	"0.0471227"	"0.00206303"	"1"	"6"	"1"	"Q9ESZ8-1"	"Q9ESZ8-1 [620-628]"	""	"0"	"1060.55744"	"50.883"	"1.779"	"0.716607214650224"	"0.990231025792746"	"141.68"	"71.73"	"4.5"	"285.6"	"9.9"	"44.44"	"114.03"	"41.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003207"	"1.52"	"48.18"
"27739"	"False"	"High"	"[K].KLFVGGLK.[G]"	""	"0.0479848"	"0.00206303"	"1"	"1"	"1"	"Q9CX86"	"Q9CX86 [99-106]"	""	"1"	"861.55565"	"86.939"	"2.954"	"0.972075648754221"	"0.906515362333117"	"78.12"	"69.57"	"3.4"	"285.0"	"11.6"	"55.65"	"59.44"	"38.63"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003271"	"1.55"	"29.46"
"23481"	"False"	"High"	"[K].GVAPLWMR.[Q]"	"1xOxidation [M7]"	"0.0476957"	"0.00206303"	"1"	"1"	"11"	"Q8VEM8"	"Q8VEM8 [214-221]"	""	"0"	"945.49748"	"256.229"	"5.210"	"0.925138005747468"	"0.906515362333117"	"49.69"	"68.25"	"1.2"	"293.2"	"5.6"	"40.22"	"35.14"	"48.21"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003251"	"2.01"	"36.62"
"17315"	"False"	"High"	"[R].FFVMTSLR.[N]"	"1xOxidation [M4]"	"0.0474084"	"0.00206303"	"1"	"1"	"6"	"Q8JZU2"	"Q8JZU2 [199-206]"	""	"0"	"1016.52336"	"20.485"	"0.886"	"0.925138005747468"	"0.906515362333117"	"32.15"	"23.85"	"13.1"	"275.1"	"11.8"	"17.96"	"34.12"	"15.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003222"	"1.62"	"39.81"
"19136"	"False"	"High"	"[R].FYIVWTK.[L]"	""	"0.0468387"	"0.00206303"	"1"	"2"	"3"	"Q60766"	"Q60766 [185-191]"	""	"0"	"956.52402"	"9.839"	"1.614"	"0.925138005747468"	"0.920591500872547"	"154.56"	"64.15"	"25.1"	"232.2"	"42.7"	"48.01"	"129.21"	"58.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003183"	"1.58"	"47.36"
"61028"	"False"	"High"	"[K].SMNIFGGFR.[Q]"	""	"0.0468387"	"0.00206303"	"1"	"1"	"4"	"Q8BMD8"	"Q8BMD8 [229-237]"	""	"0"	"1028.49821"	"2.117"	"3.676"	"0.950115942942876"	"0.906515362333117"	"93.62"	"64.41"	"42.5"	"80.6"	"176.9"	"47.20"	"151.38"	"51.15"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"0.0007894"	"0.00319"	"1.93"	"49.30"
"8292"	"False"	"High"	"[R].DILKEMFPYEASTPTGISASCR.[R]"	"1xBiotin [K4]; 1xCarbamidomethyl [C21]"	"0.0518993"	"0.00206303"	"1"	"4"	"1"	"Q61029"	"Q61029 [342-363]"	"Q61029 1xBiotin [K345]"	"1"	"2699.25137"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003571"	"1.95"	""
"60625"	"False"	"High"	"[K].SINPLGGFVHYGEVTNDFIMLK.[G]"	""	"0.0471227"	"0.00206303"	"1"	"1"	"1"	"P27659"	"P27659 [313-334]"	""	"0"	"2451.23769"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003211"	"2.63"	""
"32694"	"False"	"High"	"[K].LFYLGIR.[GQ]"	""	"0.05545"	"0.00206303"	"1"	"3"	"3"	"Q8BWR2"	"Q8BWR2 [167-173]"	""	"0"	"881.52435"	"97.905"	"2.463"	"0.42732975126201"	"0.937500052802293"	"35.94"	"33.50"	"2.6"	"290.8"	"6.6"	"23.08"	"54.30"	"35.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003855"	"1.72"	"48.22"
"32369"	"False"	"High"	"[R].IEYLHAKLLEK.[R]"	"1xBiotin [K7]"	"0.0564581"	"0.00206303"	"1"	"3"	"1"	"Q7TNJ0-1"	"Q7TNJ0-1 [417-427]"	"Q7TNJ0-1 1xBiotin [K423]"	"1"	"1582.86616"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003932"	"2.15"	""
"33053"	"False"	"High"	"[R].LGIYTVLFER.[L]"	""	"0.0494554"	"0.00206303"	"1"	"1"	"1"	"Q9CR62"	"Q9CR62 [99-108]"	""	"0"	"1210.68304"	"0.174"	"0.823"	"0.925138005747468"	"0.906515362333117"	"60.39"	"47.46"	"154.8"	"26.6"	"118.6"	"37.74"	"29.07"	"40.67"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003373"	"1.87"	"57.78"
"31604"	"False"	"High"	"[K].LDKNDR.[A]"	"1xBiotin [K3]"	"0.0544591"	"0.00206303"	"1"	"1"	"13"	"P51150"	"P51150 [192-197]"	"P51150 1xBiotin [K194]"	"1"	"986.47239"	"0.047"	"0.696"	"0.000373107427677743"	"0.906515362333117"	"62.02"	"48.19"	"174.7"	"8.4"	"117.0"	"36.25"	"43.01"	"31.00"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003772"	"2.08"	"25.34"
"27218"	"False"	"High"	"[K].KGVWGVFYK.[A]"	""	"0.0531644"	"0.00206303"	"1"	"1"	"1"	"Q80X45"	"Q80X45 [39-47]"	""	"1"	"1083.59858"	"2.343"	"1.979"	"0.925138005747468"	"0.974397579791771"	"99.88"	"71.04"	"50.8"	"119.1"	"130.1"	"64.55"	"165.06"	"38.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0007894"	"0.003671"	"2.29"	"41.54"
"27632"	"False"	"High"	"[K].KLDLEAWFPGSGAFR.[E]"	""	"0.0544591"	"0.00206303"	"1"	"1"	"2"	"P26638"	"P26638 [376-390]"	""	"1"	"1693.86967"	"6.913"	"1.174"	"0.925138005747468"	"0.906515362333117"	"314.64"	"53.62"	"36.5"	"221.5"	"42.0"	"15.05"	"106.51"	"42.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003763"	"2.12"	"57.78"
"60017"	"False"	"High"	"[R].SKDWYK.[T]"	"1xBiotin [K2]"	"0.0476957"	"0.00206303"	"1"	"7"	"7"	"Q62417"	"Q62417 [226-231]"	"Q62417 1xBiotin [K227]"	"1"	"1052.48698"	"0.187"	"0.728"	"0.925138005747468"	"0.906515362333117"	"35.76"	"70.93"	"150.3"	"28.1"	"121.6"	"33.10"	"19.93"	"61.32"	""	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.00325"	"2.23"	"37.86"
"33066"	"False"	"High"	"[K].LGNFFSPK.[V]"	""	"0.0500558"	"0.00206303"	"1"	"1"	"8"	"Q9JKF1"	"Q9JKF1 [81-88]"	""	"0"	"909.48288"	"20.828"	"0.656"	"0.925138005747468"	"0.906515362333117"	"38.87"	"36.64"	"14.9"	"275.6"	"9.5"	"27.62"	"36.61"	"20.49"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003425"	"2.40"	"38.95"
"60045"	"False"	"High"	"[K].SKFADLSEAANR.[N]"	"1xBiotin [K2]"	"0.0471227"	"0.00206303"	"1"	"1"	"4"	"P20152"	"P20152 [293-304]"	"P20152 1xBiotin [K294]"	"1"	"1534.73185"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003206"	"2.14"	""
"39659"	"False"	"High"	"[K].IYLSYYR.[S]"	""	"0.0503586"	"0.00206303"	"1"	"2"	"2"	"Q8C754"	"Q8C754 [295-301]"	""	"0"	"977.50909"	"91.729"	"2.973"	"0.982626859977453"	"0.915242122105656"	"43.56"	"41.00"	"2.9"	"288.0"	"9.1"	"38.63"	"20.21"	"10.52"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003446"	"1.41"	"37.77"
"32442"	"False"	"High"	"[R].IFGGFLMR.[K]"	"1xOxidation [M7]"	"0.0592331"	"0.00206303"	"1"	"2"	"14"	"Q32MW3"	"Q32MW3 [310-317]"	""	"0"	"956.50223"	"224.531"	"3.700"	"0.925138005747468"	"0.906515362333117"	"58.12"	"64.78"	"1.4"	"295.0"	"3.6"	"51.63"	"23.78"	"51.86"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004154"	"1.53"	"45.37"
"31625"	"False"	"High"	"[K].LDLGFKDGQTIK.[I]"	"1xBiotin [K6]"	"0.0551178"	"0.00206303"	"1"	"1"	"2"	"Q9D1J1"	"Q9D1J1 [148-159]"	"Q9D1J1 1xBiotin [K153]"	"1"	"1560.80904"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003815"	"2.21"	""
"9120"	"False"	"High"	"[R].DQHLQPSKDHR.[T]"	"1xBiotin [K8]"	"0.0506632"	"0.00206303"	"1"	"1"	"2"	"Q62178"	"Q62178 [732-742]"	"Q62178 1xBiotin [K739]"	"1"	"1586.74923"	"0.921"	"0.731"	"0.950115942942876"	"0.906515362333117"	"67.71"	"75.50"	"108.5"	"108.5"	"83.0"	"54.68"	"20.16"	"46.13"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003475"	"2.51"	"22.83"
"43394"	"False"	"High"	"[-].MFSWMGR.[Q]"	"1xAcetyl [N-Term]"	"0.0567981"	"0.00206303"	"1"	"1"	"1"	"Q9EQP2"	"Q9EQP2 [1-7]"	"Q9EQP2 1xAcetyl [N-Term]"	"0"	"956.41171"	"1.810"	"4.996"	"0.925138005747468"	"0.906515362333117"	"97.69"	"55.04"	"41.5"	"62.7"	"195.8"	"45.18"	"172.90"	"42.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003957"	"1.44"	"62.21"
"43281"	"False"	"High"	"[K].MFIGGLSWDTTK.[K]"	""	"0.0525282"	"0.00206303"	"1"	"4"	"1"	"Q60668-1"	"Q60668-1 [99-110]"	""	"0"	"1355.66640"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003627"	"2.09"	""
"33086"	"False"	"High"	"[R].LGPGQLTWKNSER.[G]"	"1xBiotin [K9]"	"0.0564581"	"0.00206303"	"1"	"2"	"3"	"Q8BP97-1"	"Q8BP97-1 [260-272]"	"Q8BP97-1 1xBiotin [K268]"	"1"	"1711.85845"	"1.012"	"0.868"	"0.994201151226993"	"0.906515362333117"	"67.62"	"54.83"	"99.9"	"107.8"	"92.4"	"58.59"	"37.21"	"30.12"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.0007894"	"0.003926"	"1.82"	"45.24"
"41244"	"False"	"High"	"[-].MASFIWVQLK.[K]"	"1xMet-loss+Acetyl [N-Term]"	"0.0512776"	"0.00206303"	"1"	"3"	"5"	"Q9WU78"	"Q9WU78 [1-10]"	"Q9WU78 1xMet-loss+Acetyl [N-Term]"	"0"	"1133.63536"	"45.959"	"1.270"	"0.925138005747468"	"0.906515362333117"	"61.13"	"69.94"	"8.3"	"281.6"	"10.1"	"45.35"	"46.01"	"52.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"0.0007894"	"0.003517"	"1.80"	"64.10"
"33316"	"False"	"High"	"[R].LHFMFDLGKGR.[T]"	"1xBiotin [K9]; 1xOxidation [M4]"	"0.0613993"	"0.00206303"	"1"	"1"	"1"	"P19137"	"P19137 [2782-2792]"	"P19137 1xBiotin [K2790]"	"1"	"1562.76065"	"108.855"	"3.283"	"0.929016530787821"	"0.906515362333117"	"147.85"	"172.44"	"0.9"	"294.9"	"4.2"	"111.81"	"98.62"	"73.56"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004347"	"2.41"	"16.61"
"32447"	"False"	"High"	"[R].IFGLLMGTLQK.[F]"	"1xOxidation [M6]"	"0.0497547"	"0.00206303"	"1"	"1"	"1"	"O35691"	"O35691 [144-154]"	""	"0"	"1236.70206"	"64.580"	"1.244"	"0.530693687265835"	""	"142.03"	"52.77"	"4.7"	"289.9"	"5.4"	"38.82"	"101.68"	"26.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003395"	"2.15"	"50.37"
"62673"	"False"	"High"	"[K].STTTGHLIYK.[C]"	""	"0.0512776"	"0.00206303"	"1"	"2"	"7"	"P10126"	"P10126 [21-30]"	""	"0"	"1120.59970"	"214.959"	"6.109"	"0.925138005747468"	"0.906515362333117"	"86.69"	"79.42"	"1.2"	"292.1"	"6.7"	"71.31"	"32.05"	"57.14"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003509"	"2.38"	"21.32"
"23712"	"False"	"High"	"[K].GWGLYCAGK.[A]"	"1xCarbamidomethyl [C6]"	"0.05714"	"0.00206303"	"1"	"1"	"1"	"Q64105"	"Q64105 [167-175]"	""	"0"	"1011.47166"	"71.396"	"2.331"	"0.477067253044389"	"0.916215054610739"	"40.28"	"47.32"	"4.2"	"285.6"	"10.2"	"39.61"	"23.51"	"44.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003998"	"1.74"	"37.74"
"26830"	"False"	"High"	"[R].KGAEPCGGAAR.[G]"	"1xBiotin [K1]; 1xCarbamidomethyl [C6]"	"0.0515876"	"0.00206303"	"1"	"1"	"1"	"Q9D1C1"	"Q9D1C1 [18-28]"	"Q9D1C1 1xBiotin [K18]"	"1"	"1299.59325"	"0.797"	"1.104"	"0.925138005747468"	"0.906515362333117"	"59.05"	"59.84"	"100.2"	"95.6"	"104.2"	"40.37"	"47.51"	"43.34"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.003546"	"1.95"	"22.75"
"62604"	"False"	"High"	"[K].STLINSLFLTDLYSPEYPGPSHR.[I]"	""	"0.0628853"	"0.00206303"	"1"	"1"	"2"	"O55131"	"O55131 [63-85]"	""	"0"	"2607.30894"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004471"	"2.10"	""
"32431"	"False"	"High"	"[R].LFFGPQHRPVILR.[L]"	""	"0.0599469"	"0.00206303"	"1"	"1"	"5"	"Q8K1B8"	"Q8K1B8 [91-103]"	""	"0"	"1579.92198"	"199.162"	"6.399"	"0.925138005747468"	"0.906515362333117"	"43.69"	"62.26"	"1.4"	"288.7"	"9.8"	"41.18"	"38.40"	"53.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.004216"	"1.99"	"41.64"
"39703"	"False"	"High"	"[R].LYQFLLDLLR.[S]"	""	"0.0588792"	"0.00206303"	"1"	"1"	"3"	"P17433"	"P17433 [174-183]"	""	"0"	"1293.75653"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004141"	"1.85"	""
"58445"	"False"	"High"	"[R].SAAAFKPVGSTSVK.[S]"	"1xBiotin [K6]"	"0.0578297"	"0.00206303"	"1"	"1"	"6"	"Q8CI51"	"Q8CI51 [345-358]"	"Q8CI51 1xBiotin [K350]"	"0"	"1575.81994"	"0.371"	"0.744"	"0.925138005747468"	"0.906515362333117"	"60.60"	"65.42"	"137.4"	"58.3"	"104.4"	"37.43"	"44.70"	"68.63"	""	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004044"	"2.70"	"38.73"
"32461"	"False"	"High"	"[K].IFGVTTLDIVR.[A]"	""	"0.05714"	"0.00206303"	"1"	"1"	"2"	"P08249"	"P08249 [166-176]"	""	"0"	"1233.72015"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003979"	"1.70"	""
"58529"	"False"	"High"	"[K].SAFGGGYYR.[G]"	""	"0.0599469"	"0.00206303"	"1"	"3"	"1"	"Q9CQV7"	"Q9CQV7 [43-51]"	""	"0"	"977.44756"	"236.482"	"6.767"	"0.925138005747468"	"0.906515362333117"	"39.91"	"57.65"	"1.4"	"287.7"	"10.9"	"30.38"	"31.55"	"45.37"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004224"	"1.72"	"29.87"
"33737"	"False"	"High"	"[R].IKLGLK.[S]"	"1xBiotin [K2]"	"0.059589"	"0.00206303"	"4"	"5"	"11"	"P43275; P43276; P15864; P43277"	"P43275 [82-87]; P43276 [80-85]; P15864 [80-85]; P43277 [81-86]"	"P43275 1xBiotin [K83]; P43276 1xBiotin [K81]; P15864 1xBiotin [K81]; P43277 1xBiotin [K82]"	"1"	"897.55902"	"0.106"	"0.686"	"0.00587526965505829"	"0.906515362333117"	"48.55"	"45.17"	"163.5"	"19.4"	"117.1"	"38.53"	"38.20"	"32.41"	"NotUnique"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004171"	"2.17"	"39.37"
"32661"	"False"	"High"	"[R].LFTNFHR.[Q]"	""	"0.053808"	"0.00206303"	"1"	"1"	"5"	"P53810"	"P53810 [221-227]"	""	"0"	"934.48936"	"219.051"	"8.167"	"0.731380567752682"	"0.906515362333117"	"56.25"	"38.92"	"1.4"	"288.1"	"10.5"	"21.48"	"43.37"	"29.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.003729"	"1.73"	"29.61"
"39522"	"False"	"High"	"[R].LWISVAR.[Y]"	""	"0.0503586"	"0.00206303"	"1"	"1"	"6"	"O08810"	"O08810 [529-535]"	""	"0"	"844.50395"	"359.287"	"9.759"	"0.925138005747468"	"0.906515362333117"	"74.09"	"73.29"	"0.8"	"292.8"	"6.4"	"52.68"	"63.82"	"55.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.003457"	"1.59"	"41.16"
"58964"	"False"	"High"	"[K].SDDFHTFGPIFLEKGFER.[E]"	"1xBiotin [K14]"	"0.0462757"	"0.00206303"	"1"	"1"	"1"	"P51829"	"P51829 [567-584]"	"P51829 1xBiotin [K580]"	"1"	"2368.10668"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0007894"	"0.003132"	"2.77"	""
"59281"	"False"	"High"	"[K].SEITELR.[R]"	""	"0.060669"	"0.00206303"	"1"	"3"	"1"	"P02535-1"	"P02535-1 [361-367]"	""	"0"	"847.45197"	"1.305"	"1.590"	"0.947989303413716"	""	"83.53"	"47.86"	"81.4"	"96.6"	"122.0"	"53.38"	"211.62"	"23.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.00427"	"1.58"	"26.00"
"32497"	"False"	"High"	"[R].IFIGTFK.[A]"	""	"0.0585274"	"0.00206303"	"1"	"2"	"4"	"P27048"	"P27048 [26-32]"	""	"0"	"825.48690"	"236.608"	"8.319"	"0.925138005747468"	"0.906515362333117"	"86.52"	"81.76"	"1.5"	"285.1"	"13.4"	"66.34"	"92.66"	"39.66"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004096"	"2.18"	"41.03"
"33656"	"False"	"High"	"[K].IKFPLPHR.[V]"	""	"0.0625106"	"0.00206303"	"1"	"1"	"7"	"P62717"	"P62717 [150-157]"	""	"1"	"1007.61490"	"210.060"	"8.292"	"0.925138005747468"	"0.906515362333117"	"126.39"	"40.34"	"1.2"	"287.8"	"10.9"	"43.06"	"91.46"	"32.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0007894"	"0.004428"	"1.78"	"31.74"
"59412"	"False"	"High"	"[R].SFFSEIISSISDVK.[F]"	""	"0.0459966"	"0.00206303"	"1"	"5"	"1"	"Q925E7"	"Q925E7 [285-298]"	""	"0"	"1558.79992"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.003127"	"1.83"	""
"31325"	"False"	"High"	"[K].LAYYYQR.[K]"	""	"0.0603069"	"0.00206303"	"1"	"1"	"3"	"P14576-1"	"P14576-1 [121-127]"	""	"0"	"976.48869"	"250.919"	"4.888"	"0.925138005747468"	"0.906515362333117"	"61.06"	"62.12"	"1.4"	"291.2"	"7.4"	"46.97"	"35.11"	"45.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004249"	"1.62"	"29.40"
"32521"	"False"	"High"	"[R].LFLQFVTGSPR.[L]"	""	"0.0585274"	"0.00206303"	"1"	"1"	"1"	"G5E870"	"G5E870 [1946-1956]"	""	"0"	"1264.70483"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004093"	"2.53"	""
"32534"	"False"	"High"	"[R].IFMHHLCR.[A]"	"1xCarbamidomethyl [C7]; 1xOxidation [M3]"	"0.0588792"	"0.00206303"	"1"	"1"	"5"	"Q7TPV4"	"Q7TPV4 [878-885]"	""	"0"	"1129.53937"	"231.040"	"3.722"	"0.925138005747468"	"0.906515362333117"	"80.59"	"66.57"	"1.8"	"292.2"	"6.0"	"53.04"	"59.75"	"36.84"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004141"	"1.58"	"19.12"
"28050"	"False"	"High"	"[K].KIPVVFR.[L]"	""	"0.0581775"	"0.00206303"	"1"	"1"	"4"	"Q9R0P3"	"Q9R0P3 [247-253]"	""	"1"	"858.55598"	"192.325"	"4.213"	"0.925138005747468"	"0.906515362333117"	"60.34"	"64.74"	"1.5"	"291.3"	"7.3"	"53.08"	"21.66"	"26.88"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004067"	"2.02"	"32.19"
"6796"	"False"	"High"	"[R].DCKGDTLGSDWGGAMWT.[-]"	"1xBiotin [K3]; 1xCarbamidomethyl [C2]; 1xOxidation [M15]"	"0.0494554"	"0.00206303"	"1"	"1"	"2"	"P01896"	"P01896 [169-185]"	"P01896 1xBiotin [K171]"	"1"	"2098.83032"	"0.337"	"0.978"	"0.925138005747468"	"0.906515362333117"	"56.37"	"48.95"	"128.7"	"44.0"	"127.4"	"43.52"	"39.07"	"40.97"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0007894"	"0.003374"	"2.93"	"55.96"
"32620"	"False"	"High"	"[R].IFSAYIK.[E]"	""	"0.0564581"	"0.00206303"	"1"	"1"	"7"	"Q9WV32"	"Q9WV32 [168-174]"	""	"0"	"841.48182"	"126.151"	"3.205"	"0.929016530787821"	"0.906515362333117"	"43.42"	"52.30"	"2.5"	"289.8"	"7.6"	"39.76"	"23.38"	"36.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003943"	"1.66"	"36.58"
"58765"	"False"	"High"	"[K].SATTTVMNPKFAES.[-]"	"1xBiotin [K10]"	"0.0479848"	"0.00206303"	"1"	"1"	"5"	"P11835"	"P11835 [758-771]"	"P11835 1xBiotin [K767]"	"1"	"1709.78732"	"0.142"	"0.867"	"0.925138005747468"	"0.906515362333117"	"40.86"	"33.15"	"151.8"	"22.6"	"125.6"	"22.42"	"43.73"	"25.11"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0007894"	"0.003262"	"2.13"	"46.37"
"23199"	"False"	"High"	"[K].GSVSLKELNARPLEVFMCSVLK.[R]"	"1xBiotin [K6]; 1xCarbamidomethyl [C18]"	"0.059589"	"0.00206303"	"1"	"1"	"2"	"Q9CQC9"	"Q9CQC9 [161-182]"	"Q9CQC9 1xBiotin [K166]"	"1"	"2703.40306"	"1.083"	"1.263"	""	"0.906515362333117"	"47.19"	"61.38"	"90.8"	"103.2"	"106.0"	"34.68"	"33.63"	"55.30"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.0007894"	"0.004172"	"1.77"	"66.44"
"62563"	"False"	"High"	"[K].STGGKAPR.[K]"	"1xBiotin [K5]"	"0.0636411"	"0.00240334"	"1"	"4"	"3"	"P84244"	"P84244 [11-18]"	"P84244 1xBiotin [K15]"	"1"	"999.50402"	"0.565"	"0.764"	"0.925138005747468"	"0.906515362333117"	"53.35"	"59.20"	"112.4"	"75.9"	"111.7"	"37.70"	"32.24"	"56.46"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0007894"	"0.004515"	"1.64"	"20.13"
"32656"	"False"	"High"	"[K].IFTFGSYR.[L]"	""	"0.0636411"	"0.00240334"	"1"	"6"	"11"	"Q61183-1"	"Q61183-1 [97-104]"	""	"0"	"990.50434"	"139.420"	"3.841"	"0.925138005747468"	"0.906515362333117"	"72.80"	"74.07"	"1.9"	"289.9"	"8.2"	"61.48"	"40.38"	"35.81"	"MandatoryModificationMissing"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0008264"	"0.004534"	"1.97"	"42.92"
"19061"	"False"	"High"	"[K].FWSLQDYFR.[N]"	""	"0.0636411"	"0.00240334"	"1"	"1"	"1"	"Q8R3N6"	"Q8R3N6 [238-246]"	""	"0"	"1261.60003"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0008264"	"0.004519"	"2.37"	""
"12354"	"False"	"High"	"[K].EGKIYR.[NL]"	"1xBiotin [K3]"	"0.0636411"	"0.00240334"	"1"	"3"	"24"	"Q8VCH8"	"Q8VCH8 [479-484]"	"Q8VCH8 1xBiotin [K481]"	"1"	"991.50296"	"0.007"	"1.107"	"3.41745047212072E-06"	"0.935866453494337"	"36.11"	"30.30"	"142.6"	"0.9"	"156.5"	"20.77"	"39.33"	"25.57"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0007894"	"0.004513"	"1.91"	"30.46"
"71417"	"False"	"High"	"[R].YGDFFIR.[Q]"	""	"0.0636411"	"0.00240334"	"1"	"1"	"2"	"Q8QZY1"	"Q8QZY1 [539-545]"	""	"0"	"917.45158"	"87.343"	"1.932"	"0.81935588402079"	"0.979115753446745"	"67.68"	"61.38"	"3.0"	"290.4"	"6.6"	"52.03"	"32.73"	"34.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0008264"	"0.004526"	"1.56"	"43.85"
"44102"	"False"	"High"	"[K].MGWIKPR.[R]"	"1xOxidation [M1]"	"0.0636411"	"0.00240334"	"1"	"1"	"1"	"P97452"	"P97452 [251-257]"	""	"0"	"903.48692"	"171.537"	"2.216"	"0.425904733810833"	"0.957997056050743"	"66.09"	"53.68"	"1.9"	"293.9"	"4.2"	"30.08"	"66.72"	"80.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0007894"	"0.004511"	"1.72"	"21.27"
"18911"	"False"	"High"	"[K].FTVLLMPNGPMR.[I]"	"2xOxidation [M6; M11]"	"0.0640222"	"0.00240334"	"1"	"2"	"2"	"P50580"	"P50580 [321-332]"	""	"0"	"1407.71230"	"92.493"	"1.324"	"0.477067253044389"	""	"58.18"	"53.41"	"3.3"	"292.4"	"4.2"	"24.65"	"63.52"	"45.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0008264"	"0.004574"	"2.04"	"41.45"
"69740"	"False"	"High"	"[K].VVIDKHPVR.[F]"	"1xBiotin [K5]"	"0.0636411"	"0.00240334"	"1"	"1"	"1"	"Q3TP92"	"Q3TP92 [97-105]"	"Q3TP92 1xBiotin [K101]"	"1"	"1288.71944"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0008264"	"0.004537"	"2.13"	""
"15354"	"False"	"High"	"[K].EQQPKVR.[G]"	"1xBiotin [K5]"	"0.0644055"	"0.00274746"	"1"	"1"	"8"	"Q9D0K1"	"Q9D0K1 [307-313]"	"Q9D0K1 1xBiotin [K311]"	"1"	"1110.57244"	"0.212"	"0.839"	"0.925138005747468"	"0.906515362333117"	"61.77"	"35.98"	"136.7"	"35.9"	"127.4"	"39.50"	"43.44"	"15.20"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000864"	"0.004597"	"2.03"	"23.42"
"16959"	"False"	"High"	"[K].FASFIDK.[V]"	""	"0.0644055"	"0.00274746"	"7"	"17"	"1"	"Q3TTY5; Q9R0H5; Q6NXH9; P04104; Q8VED5; Q3UV17; Q922U2"	"Q3TTY5 [210-216]; Q9R0H5 [142-148]; Q6NXH9 [142-148]; P04104 [199-205]; Q8VED5 [150-156]; Q3UV17 [176-182]; Q922U2 [173-179]"	""	"0"	"827.42978"	"1.069"	"1.093"	"0.137899234869517"	""	"55.33"	"50.46"	"98.6"	"98.1"	"103.2"	"39.37"	"240.28"	"41.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000864"	"0.004595"	"1.74"	"35.25"
"4564"	"False"	"High"	"[K].AVTKAQK.[K]"	"1xBiotin [K4]"	"0.064791"	"0.00307305"	"1"	"8"	"11"	"Q6ZWY9"	"Q6ZWY9 [18-24]"	"Q6ZWY9 1xBiotin [K21]"	"1"	"971.53426"	"0.122"	"0.994"	"0.101556905500078"	"0.906515362333117"	"51.65"	"70.75"	"142.1"	"17.8"	"140.2"	"23.74"	"50.98"	"71.45"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.000864"	"0.004633"	"2.04"	"20.89"
"24192"	"False"	"High"	"[R].HFGGMAWYFVNK.[K]"	"1xOxidation [M5]"	"0.0651787"	"0.00307305"	"1"	"1"	"2"	"Q9CXW2"	"Q9CXW2 [266-277]"	""	"0"	"1472.67797"	"89.774"	"0.698"	"0.925138005747468"	"0.906515362333117"	"60.27"	"79.05"	"3.3"	"294.4"	"2.3"	"47.10"	"35.44"	"104.39"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004671"	"2.41"	"42.71"
"33404"	"False"	"High"	"[K].IHPQTIISGWR.[E]"	""	"0.0659606"	"0.00307305"	"1"	"1"	"13"	"P80314"	"P80314 [121-131]"	""	"0"	"1307.72188"	"242.941"	"6.951"	"0.925138005747468"	"0.906515362333117"	"62.16"	"71.89"	"1.2"	"290.8"	"8.0"	"50.16"	"31.38"	"52.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.000899"	"0.004735"	"2.59"	"39.66"
"26734"	"False"	"High"	"[R].KFLALMR.[E]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"3"	"P46460"	"P46460 [728-734]"	""	"1"	"878.52806"	"1.302"	"5.291"	"0.989369718514603"	"0.906515362333117"	"60.16"	"60.24"	"36.9"	"45.5"	"217.7"	"28.37"	"154.91"	"50.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000899"	"0.004702"	"1.61"	"36.47"
"71292"	"False"	"High"	"[R].YFEITDESPYVHYLNTFSSK.[E]"	""	"0.0659606"	"0.00307305"	"1"	"1"	"1"	"Q9WUM4"	"Q9WUM4 [292-311]"	""	"0"	"2440.13433"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004737"	"2.36"	""
"39497"	"False"	"High"	"[R].IWGNVTR.[W]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"1"	"Q9Z1Q9"	"Q9Z1Q9 [183-189]"	""	"0"	"845.46281"	"0.196"	"3.149"	"0.925138005747468"	"0.906515362333117"	"63.37"	"49.81"	"69.0"	"13.6"	"217.4"	"51.43"	"34.45"	"15.51"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000899"	"0.004696"	"1.59"	"28.25"
"66788"	"False"	"High"	"[R].VDKSAVGFNEMEAPTTAYK.[K]"	"1xBiotin [K3]"	"0.064791"	"0.00307305"	"1"	"1"	"1"	"P49710"	"P49710 [205-223]"	"P49710 1xBiotin [K207]"	"1"	"2284.06243"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000864"	"0.004621"	"2.39"	""
"66790"	"False"	"High"	"[R].VDKWWGNRK.[E]"	""	"0.064791"	"0.00307305"	"1"	"1"	"4"	"P51410"	"P51410 [57-65]"	""	"2"	"1188.62725"	"157.884"	"4.819"	"0.925138005747468"	"0.906515362333117"	"51.94"	"39.09"	"1.9"	"289.5"	"8.5"	"26.96"	"46.49"	"30.57"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.000899"	"0.004636"	"1.80"	"23.88"
"4288"	"False"	"High"	"[K].ATWPVWR.[G]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"4"	"E9Q634"	"E9Q634 [642-648]"	""	"0"	"915.48355"	"124.627"	"4.268"	"0.925138005747468"	"0.906515362333117"	"78.58"	"21.03"	"1.8"	"290.7"	"7.5"	"76.32"	"46.17"	"37.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.000899"	"0.004688"	"1.52"	"44.05"
"16682"	"False"	"High"	"[R].EVWFFGLQYVDSK.[G]"	""	"0.0659606"	"0.00307305"	"1"	"1"	"2"	"P26043"	"P26043 [41-53]"	""	"0"	"1617.79477"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004717"	"1.59"	""
"31310"	"False"	"High"	"[R].IAWYLR.[D]"	""	"0.0651787"	"0.00307305"	"1"	"1"	"13"	"O35459"	"O35459 [137-142]"	""	"0"	"821.46684"	"86.712"	"3.019"	"0.972075648754221"	"0.906515362333117"	"67.85"	"70.59"	"2.5"	"288.7"	"8.8"	"61.14"	"37.31"	"38.63"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.000899"	"0.004647"	"1.63"	"42.94"
"63848"	"False"	"High"	"[R].TFSPSKPAK.[S]"	"1xBiotin [K6]"	"0.0651787"	"0.00307305"	"1"	"1"	"7"	"Q8C1Y8"	"Q8C1Y8 [72-80]"	"Q8C1Y8 1xBiotin [K77]"	"0"	"1188.60816"	"0.201"	"0.743"	"0.861442719681534"	"0.906515362333117"	"35.31"	"42.18"	"156.3"	"30.9"	"112.8"	"14.99"	"37.21"	"51.05"	""	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.000899"	"0.004659"	"2.27"	"32.43"
"64763"	"False"	"High"	"[K].TLPLVLK.[A]"	"1xBiotin [K7]"	"0.0651787"	"0.00307305"	"1"	"4"	"1"	"Q6ZPK0"	"Q6ZPK0 [141-147]"	"Q6ZPK0 1xBiotin [K147]"	"0"	"1009.61145"	"0.340"	"1.116"	"0.925138005747468"	"0.908711615301771"	"44.56"	"58.67"	"120.6"	"41.4"	"137.9"	"33.35"	"28.98"	"45.29"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000899"	"0.004668"	"1.66"	"55.22"
"34451"	"False"	"High"	"[K].LIFLNFVR.[V]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"2"	"Q99LR1"	"Q99LR1 [100-107]"	""	"0"	"1021.61931"	"95.043"	"2.072"	"0.434853540501642"	"0.990231025792746"	"42.97"	"67.03"	"2.8"	"291.0"	"6.2"	"41.02"	"20.77"	"55.42"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.000899"	"0.004699"	"1.66"	"57.80"
"53084"	"False"	"High"	"[K].QFSQYIK.[N]"	""	"0.0651787"	"0.00307305"	"1"	"1"	"2"	"P47962"	"P47962 [222-228]"	""	"0"	"913.47779"	"204.620"	"5.653"	"0.925138005747468"	"0.906515362333117"	"42.65"	"68.46"	"1.4"	"291.5"	"7.1"	"49.90"	"33.48"	"42.21"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.000899"	"0.004654"	"2.12"	"31.05"
"38701"	"False"	"High"	"[K].ITLESFLAWK.[K]"	""	"0.0655685"	"0.00307305"	"1"	"2"	"1"	"Q3TIV5-1"	"Q3TIV5-1 [250-259]"	""	"0"	"1207.67214"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004675"	"2.05"	""
"53856"	"False"	"High"	"[K].QLGGGYYVFPGASHNR.[F]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"3"	"Q60710"	"Q60710 [150-165]"	""	"0"	"1722.83468"	"61.693"	"1.393"	"0.925138005747468"	"0.906515362333117"	"63.95"	"70.46"	"4.5"	"288.5"	"7.1"	"44.67"	"69.56"	"49.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.000899"	"0.004702"	"3.09"	"38.88"
"46571"	"False"	"High"	"[K].MPIVGLGTWK.[S]"	""	"0.0659606"	"0.00307305"	"1"	"2"	"2"	"P45377"	"P45377 [13-22]"	""	"0"	"1101.61251"	"34.714"	"3.676"	"0.925138005747468"	"0.906515362333117"	"124.90"	"43.85"	"7.5"	"266.5"	"26.0"	"41.16"	"84.03"	"28.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.000899"	"0.004709"	"2.36"	"49.10"
"38856"	"False"	"High"	"[K].ITSEELHYFVQNHFTSAR.[M]"	""	"0.0655685"	"0.00307305"	"1"	"1"	"1"	"Q9DB77"	"Q9DB77 [200-217]"	""	"0"	"2179.05669"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004707"	"2.33"	""
"28775"	"False"	"High"	"[K].KPDDGKMK.[G]"	"1xBiotin [K6]; 1xOxidation [M7]"	"0.0695912"	"0.00333299"	"1"	"1"	"8"	"Q9CPU0"	"Q9CPU0 [152-159]"	"Q9CPU0 1xBiotin [K157]"	"1"	"1160.54384"	"0.189"	"0.763"	"0.925138005747468"	"0.906515362333117"	"22.61"	"70.50"	"154.0"	"29.4"	"116.6"	"21.03"	"20.65"	"79.72"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0009248"	"0.005029"	"1.51"	"15.72"
"67691"	"False"	"High"	"[K].VKSMEGFQDLLNMRPDQSNVR.[R]"	"1xBiotin [K2]; 1xOxidation [M13]"	"0.0679548"	"0.00333299"	"1"	"2"	"1"	"Q924N4"	"Q924N4 [1062-1082]"	"Q924N4 1xBiotin [K1063]"	"1"	"2706.27965"	"0.854"	"1.555"	"0.949662611758987"	"0.978808017637416"	"74.43"	"96.55"	"111.5"	"87.3"	"101.2"	"52.96"	"23.02"	"80.97"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0009248"	"0.004883"	"1.84"	"52.11"
"2888"	"False"	"High"	"[K].AMTTGAIAAMLSTILYSR.[R]"	"1xOxidation [M2]"	"0.0683604"	"0.00333299"	"1"	"1"	"1"	"O09061"	"O09061 [109-126]"	""	"0"	"1886.97143"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.004936"	"2.72"	""
"28985"	"False"	"High"	"[K].KPPAAPQQPQPPAPHPPQHPQNQAHR.[G]"	"1xBiotin [K1]"	"0.0712648"	"0.00333299"	"1"	"1"	"4"	"Q8BMK4"	"Q8BMK4 [35-60]"	"Q8BMK4 1xBiotin [K35]"	"0"	"3077.53873"	"0.343"	"0.645"	"0.925138005747468"	"0.906515362333117"	"98.06"	"115.47"	"170.4"	"61.8"	"67.8"	"77.31"	"33.03"	"83.00"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.0009916"	"0.005207"	"2.75"	"26.78"
"46932"	"False"	"High"	"[-G].MQIFVK.[T]"	""	"0.0729765"	"0.00333299"	"1"	"4"	"12"	"P62984"	"P62984 [1-6]"	""	"0"	"765.43276"	"31.378"	"2.645"	"0.925138005747468"	"0.906515362333117"	"72.95"	"59.65"	"8.2"	"267.5"	"24.3"	"47.63"	"55.25"	"28.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009916"	"0.005368"	"1.52"	"34.31"
"38666"	"False"	"High"	"[R].LTKGNSPSVLER.[L]"	"1xBiotin [K3]"	"0.0671504"	"0.00333299"	"1"	"1"	"3"	"Q8VDU0"	"Q8VDU0 [573-584]"	"Q8VDU0 1xBiotin [K575]"	"1"	"1526.79954"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0009248"	"0.004835"	"2.28"	""
"45518"	"False"	"High"	"[K].MLTFLMLVR.[L]"	"1xOxidation [M]"	"0.0700061"	"0.00333299"	"1"	"1"	"4"	"Q6ZQ38"	"Q6ZQ38 [1121-1129]"	""	"0"	"1139.63153"	"36.235"	"2.053"	"0.925138005747468"	"0.99222742129649"	"141.66"	"63.99"	"4.7"	"285.4"	"9.9"	"57.20"	"80.44"	"52.79"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0009248"	"0.005094"	"1.79"	"58.77"
"39546"	"False"	"High"	"[K].LWSSLTLFGAYK.[S]"	""	"0.0700061"	"0.00333299"	"1"	"1"	"5"	"Q9CQH8"	"Q9CQH8 [83-94]"	""	"0"	"1385.74636"	"35.636"	"0.910"	"0.925138005747468"	""	"35.95"	"49.24"	"7.8"	"285.3"	"6.9"	"34.89"	"51.42"	"32.00"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.00508"	"2.14"	"58.63"
"66337"	"False"	"High"	"[R].TYNIFAIMFR.[Y]"	""	"0.0712648"	"0.00333299"	"1"	"2"	"2"	"Q6WKZ8-1"	"Q6WKZ8-1 [191-200]"	""	"0"	"1275.65544"	"1.844"	"0.943"	"0.925138005747468"	"0.906515362333117"	"79.53"	"61.94"	"80.3"	"148.1"	"71.7"	"40.75"	"132.78"	"54.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.000961"	"0.005182"	"1.52"	"64.85"
"71512"	"False"	"High"	"[K].YGNANAWR.[Y]"	""	"0.072545"	"0.00333299"	"1"	"1"	"2"	"Q9CQR6"	"Q9CQR6 [133-140]"	""	"0"	"951.44314"	"109.006"	"3.480"	"0.545092645246401"	"0.906515362333117"	"71.92"	"60.46"	"2.3"	"289.4"	"8.3"	"69.68"	"35.44"	"29.63"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0009916"	"0.005314"	"1.51"	"24.22"
"38659"	"False"	"High"	"[K].LTKAEK.[LK]"	"1xBiotin [K3]"	"0.0683604"	"0.00333299"	"1"	"2"	"6"	"O35427"	"O35427 [78-83]"	"O35427 1xBiotin [K80]"	"1"	"915.49681"	"0.069"	"0.802"	"0.0032109022594614"	"0.906515362333117"	"53.62"	"64.18"	"145.9"	"10.4"	"143.8"	"57.97"	"36.00"	"43.06"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.004953"	"2.09"	"23.42"
"45951"	"False"	"High"	"[K].MMVAGFK.[K]"	"2xOxidation [M1; M2]"	"0.0691786"	"0.00333299"	"1"	"2"	"7"	"Q8VEK3"	"Q8VEK3 [513-519]"	""	"0"	"815.37901"	"634.173"	"3.396"	"0.563876479871168"	"0.906515362333117"	"62.01"	"71.36"	"0.5"	"297.8"	"1.7"	"40.09"	"49.49"	"59.48"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009248"	"0.005014"	"1.66"	"20.08"
"39411"	"False"	"High"	"[R].LVTLPVSFAQLKNLK.[W]"	"1xBiotin [K12]"	"0.0691786"	"0.00333299"	"1"	"1"	"1"	"Q922Q8"	"Q922Q8 [97-111]"	"Q922Q8 1xBiotin [K108]"	"1"	"1897.09795"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.005025"	"2.44"	""
"17939"	"False"	"High"	"[K].FLPGMAVGFSSSK.[L]"	""	"0.066355"	"0.00333299"	"1"	"1"	"1"	"Q64674"	"Q64674 [136-148]"	""	"0"	"1327.67148"	"8.170"	"1.318"	"0.998769547666767"	"0.906515362333117"	"160.68"	"56.92"	"34.6"	"221.0"	"44.4"	"34.22"	"101.28"	"49.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.000899"	"0.00475"	"1.99"	"46.09"
"43280"	"False"	"High"	"[K].MFLGDNAHLSIINEYLSQSYQK.[F]"	"1xOxidation [M1]"	"0.0734105"	"0.00333299"	"1"	"1"	"3"	"Q9JKF1"	"Q9JKF1 [1240-1261]"	""	"0"	"2587.24971"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.0009916"	"0.005371"	"2.77"	""
"27641"	"False"	"High"	"[K].KLEAAATALATK.[S]"	"1xBiotin [K1]"	"0.0679548"	"0.00333299"	"1"	"1"	"1"	"Q9D8E6"	"Q9D8E6 [353-364]"	"Q9D8E6 1xBiotin [K353]"	"1"	"1413.77701"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.004913"	"1.91"	""
"28248"	"False"	"High"	"[K].KLVYLYLMNYAK.[S]"	"1xOxidation [M8]"	"0.0687684"	"0.00333299"	"1"	"3"	"3"	"O35643"	"O35643 [67-78]"	""	"1"	"1534.83380"	"173.468"	"2.643"	"0.430383505746853"	"0.906515362333117"	"71.41"	"30.46"	"1.6"	"294.0"	"4.4"	"42.93"	"57.25"	"36.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0009248"	"0.004963"	"2.80"	"44.88"
"39676"	"False"	"High"	"[K].LYMYQLFR.[S]"	""	"0.0738469"	"0.00333299"	"1"	"1"	"2"	"Q9WV60"	"Q9WV60 [160-167]"	""	"0"	"1133.58121"	"1.150"	"0.762"	"0.497492915698976"	"0.906515362333117"	"183.85"	"63.39"	"111.6"	"111.6"	"76.9"	"46.44"	"120.36"	"42.46"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009916"	"0.005425"	"1.46"	"52.85"
"3161"	"False"	"High"	"[R].APHWWR.[T]"	""	"0.0734105"	"0.00333299"	"1"	"2"	"11"	"Q8K2M0"	"Q8K2M0 [67-72]"	""	"0"	"852.42637"	"156.867"	"3.878"	"0.925138005747468"	"0.906515362333117"	"55.05"	"41.49"	"2.0"	"290.4"	"7.6"	"38.48"	"39.73"	"27.89"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009916"	"0.005408"	"1.58"	"31.01"
"44287"	"False"	"High"	"[R].MKALDAIR.[A]"	"1xBiotin [K2]"	"0.0729765"	"0.00333299"	"1"	"3"	"1"	"Q8R092"	"Q8R092 [104-111]"	"Q8R092 1xBiotin [K105]"	"1"	"1143.60130"	"0.498"	"1.187"	"0.925138005747468"	"0.906515362333117"	"72.59"	"68.97"	"122.8"	"70.2"	"107.0"	"52.79"	"44.58"	"56.17"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009916"	"0.005331"	"1.97"	"42.38"
"39665"	"False"	"High"	"[R].LYIWSGR.[D]"	""	"0.0679548"	"0.00333299"	"1"	"1"	"10"	"Q61191"	"Q61191 [334-340]"	""	"0"	"894.48321"	"130.042"	"2.734"	"0.925138005747468"	"0.906515362333117"	"91.75"	"97.39"	"2.2"	"292.2"	"5.6"	"88.14"	"44.93"	"69.75"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0009248"	"0.004908"	"1.48"	"40.45"
"24583"	"False"	"High"	"[R].HLNDDDVTGSVKSER.[R]"	"1xBiotin [K12]"	"0.0687684"	"0.00333299"	"1"	"1"	"1"	"O70480"	"O70480 [8-22]"	"O70480 1xBiotin [K19]"	"1"	"1897.87086"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0009248"	"0.004954"	"2.76"	""
"18096"	"False"	"High"	"[R].FLYLVSTFDWK.[N]"	""	"0.072545"	"0.00333299"	"1"	"2"	"2"	"Q8R5K4"	"Q8R5K4 [909-919]"	""	"0"	"1418.73546"	"4.077"	"0.902"	"0.929320212853233"	""	"139.33"	"44.99"	"49.8"	"205.6"	"44.7"	"35.03"	"158.53"	"39.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009916"	"0.005328"	"1.97"	"61.24"
"72396"	"False"	"High"	"[K].YSKVSK.[E]"	"1xBiotin [K3]"	"0.072545"	"0.00333299"	"1"	"1"	"5"	"Q07113"	"Q07113 [2343-2348]"	"Q07113 1xBiotin [K2345]"	"1"	"937.48116"	"0.492"	"0.760"	"0.929320212853233"	"0.906515362333117"	"99.12"	"104.61"	"134.6"	"62.9"	"102.5"	"72.03"	"42.96"	"77.35"	""	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.0009916"	"0.005321"	"1.68"	"25.30"
"48731"	"False"	"High"	"[-].MVAKQR.[I]"	"1xBiotin [K4]; 1xMet-loss [N-Term]"	"0.0716892"	"0.00333299"	"1"	"3"	"9"	"Q9Z1W5"	"Q9Z1W5 [1-6]"	"Q9Z1W5 1xBiotin [K4]; 1xMet-loss [N-Term]"	"1"	"827.45562"	"0.049"	"0.929"	"0.000163533636151888"	"0.906515362333117"	"61.20"	"38.65"	"157.0"	"9.9"	"133.1"	"33.60"	"48.62"	"33.61"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0009916"	"0.005217"	"1.83"	"18.69"
"58033"	"False"	"High"	"[K].RSSSLNSKPSSLR.[R]"	"1xBiotin [K8]"	"0.0738469"	"0.00333299"	"1"	"1"	"1"	"Q60664"	"Q60664 [344-356]"	"Q60664 1xBiotin [K351]"	"1"	"1644.84861"	"0.228"	"0.902"	"0.925138005747468"	"0.906515362333117"	"47.30"	"25.72"	"139.4"	"32.9"	"127.6"	"13.79"	"40.42"	"21.61"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009916"	"0.005428"	"2.50"	"31.13"
"23893"	"False"	"High"	"[K].GYSTWLK.[L]"	""	"0.0704233"	"0.00333299"	"1"	"1"	"10"	"P26043"	"P26043 [54-60]"	""	"0"	"854.44068"	"198.314"	"5.712"	"0.925138005747468"	"0.906515362333117"	"70.02"	"64.33"	"1.5"	"290.0"	"8.5"	"62.96"	"39.33"	"26.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.0009248"	"0.005136"	"1.64"	"36.76"
"69955"	"False"	"High"	"[R].VWWMFR.[VA]"	"1xOxidation [M4]"	"0.0675514"	"0.00333299"	"1"	"2"	"19"	"P52196"	"P52196 [112-117]"	""	"0"	"940.44981"	"79.727"	"1.192"	"0.987144754730324"	"0.907108336447894"	"51.83"	"53.48"	"3.7"	"291.8"	"4.5"	"41.90"	"26.73"	"41.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.004872"	"1.76"	"50.70"
"70000"	"False"	"High"	"[K].VYLLYRPGHYDILYK.[-]"	""	"0.0712648"	"0.00333299"	"1"	"1"	"1"	"Q7TQI3"	"Q7TQI3 [257-271]"	""	"0"	"1913.03198"	"121.075"	"2.819"	"0.430170192740307"	"0.909223670800027"	"65.26"	"30.36"	"3.0"	"289.0"	"7.9"	"24.03"	"85.25"	"22.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.000961"	"0.005182"	"2.78"	"46.07"
"4324"	"False"	"High"	"[K].AVCVLKGDGPVQGTIHFEQK.[A]"	"1xBiotin [K6]; 1xCarbamidomethyl [C3]"	"0.0691786"	"0.00333299"	"1"	"1"	"1"	"P08228"	"P08228 [5-24]"	"P08228 1xBiotin [K10]"	"1"	"2409.20535"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.005"	"2.15"	""
"58412"	"False"	"High"	"[R].RYIGIVK.[Q]"	""	"0.0691786"	"0.00333299"	"1"	"2"	"5"	"Q9Z2X1-1"	"Q9Z2X1-1 [218-224]"	""	"1"	"848.53525"	"148.631"	"3.974"	"0.925138005747468"	"0.906515362333117"	"69.97"	"74.95"	"1.6"	"291.5"	"6.9"	"62.10"	"29.97"	"25.48"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.0009248"	"0.00499"	"1.91"	"23.52"
"23681"	"False"	"High"	"[K].GVTIPYRPKPSSSPVIFAGGQDR.[Y]"	"1xBiotin [K9]"	"0.0667515"	"0.00333299"	"1"	"2"	"1"	"Q61990"	"Q61990 [173-195]"	"Q61990 1xBiotin [K181]"	"0"	"2655.37117"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.004781"	"2.42"	""
"33313"	"False"	"High"	"[K].LHFIFR.[H]"	""	"0.0683604"	"0.00333299"	"1"	"1"	"30"	"P35564"	"P35564 [201-206]"	""	"0"	"832.48282"	"125.583"	"2.888"	"0.925138005747468"	"0.906515362333117"	"40.78"	"42.03"	"2.3"	"291.0"	"6.7"	"37.02"	"28.72"	"17.37"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.004934"	"1.98"	"39.54"
"9838"	"False"	"High"	"[K].DVAKQLK.[E]"	"1xBiotin [K4]"	"0.0738469"	"0.00333299"	"1"	"2"	"6"	"P61620"	"P61620 [389-395]"	"P61620 1xBiotin [K392]"	"1"	"1027.56048"	"0.215"	"1.990"	"0.00614248831406252"	"0.916215054610739"	"142.34"	"132.90"	"101.2"	"27.7"	"171.1"	"102.93"	"30.34"	"62.07"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0009916"	"0.00543"	"2.27"	"31.49"
"33261"	"False"	"High"	"[R].LGYIHR.[N]"	""	"0.0691786"	"0.00333299"	"1"	"3"	"7"	"O70133"	"O70133 [902-907]"	""	"0"	"758.43078"	"179.777"	"4.751"	"0.925138005747468"	"0.906515362333117"	"66.45"	"56.84"	"1.9"	"290.6"	"7.5"	"63.79"	"39.92"	"30.14"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0009248"	"0.005016"	"1.66"	"19.62"
"11415"	"False"	"High"	"[K].EEDSSFEGGGALLNK.[L]"	""	"0.066355"	"0.00333299"	"1"	"1"	"1"	"Q91ZB0"	"Q91ZB0 [607-621]"	""	"0"	"1552.71256"	"27.796"	"0.605"	"0.925138005747468"	"0.906515362333117"	"62.05"	"73.26"	"9.3"	"285.0"	"5.6"	"60.89"	"34.41"	"56.00"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009248"	"0.004774"	"1.99"	"37.66"
"33097"	"False"	"High"	"[R].LGPIPFFSLLQYD.[-]"	""	"0.0691786"	"0.00333299"	"1"	"1"	"2"	"P08030"	"P08030 [168-180]"	""	"0"	"1509.79879"	"0.898"	"1.530"	""	"0.92308690840413"	"64.80"	"65.94"	"104.6"	"75.4"	"120.0"	"33.91"	"55.35"	"65.66"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"0.0009248"	"0.005017"	"2.66"	"68.76"
"60059"	"False"	"High"	"[K].SKGIAYIEFK.[S]"	"1xBiotin [K2]"	"0.0712648"	"0.00333299"	"1"	"1"	"1"	"P09405"	"P09405 [430-439]"	"P09405 1xBiotin [K431]"	"1"	"1381.71843"	"0.991"	"0.868"	""	"0.906515362333117"	"61.21"	"128.11"	"102.9"	"119.2"	"77.9"	"48.03"	"38.99"	"130.21"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.000961"	"0.005184"	"2.36"	"49.53"
"63263"	"False"	"High"	"[K].TALRPLKPSENKEDDGQEIA.[-]"	"1xBiotin [K7]"	"0.0704233"	"0.00333299"	"1"	"1"	"4"	"Q8VE98"	"Q8VE98 [297-316]"	"Q8VE98 1xBiotin [K303]"	"1"	"2437.20276"	"0.436"	"1.106"	"0.925138005747468"	"0.91398852688127"	"61.40"	"52.73"	"137.5"	"57.4"	"105.1"	"47.99"	"48.31"	"29.47"	""	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0009248"	"0.005105"	"2.86"	"38.30"
"63144"	"False"	"High"	"[R].SYYFPVK.[N]"	""	"0.0691786"	"0.00333299"	"1"	"2"	"8"	"Q921M3-1"	"Q921M3-1 [1165-1171]"	""	"0"	"903.46108"	"158.358"	"4.598"	"0.695663262369178"	"0.906515362333117"	"41.64"	"60.84"	"2.0"	"289.4"	"8.7"	"27.14"	"27.76"	"46.50"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0009248"	"0.005008"	"1.45"	"37.62"
"1408"	"False"	"High"	"[R].AGIKNR.[V]"	"1xBiotin [K4]"	"0.0687684"	"0.00333299"	"1"	"3"	"23"	"Q3TBT3"	"Q3TBT3 [232-237]"	"Q3TBT3 1xBiotin [K235]"	"1"	"884.47708"	"0.003"	"0.746"	"4.02494379603269E-07"	"0.906515362333117"	"40.28"	"25.49"	"173.8"	"0.5"	"125.7"	"20.25"	"36.59"	"23.90"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.004981"	"2.09"	"24.74"
"70275"	"False"	"High"	"[R].WFVMGPPR.[S]"	""	"0.0695912"	"0.00333299"	"1"	"2"	"3"	"Q9ERI5-1"	"Q9ERI5-1 [174-181]"	""	"0"	"989.50257"	"1.077"	"3.211"	"0.9822920625481"	"0.906515362333117"	"84.87"	"59.67"	"53.0"	"57.1"	"189.9"	"34.73"	"172.15"	"44.71"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.0009248"	"0.005045"	"1.38"	"45.70"
"8400"	"False"	"High"	"[R].DLPGKQVQLLR.[L]"	"1xBiotin [K5]"	"0.0695912"	"0.00333299"	"1"	"2"	"3"	"Q4FZC9-1"	"Q4FZC9-1 [579-589]"	"Q4FZC9-1 1xBiotin [K583]"	"1"	"1492.83044"	"0.917"	"0.811"	"0.949662611758987"	"0.906515362333117"	"68.83"	"81.01"	"113.5"	"98.4"	"88.1"	"39.17"	"50.21"	"63.60"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.0009248"	"0.005049"	"2.12"	"48.45"
"60870"	"False"	"High"	"[K].SIVFHR.[K]"	""	"0.072545"	"0.00333299"	"1"	"1"	"10"	"P62827"	"P62827 [135-140]"	""	"0"	"758.43078"	"150.167"	"2.252"	"0.925138005747468"	"0.935866453494337"	"83.37"	"78.83"	"1.5"	"294.8"	"3.7"	"70.03"	"52.35"	"29.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.0009916"	"0.005314"	"1.56"	"21.97"
"32857"	"False"	"High"	"[R].IGFVGFPSVGK.[S]"	""	"0.0700061"	"0.00333299"	"1"	"1"	"1"	"P32233"	"P32233 [67-77]"	""	"0"	"1107.61971"	"89.788"	"1.951"	"0.486690115660178"	"0.998581608660643"	"64.42"	"94.00"	"3.3"	"290.5"	"6.1"	"59.72"	"31.04"	"89.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.0009248"	"0.005087"	"2.45"	"48.64"
"32380"	"False"	"High"	"[R].LFAFVR.[F]"	""	"0.0742857"	"0.00333299"	"1"	"1"	"21"	"Q9CQI6"	"Q9CQI6 [58-63]"	""	"0"	"752.44537"	"221.314"	"5.476"	"0.925138005747468"	"0.906515362333117"	"64.80"	"53.90"	"1.3"	"290.9"	"7.8"	"52.63"	"54.71"	"32.36"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.001028"	"0.005453"	"1.57"	"43.22"
"61608"	"False"	"High"	"[K].SPTTTQSPKSSFLASLNPK.[T]"	"1xBiotin [K9]"	"0.0704233"	"0.00333299"	"1"	"1"	"2"	"G5E870"	"G5E870 [1063-1081]"	"G5E870 1xBiotin [K1071]"	"1"	"2217.12199"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0009248"	"0.005124"	"3.06"	""
"63019"	"False"	"High"	"[K].SWLKPR.[L]"	""	"0.0700061"	"0.00333299"	"1"	"1"	"14"	"Q91V92"	"Q91V92 [83-88]"	""	"0"	"786.46208"	"108.354"	"3.340"	"0.929320212853233"	"0.906515362333117"	"47.94"	"52.85"	"2.6"	"288.2"	"9.2"	"54.69"	"37.43"	"29.32"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.005084"	"1.75"	"23.21"
"32662"	"False"	"High"	"[R].LFTNLKDTSSK.[V]"	"1xBiotin [K6]"	"0.0721159"	"0.00333299"	"1"	"2"	"2"	"Q99KY4-1"	"Q99KY4-1 [383-393]"	"Q99KY4-1 1xBiotin [K388]"	"1"	"1479.75119"	"0.046"	"0.848"	"0.00023066931639311"	"0.906515362333117"	"33.72"	"25.58"	"157.2"	"7.7"	"135.1"	"15.05"	"45.44"	"21.75"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0009916"	"0.005267"	"2.53"	"43.09"
"31620"	"False"	"High"	"[R].LDIDSAPITAR.[N]"	""	"0.0734105"	"0.00333299"	"1"	"2"	"1"	"P52480"	"P52480 [33-43]"	""	"0"	"1171.63173"	"1.357"	"1.038"	"0.961201741850067"	""	"32.08"	"38.20"	"85.3"	"124.3"	"90.4"	"23.82"	"231.17"	"39.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009916"	"0.005398"	"2.13"	"36.33"
"31101"	"False"	"High"	"[R].LAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGR.[S]"	"2xCarbamidomethyl [C23; C24]"	"0.0683604"	"0.00333299"	"1"	"1"	"2"	"P52480"	"P52480 [401-436]"	""	"2"	"3647.87714"	"0.651"	"0.959"	"0.936509618400951"	"0.906515362333117"	"65.50"	"61.23"	"114.4"	"73.6"	"112.0"	"24.55"	"232.66"	"86.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.004939"	"3.03"	"61.47"
"167"	"False"	"High"	"[R].AAKMPR.[S]"	"1xBiotin [K3]"	"0.0675514"	"0.00333299"	"1"	"1"	"26"	"Q3UBX0"	"Q3UBX0 [233-238]"	"Q3UBX0 1xBiotin [K235]"	"1"	"899.45899"	"0.015"	"0.886"	"1.6742954059348E-05"	"0.906515362333117"	"66.67"	"37.78"	"158.2"	"2.8"	"139.0"	"37.32"	"51.65"	"10.97"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009248"	"0.004854"	"2.03"	"26.07"
"51727"	"False"	"High"	"[R].NTGGKGGDYALAPGSQSSEMSLR.[D]"	"1xBiotin [K5]; 1xOxidation [M20]"	"0.0721159"	"0.00333299"	"1"	"3"	"5"	"P01896"	"P01896 [146-168]"	"P01896 1xBiotin [K150]"	"1"	"2525.13951"	"0.392"	"1.060"	"0.928611703535518"	"0.931412981987664"	"97.66"	"96.65"	"128.3"	"73.1"	"98.6"	"74.29"	"43.48"	"59.34"	""	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"0.0009916"	"0.005271"	"3.37"	"38.93"
"36794"	"False"	"High"	"[R].LPLQDVYKIGGIGTVPVGR.[V]"	"1xBiotin [K8]"	"0.066355"	"0.00333299"	"1"	"2"	"1"	"P10126"	"P10126 [248-266]"	"P10126 1xBiotin [K255]"	"1"	"2208.22092"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000899"	"0.004759"	"2.49"	""
"25455"	"False"	"High"	"[K].KAASGEAKPQAK.[K]"	"1xBiotin [K1]"	"0.0700061"	"0.00333299"	"1"	"1"	"3"	"P15864"	"P15864 [110-121]"	"P15864 1xBiotin [K110]"	"1"	"1411.73621"	"0.664"	"1.354"	"0.925138005747468"	"0.916215054610739"	"41.52"	"81.88"	"115.5"	"73.4"	"111.1"	"38.39"	"34.48"	"64.43"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009248"	"0.005066"	"3.08"	"16.40"
"36701"	"False"	"High"	"[R].IPGTFKGER.[L]"	"1xBiotin [K6]"	"0.0738469"	"0.00333299"	"1"	"1"	"8"	"Q5SW45"	"Q5SW45 [467-475]"	"Q5SW45 1xBiotin [K472]"	"1"	"1230.62995"	"0.105"	"0.566"	"0.0650652161900591"	"0.906515362333117"	"59.46"	"37.75"	"181.1"	"18.3"	"100.5"	"32.34"	"48.30"	"24.05"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001028"	"0.005436"	"1.74"	"36.83"
"65858"	"False"	"High"	"[R].TTAENEFVMLK.[K]"	"1xOxidation [M9]"	"0.0708429"	"0.00333299"	"1"	"1"	"2"	"Q922U2"	"Q922U2 [260-270]"	""	"0"	"1298.62968"	"0.859"	"0.734"	"0.999765140504802"	"0.906515362333117"	"74.42"	"58.30"	"123.7"	"100.5"	"75.8"	"26.93"	"229.07"	"42.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.000961"	"0.005139"	"1.61"	"37.28"
"2116"	"False"	"High"	"[K].AIFAGYK.[R]"	""	"0.0721159"	"0.00333299"	"1"	"1"	"9"	"O55142"	"O55142 [9-15]"	""	"0"	"769.42430"	"108.402"	"2.516"	"0.929320212853233"	"0.906515362333117"	"62.60"	"54.35"	"3.0"	"290.5"	"6.5"	"42.12"	"44.20"	"36.27"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.0009916"	"0.005276"	"1.81"	"31.33"
"21536"	"False"	"High"	"[R].GLINVKGK.[G]"	"1xBiotin [K6]"	"0.072545"	"0.00333299"	"1"	"2"	"5"	"P51829"	"P51829 [1071-1078]"	"P51829 1xBiotin [K1076]"	"1"	"1054.60776"	"0.161"	"0.749"	"0.925138005747468"	"0.906515362333117"	"68.29"	"81.53"	"156.1"	"24.1"	"119.8"	"57.10"	"33.74"	"64.42"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0009916"	"0.005316"	"2.15"	"39.29"
"30227"	"False"	"High"	"[R].KVGLIAAR.[R]"	""	"0.072545"	"0.00333299"	"1"	"1"	"14"	"P62918"	"P62918 [234-241]"	""	"1"	"827.54615"	"109.708"	"3.176"	"0.959544012046536"	"0.906515362333117"	"64.85"	"70.61"	"1.8"	"290.5"	"7.8"	"59.40"	"39.40"	"42.90"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.0009916"	"0.005323"	"2.27"	"20.89"
"57188"	"False"	"High"	"[K].RLWGDIYFNPK.[T]"	""	"0.066355"	"0.00333299"	"1"	"1"	"3"	"O08810"	"O08810 [341-351]"	""	"1"	"1408.73720"	"152.944"	"2.492"	"0.320753525454886"	"0.922415312206355"	"74.78"	"89.29"	"1.8"	"293.1"	"5.1"	"40.70"	"57.16"	"70.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.000899"	"0.004744"	"1.93"	"46.07"
"13827"	"False"	"High"	"[K].ELPGKTLDFHFDISETPIIGR.[R]"	"1xBiotin [K5]"	"0.0700061"	"0.00333299"	"1"	"2"	"1"	"E9Q8I9"	"E9Q8I9 [2330-2350]"	"E9Q8I9 1xBiotin [K2334]"	"1"	"2611.32248"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0009248"	"0.005073"	"2.60"	""
"21339"	"False"	"High"	"[K].GLDKSSK.[S]"	"1xBiotin [K4]"	"0.0695912"	"0.00333299"	"1"	"1"	"9"	"Q9DBG7"	"Q9DBG7 [223-229]"	"Q9DBG7 1xBiotin [K226]"	"1"	"960.48189"	"0.135"	"0.776"	"0.925138005747468"	"0.906515362333117"	"43.76"	"33.01"	"153.1"	"22.3"	"124.6"	"31.56"	"40.54"	"17.02"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.0009248"	"0.005034"	"1.66"	"25.50"
"3890"	"False"	"High"	"[K].ASINMLR.[I]"	"1xOxidation [M5]"	"0.0695912"	"0.00333299"	"1"	"1"	"3"	"P14148"	"P14148 [150-156]"	""	"0"	"820.43455"	"473.897"	"5.674"	"0.911117679842347"	"0.906515362333117"	"58.48"	"67.61"	"0.6"	"296.4"	"3.0"	"53.40"	"29.69"	"50.72"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.0009248"	"0.005063"	"1.81"	"22.21"
"71851"	"False"	"High"	"[K].YIMIFR.[N]"	""	"0.0742857"	"0.00333299"	"1"	"1"	"8"	"Q9ERK4"	"Q9ERK4 [487-492]"	""	"0"	"842.45931"	"39.740"	"3.646"	"0.925138005747468"	"0.906515362333117"	"147.34"	"41.36"	"6.6"	"268.2"	"25.2"	"23.61"	"102.71"	"39.17"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001028"	"0.00548"	"1.69"	"45.36"
"53707"	"False"	"High"	"[K].QLATKAAR.[K]"	"1xBiotin [K5]"	"0.0683604"	"0.00333299"	"1"	"3"	"1"	"P84244"	"P84244 [20-27]"	"P84244 1xBiotin [K24]"	"1"	"1084.59317"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.0009248"	"0.00493"	"2.28"	""
"30581"	"False"	"High"	"[K].KYGVGTCGPR.[G]"	"1xBiotin [K1]; 1xCarbamidomethyl [C7]"	"0.0716892"	"0.00333299"	"1"	"1"	"1"	"O35704"	"O35704 [127-136]"	"O35704 1xBiotin [K127]"	"1"	"1320.61874"	"0.974"	"0.623"	"0.13756602572606"	"0.906515362333117"	"141.89"	"59.63"	"115.7"	"114.4"	"69.9"	"97.87"	"228.15"	"130.52"	""	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0009916"	"0.005246"	"1.78"	"32.47"
"30615"	"False"	"High"	"[R].KYNWSAK.[A]"	""	"0.0679548"	"0.00333299"	"1"	"1"	"8"	"Q9D823"	"Q9D823 [46-52]"	""	"1"	"896.46248"	"270.180"	"6.571"	"0.925138005747468"	"0.906515362333117"	"76.03"	"95.13"	"1.0"	"290.9"	"8.1"	"71.90"	"40.59"	"64.46"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.0009248"	"0.004907"	"1.75"	"18.41"
"1835"	"False"	"High"	"[K].AKMQASIEK.[G]"	"1xBiotin [K2]"	"0.0691786"	"0.00333299"	"1"	"1"	"1"	"Q61937"	"Q61937 [247-255]"	"Q61937 1xBiotin [K248]"	"1"	"1231.61734"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.0009248"	"0.005014"	"1.91"	""
"70905"	"False"	"High"	"[K].WYQQWK.[D]"	""	"0.0729765"	"0.00333299"	"1"	"1"	"12"	"O35857"	"O35857 [241-246]"	""	"0"	"938.45191"	"122.391"	"3.309"	"0.925138005747468"	"0.906515362333117"	"67.43"	"51.12"	"2.8"	"287.8"	"9.4"	"43.89"	"85.42"	"32.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.0009916"	"0.005335"	"1.95"	"34.16"
"70899"	"False"	"High"	"[R].WYLTLAR.[C]"	""	"0.0716892"	"0.00333299"	"1"	"1"	"1"	"Q9CRA4"	"Q9CRA4 [135-141]"	""	"0"	"922.51451"	"96.817"	"2.890"	"0.952905080717326"	"0.906515362333117"	"58.86"	"35.98"	"3.1"	"288.3"	"8.6"	"29.59"	"50.92"	"23.12"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.0009916"	"0.005222"	"1.67"	"46.74"
"30647"	"False"	"High"	"[K].KYVIVPSLQLTPK.[E]"	"1xBiotin [K1]"	"0.0716892"	"0.00333299"	"1"	"4"	"3"	"Q7TNJ0-1"	"Q7TNJ0-1 [276-288]"	"Q7TNJ0-1 1xBiotin [K276]"	"1"	"1711.98153"	"1.641"	"0.880"	"0.987000067345905"	"0.906515362333117"	"57.85"	"65.83"	"85.7"	"140.7"	"73.6"	"50.58"	"15.57"	"37.69"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.0009916"	"0.00522"	"2.65"	"54.49"
"56515"	"False"	"High"	"[K].RGILTLK.[Y]"	""	"0.0704233"	"0.00333299"	"1"	"7"	"12"	"P60710"	"P60710 [62-68]"	""	"1"	"800.53525"	"117.933"	"3.659"	"0.925138005747468"	"0.906515362333117"	"60.01"	"68.78"	"2.5"	"287.4"	"10.1"	"66.27"	"49.84"	"30.53"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.0009248"	"0.005112"	"2.41"	"28.15"
"59470"	"False"	"High"	"[R].SFPHLR.[R]"	""	"0.0751708"	"0.0036583"	"1"	"1"	"4"	"P10107"	"P10107 [229-234]"	""	"0"	"756.41513"	"165.538"	"3.596"	"0.817970099645018"	"0.906515362333117"	"32.54"	"26.33"	"2.0"	"291.6"	"6.5"	"17.19"	"40.85"	"17.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001098"	"0.005559"	"1.50"	"25.67"
"49957"	"False"	"High"	"[K].NFWNGR.[W]"	""	"0.074727"	"0.0036583"	"1"	"2"	"10"	"P47753"	"P47753 [167-172]"	""	"0"	"793.37400"	"124.871"	"3.315"	"0.925138005747468"	"0.906515362333117"	"72.78"	"69.34"	"2.0"	"290.2"	"7.8"	"67.27"	"34.21"	"32.00"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.001028"	"0.005495"	"1.47"	"33.00"
"62520"	"False"	"High"	"[K].STAWPYFLPMLNR.[Q]"	"1xOxidation [M10]"	"0.074727"	"0.0036583"	"1"	"1"	"1"	"Q8BVE3"	"Q8BVE3 [120-132]"	""	"0"	"1611.79881"	"56.569"	"0.990"	"0.925138005747468"	"0.906515362333117"	"53.64"	"51.51"	"5.5"	"289.1"	"5.4"	"38.68"	"34.37"	"32.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001065"	"0.005509"	"2.63"	"58.90"
"4095"	"False"	"High"	"[R].ASYSLFR.[A]"	""	"0.074727"	"0.0036583"	"1"	"1"	"1"	"O70503-1"	"O70503-1 [26-32]"	""	"0"	"843.43593"	"112.030"	"2.090"	"0.423976448584242"	"0.983025330649738"	"64.84"	"52.39"	"2.4"	"292.2"	"5.4"	"46.24"	"62.62"	"36.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.001065"	"0.00551"	"1.54"	"36.99"
"23457"	"False"	"High"	"[K].GTYFPTWEGLFWEK.[A]"	""	"0.075617"	"0.0036583"	"1"	"1"	"2"	"Q99PV0"	"Q99PV0 [1492-1505]"	""	"0"	"1760.83188"	"9.565"	"1.410"	"0.982626859977453"	"0.916215054610739"	"156.46"	"72.35"	"28.4"	"232.7"	"38.9"	"55.39"	"104.86"	"34.74"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001098"	"0.005609"	"2.24"	"63.49"
"53922"	"False"	"High"	"[K].QLICDLEDDSDK.[S]"	"1xCarbamidomethyl [C4]"	"0.0751708"	"0.0036583"	"1"	"3"	"2"	"A2AWL7"	"A2AWL7 [1285-1296]"	""	"0"	"1450.63662"	"46.583"	"0.762"	"0.925138005747468"	"0.906515362333117"	"50.88"	"52.73"	"7.0"	"288.0"	"5.0"	"27.56"	"43.22"	"45.89"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001098"	"0.005535"	"2.19"	"37.23"
"68722"	"False"	"High"	"[K].VPHWYHFSCFWK.[V]"	"1xCarbamidomethyl [C9]"	"0.0751708"	"0.0036583"	"1"	"1"	"2"	"P11103"	"P11103 [48-59]"	""	"0"	"1693.77326"	"8.109"	"1.321"	"0.988282201872393"	"0.906515362333117"	"199.18"	"115.86"	"34.6"	"220.2"	"45.2"	"42.82"	"109.77"	"80.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.001098"	"0.005549"	"2.30"	"49.14"
"1431"	"False"	"High"	"[K].AGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGK.[A]"	"1xBiotin [K8]"	"0.0751708"	"0.0036583"	"1"	"3"	"1"	"Q8K2K6-1"	"Q8K2K6-1 [319-354]"	"Q8K2K6-1 1xBiotin [K326]"	"1"	"3727.76568"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001098"	"0.005542"	"3.63"	""
"32449"	"False"	"High"	"[R].IFGINKY.[-]"	"1xBiotin [K6]"	"0.0769707"	"0.00396207"	"1"	"4"	"11"	"Q9CPZ6"	"Q9CPZ6 [147-153]"	"Q9CPZ6 1xBiotin [K152]"	"1"	"1080.55466"	"0.146"	"0.536"	"0.102089005491845"	"0.906515362333117"	"37.45"	"37.38"	"178.3"	"26.2"	"95.5"	"15.57"	"37.20"	"52.58"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.00113"	"0.005714"	"1.81"	"57.83"
"34624"	"False"	"High"	"[R].LIGWGQIR.[R]"	""	"0.077427"	"0.00396207"	"1"	"2"	"16"	"Q9Z0N1"	"Q9Z0N1 [453-460]"	""	"0"	"942.55196"	"153.919"	"4.440"	"0.925138005747468"	"0.906515362333117"	"64.90"	"65.38"	"2.0"	"287.8"	"10.2"	"49.27"	"44.58"	"28.34"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.00113"	"0.005744"	"2.42"	"43.07"
"37079"	"False"	"High"	"[R].LQAPKK.[F]"	"1xBiotin [K5]"	"0.0760657"	"0.00396207"	"1"	"1"	"4"	"Q8CB65-1"	"Q8CB65-1 [371-376]"	"Q8CB65-1 1xBiotin [K375]"	"1"	"910.51788"	"0.054"	"0.663"	"9.56190873519663E-05"	"0.906515362333117"	"56.18"	"46.81"	"170.4"	"9.2"	"120.3"	"36.37"	"39.71"	"32.85"	""	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00113"	"0.005653"	"2.02"	"25.06"
"28138"	"False"	"High"	"[K].KISLPGQMTGTPITPLK.[D]"	"1xBiotin [K1]"	"0.0760657"	"0.00396207"	"1"	"2"	"2"	"Q99JX3"	"Q99JX3 [212-228]"	"Q99JX3 1xBiotin [K212]"	"1"	"2008.09697"	"0.911"	"1.500"	"0.925138005747468"	"0.928398160526778"	"61.06"	"63.13"	"87.8"	"79.7"	"132.5"	"45.99"	"37.35"	"44.16"	""	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001098"	"0.00562"	"2.18"	"51.59"
"68132"	"False"	"High"	"[K].VLNWVR.[E]"	""	"0.0760657"	"0.00396207"	"1"	"1"	"3"	"P23116"	"P23116 [410-415]"	""	"0"	"786.46208"	"142.720"	"3.572"	"0.925138005747468"	"0.906515362333117"	"52.99"	"53.98"	"2.5"	"290.7"	"6.8"	"39.88"	"38.28"	"80.57"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.00113"	"0.005649"	"1.69"	"35.76"
"18424"	"False"	"High"	"[K].FPTLWSGAR.[S]"	""	"0.0760657"	"0.00396207"	"1"	"1"	"1"	"Q00PI9"	"Q00PI9 [272-280]"	""	"0"	"1034.54179"	"130.780"	"4.538"	"0.935194287285695"	"0.906515362333117"	"55.59"	"49.64"	"2.3"	"287.5"	"10.2"	"43.44"	"33.82"	"22.22"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001098"	"0.005621"	"2.23"	"45.84"
"32433"	"False"	"High"	"[R].LFFVGSR.[E]"	""	"0.077427"	"0.00396207"	"2"	"3"	"4"	"Q8BGK6-1; Q9Z127"	"Q8BGK6-1 [342-348]; Q9Z127 [354-360]"	""	"0"	"825.46175"	"170.722"	"3.606"	"0.925138005747468"	"0.906515362333117"	"54.69"	"48.84"	"1.8"	"292.3"	"5.9"	"30.55"	"43.78"	"38.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.00113"	"0.005776"	"1.81"	"41.36"
"418"	"False"	"High"	"[R].AAYIYIR.[G]"	""	"0.077427"	"0.00396207"	"1"	"1"	"6"	"Q91YT0"	"Q91YT0 [153-159]"	""	"0"	"869.48796"	"149.540"	"2.833"	"0.426200181511617"	"0.909223670800027"	"52.52"	"78.28"	"1.9"	"291.6"	"6.5"	"59.88"	"34.58"	"84.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.00113"	"0.005759"	"1.50"	"34.62"
"12357"	"False"	"High"	"[K].EGKPYLVLGLLWQVIK.[I]"	""	"0.0778858"	"0.00396207"	"1"	"1"	"1"	"Q61233"	"Q61233 [218-233]"	""	"0"	"1856.10442"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001166"	"0.005814"	"2.50"	""
"492"	"False"	"High"	"[R].ACYGVLR.[F]"	"1xCarbamidomethyl [C2]"	"0.0769707"	"0.00396207"	"1"	"1"	"4"	"P62908"	"P62908 [118-124]"	""	"0"	"838.42398"	"98.939"	"3.107"	"0.966090293805027"	"0.906515362333117"	"66.36"	"70.35"	"3.3"	"288.0"	"8.7"	"47.42"	"41.66"	"69.57"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.00113"	"0.005723"	"1.57"	"27.13"
"62119"	"False"	"High"	"[K].SSEPLDVGSRNPER.[T]"	""	"0.0760657"	"0.00396207"	"1"	"3"	"3"	"Q9D2G5-1"	"Q9D2G5-1 [1378-1391]"	""	"1"	"1542.75067"	"43.581"	"3.509"	"0.585581871548498"	"0.906515362333117"	"146.44"	"45.53"	"6.0"	"273.3"	"20.8"	"39.26"	"109.96"	"20.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.001098"	"0.005616"	"2.70"	"37.23"
"480"	"False"	"High"	"[K].ACSLKTMSTSDPAEVLIK.[N]"	"1xBiotin [K5]; 1xCarbamidomethyl [C2]"	"0.0778858"	"0.00396207"	"1"	"1"	"5"	"Q80WJ7"	"Q80WJ7 [484-501]"	"Q80WJ7 1xBiotin [K488]"	"1"	"2177.06507"	"0.714"	"1.245"	"0.925138005747468"	"0.906515362333117"	"47.39"	"41.01"	"100.6"	"69.9"	"129.5"	"43.48"	"32.82"	"22.37"	""	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.001166"	"0.005798"	"2.61"	"52.16"
"60408"	"False"	"High"	"[R].SLGYAYVNFQQPADAER.[A]"	""	"0.076517"	"0.00396207"	"1"	"1"	"1"	"P29341"	"P29341 [51-67]"	""	"0"	"1928.91372"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00113"	"0.005671"	"2.68"	""
"48732"	"False"	"High"	"[-].MVAKQR.[I]"	"1xAcetyl [N-Term]; 1xBiotin [K4]"	"0.0760657"	"0.00396207"	"1"	"3"	"19"	"Q9Z1W5"	"Q9Z1W5 [1-6]"	"Q9Z1W5 1xAcetyl [N-Term]; 1xBiotin [K4]"	"1"	"1000.50667"	"0.031"	"1.046"	"6.64120188369121E-05"	"0.919235111389825"	"47.01"	"49.74"	"155.6"	"4.9"	"139.5"	"31.45"	"40.31"	"33.88"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001098"	"0.005619"	"2.00"	"37.90"
"50661"	"False"	"High"	"[K].NIMSSKIADR.[N]"	"1xBiotin [K6]"	"0.077427"	"0.00396207"	"1"	"2"	"2"	"Q8C147"	"Q8C147 [922-931]"	"Q8C147 1xBiotin [K927]"	"1"	"1360.67117"	"0.644"	"1.090"	"0.929016530787821"	"0.906515362333117"	"52.10"	"67.44"	"112.1"	"65.0"	"122.9"	"36.89"	"38.62"	"51.27"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.00113"	"0.005768"	"2.02"	"41.27"
"9281"	"False"	"High"	"[K].DRPFFTGLVK.[Y]"	""	"0.0760657"	"0.00396207"	"1"	"1"	"2"	"P15532"	"P15532 [57-66]"	""	"0"	"1179.65207"	"163.085"	"4.198"	"0.925138005747468"	"0.906515362333117"	"72.60"	"65.61"	"2.0"	"289.3"	"8.6"	"60.01"	"55.54"	"27.59"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001098"	"0.005638"	"2.24"	"43.10"
"71691"	"False"	"High"	"[K].YKPLDLRPK.[K]"	""	"0.077427"	"0.00396207"	"1"	"1"	"1"	"Q6ZWV7"	"Q6ZWV7 [78-86]"	""	"0"	"1129.67281"	"113.633"	"1.254"	"0.434853540501642"	"0.906515362333117"	"46.13"	"101.45"	"2.7"	"293.8"	"3.4"	"33.83"	"37.22"	"83.96"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.00113"	"0.005766"	"1.54"	"25.96"
"71745"	"False"	"High"	"[K].YLDFIFAVK.[N]"	""	"0.0778858"	"0.00396207"	"1"	"3"	"5"	"P17047"	"P17047 [286-294]"	""	"0"	"1115.61356"	"51.751"	"1.221"	"0.925138005747468"	"0.906515362333117"	"37.02"	"52.45"	"6.1"	"287.1"	"6.8"	"34.18"	"26.91"	"38.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.001166"	"0.005793"	"1.99"	"58.40"
"23913"	"False"	"High"	"[K].GYWWHFK.[D]"	""	"0.077427"	"0.00396207"	"1"	"1"	"6"	"Q921D4"	"Q921D4 [144-150]"	""	"0"	"1023.48355"	"38.561"	"1.129"	"0.925138005747468"	"0.906515362333117"	"91.13"	"77.34"	"7.6"	"284.7"	"7.6"	"60.27"	"66.86"	"48.78"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.00113"	"0.005775"	"1.52"	"44.62"
"11810"	"False"	"High"	"[R].EEPSVAPTSTGKTFQPGSWTPEDGKR.[Q]"	"1xBiotin [K12]"	"0.077427"	"0.00396207"	"1"	"1"	"4"	"Q59J78"	"Q59J78 [140-165]"	"Q59J78 1xBiotin [K151]"	"2"	"3015.41527"	"0.932"	"0.949"	"0.925138005747468"	"0.906515362333117"	"57.11"	"72.44"	"104.6"	"98.6"	"96.7"	"37.17"	"43.39"	"73.01"	""	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Not Found"	"High"	"High"	"0.00113"	"0.00578"	"3.15"	"43.99"
"50545"	"False"	"High"	"[K].NLKEAMR.[M]"	"1xBiotin [K3]; 1xOxidation [M6]"	"0.077427"	"0.00396207"	"1"	"5"	"4"	"Q99K01"	"Q99K01 [19-25]"	"Q99K01 1xBiotin [K21]"	"1"	"1103.53361"	"0.168"	"0.764"	"0.0118169088083255"	"0.906515362333117"	"81.93"	"86.28"	"155.2"	"27.6"	"117.3"	"63.71"	"41.97"	"52.04"	""	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.00113"	"0.00576"	"1.79"	"27.56"
"3479"	"False"	"High"	"[K].AQPWWTPR.[E]"	""	"0.077427"	"0.00396207"	"1"	"1"	"12"	"Q8BSY0"	"Q8BSY0 [555-562]"	""	"0"	"1041.52648"	"144.058"	"5.433"	"0.925138005747468"	"0.906515362333117"	"40.57"	"47.97"	"1.9"	"287.3"	"10.7"	"37.34"	"26.55"	"51.15"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.00113"	"0.005779"	"1.72"	"42.35"
"40456"	"False"	"High"	"[-].MAEPSAPESKHK.[S]"	"1xBiotin [K]; 1xMet-loss+Acetyl [N-Term]"	"0.0769707"	"0.00396207"	"1"	"1"	"7"	"Q3TDQ1"	"Q3TDQ1 [1-12]"	"Q3TDQ1 1xBiotin [K]; 1xMet-loss+Acetyl [N-Term]"	"1"	"1448.68384"	"0.261"	"0.866"	"0.925138005747468"	"0.906515362333117"	"72.66"	"77.77"	"141.9"	"36.1"	"122.0"	"57.12"	"39.68"	"67.24"	""	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"0.00113"	"0.005697"	"2.73"	"27.02"
"63735"	"False"	"High"	"[K].TEVKPSSNGSASSASKR.[G]"	"1xBiotin [K16]"	"0.0788112"	"0.00428522"	"1"	"1"	"3"	"Q9DAV9"	"Q9DAV9 [260-276]"	"Q9DAV9 1xBiotin [K275]"	"1"	"1918.92871"	"0.994"	"0.730"	"0.925138005747468"	"0.906515362333117"	"44.91"	"61.52"	"109.2"	"108.3"	"82.5"	"31.86"	"42.61"	"47.84"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001199"	"0.005892"	"2.73"	"20.66"
"13762"	"False"	"High"	"[R].ELMALCLQDPEPK.[N]"	"1xCarbamidomethyl [C6]; 1xOxidation [M3]"	"0.0783472"	"0.00428522"	"1"	"1"	"1"	"Q6XQH0"	"Q6XQH0 [313-325]"	""	"0"	"1559.74439"	"93.262"	"0.937"	"0.982626859977453"	"0.906515362333117"	"104.59"	"77.51"	"2.3"	"295.0"	"2.7"	"86.58"	"72.53"	"78.20"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001166"	"0.005828"	"1.86"	"38.94"
"51817"	"False"	"High"	"[R].NTVKGK.[G]"	"1xBiotin [K4]"	"0.0783472"	"0.00428522"	"1"	"1"	"15"	"Q99P91"	"Q99P91 [538-543]"	"Q99P91 1xBiotin [K541]"	"1"	"872.46585"	"0.040"	"0.805"	"0.000102237726853927"	"0.906515362333117"	"60.57"	"37.37"	"160.8"	"5.5"	"133.7"	"34.12"	"48.15"	"11.79"	""	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001199"	"0.005857"	"1.62"	"19.35"
"33413"	"False"	"High"	"[K].LHQMWLSWNQK.[T]"	"1xOxidation [M4]"	"0.0783472"	"0.00428522"	"1"	"1"	"4"	"Q9DBG5"	"Q9DBG5 [301-311]"	""	"0"	"1486.72598"	"219.932"	"2.898"	"0.925138005747468"	"0.906515362333117"	"49.17"	"43.52"	"1.6"	"293.9"	"4.6"	"39.54"	"29.86"	"28.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001199"	"0.005861"	"1.97"	"39.74"
"23918"	"False"	"High"	"[R].GYYSVETVTLLVALK.[V]"	""	"0.0783472"	"0.00428522"	"1"	"2"	"1"	"P62715"	"P62715 [90-104]"	""	"0"	"1655.92545"	"0.833"	"1.033"	"0.925138005747468"	""	"36.55"	"55.29"	"120.4"	"95.1"	"84.6"	"39.33"	"223.16"	"40.39"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001199"	"0.005864"	"2.35"	"61.35"
"43146"	"False"	"High"	"[K].MEVGQYIFVKCPK.[V]"	"1xBiotin [K13]; 1xCarbamidomethyl [C11]; 1xOxidation [M1]"	"0.0783472"	"0.00428522"	"1"	"1"	"1"	"Q61093"	"Q61093 [319-331]"	"Q61093 1xBiotin [K331]"	"1"	"1840.87945"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001166"	"0.005829"	"2.28"	""
"47951"	"False"	"High"	"[-].MSPTISHKDSSR.[Q]"	"1xBiotin [K8]; 1xMet-loss [N-Term]"	"0.0792777"	"0.00459494"	"1"	"1"	"2"	"Q99J27"	"Q99J27 [1-12]"	"Q99J27 1xBiotin [K8]; 1xMet-loss [N-Term]"	"1"	"1440.68999"	"0.309"	"0.725"	"0.925138005747468"	"0.906515362333117"	"47.59"	"48.74"	"154.1"	"42.8"	"103.2"	"33.64"	"31.42"	"33.13"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001199"	"0.005931"	"2.30"	"23.74"
"64925"	"False"	"High"	"[K].TLWNGQK.[L]"	""	"0.0792777"	"0.00459494"	"1"	"1"	"6"	"P40124"	"P40124 [458-464]"	""	"0"	"846.44683"	"131.044"	"4.507"	"0.925138005747468"	"0.906515362333117"	"45.41"	"32.48"	"2.3"	"287.4"	"10.3"	"27.70"	"34.74"	"14.64"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001229"	"0.005951"	"1.72"	"26.75"
"69967"	"False"	"High"	"[K].VYDLTKFLEEHPGGEEVLR.[E]"	"1xBiotin [K6]"	"0.0797468"	"0.00459494"	"1"	"1"	"1"	"P56395"	"P56395 [34-52]"	"P56395 1xBiotin [K39]"	"1"	"2457.21187"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001229"	"0.005976"	"2.44"	""
"71307"	"False"	"High"	"[R].YFGWNR.[M]"	""	"0.0806928"	"0.00459494"	"1"	"1"	"2"	"P35689"	"P35689 [964-969]"	""	"0"	"842.39440"	"160.517"	"5.415"	"0.424207202959423"	"0.906515362333117"	"46.31"	"59.71"	"1.6"	"288.2"	"10.2"	"63.48"	"15.02"	"30.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001229"	"0.00605"	"1.27"	"37.83"
"72692"	"False"	"High"	"[K].YYGSYFK.[N]"	""	"0.0792777"	"0.00459494"	"1"	"3"	"12"	"Q9JI11"	"Q9JI11 [88-94]"	""	"0"	"927.42470"	"135.386"	"3.580"	"0.925138005747468"	"0.906515362333117"	"48.85"	"41.15"	"2.2"	"289.4"	"8.4"	"29.40"	"55.55"	"29.65"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.001199"	"0.00592"	"1.60"	"33.75"
"71200"	"False"	"High"	"[R].YEGFFGLYR.[G]"	""	"0.0797468"	"0.00459494"	"1"	"2"	"4"	"Q9QXX4"	"Q9QXX4 [385-393]"	""	"0"	"1151.55202"	"143.358"	"3.692"	"0.346137410356404"	"0.906515362333117"	"41.13"	"35.13"	"2.0"	"290.9"	"7.1"	"35.24"	"25.62"	"21.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001229"	"0.005981"	"1.70"	"52.08"
"18453"	"False"	"High"	"[R].FQFFQR.[D]"	""	"0.0792777"	"0.00459494"	"1"	"2"	"2"	"P16546"	"P16546 [46-51]"	""	"0"	"872.44135"	"306.901"	"4.559"	"0.925138005747468"	"0.906515362333117"	"64.41"	"54.69"	"1.0"	"295.1"	"3.9"	"59.14"	"42.89"	"24.93"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001199"	"0.005925"	"1.61"	"41.57"
"69976"	"False"	"High"	"[R].VYFGGFFIR.[G]"	""	"0.0792777"	"0.00459494"	"1"	"3"	"1"	"Q80YV4-1"	"Q80YV4-1 [319-327]"	""	"0"	"1105.58293"	"117.312"	"1.679"	"0.437961938844098"	"0.984757285686748"	"41.94"	"61.07"	"2.4"	"293.6"	"4.1"	"22.45"	"33.54"	"54.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001199"	"0.005927"	"1.41"	"56.74"
"58249"	"False"	"High"	"[R].RVHPISTMIK.[G]"	""	"0.0797468"	"0.00459494"	"1"	"1"	"1"	"P06151"	"P06151 [269-278]"	""	"1"	"1181.68232"	"50.730"	"3.676"	"0.996958523299102"	"0.906515362333117"	"94.50"	"66.62"	"5.5"	"274.0"	"20.5"	"42.33"	"74.00"	"53.03"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001229"	"0.005958"	"3.68"	"26.46"
"31188"	"False"	"High"	"[K].LASFFLSR.[L]"	""	"0.0797468"	"0.00459494"	"1"	"1"	"7"	"Q9DBD5"	"Q9DBD5 [217-224]"	""	"0"	"940.52508"	"177.331"	"5.079"	"0.370718898464095"	"0.906515362333117"	"53.41"	"54.57"	"1.7"	"289.7"	"8.6"	"45.99"	"24.80"	"24.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001229"	"0.005984"	"1.84"	"45.83"
"39328"	"False"	"High"	"[K].IVQLEGKLVSIEK.[E]"	"1xBiotin [K7]"	"0.0792777"	"0.00459494"	"1"	"1"	"1"	"Q00547-1"	"Q00547-1 [210-222]"	"Q00547-1 1xBiotin [K216]"	"1"	"1681.95570"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001199"	"0.005925"	"2.29"	""
"46150"	"False"	"High"	"[R].MNIPFR.[I]"	"1xOxidation [M1]"	"0.0811698"	"0.00459494"	"1"	"1"	"1"	"Q99K85"	"Q99K85 [301-306]"	""	"0"	"793.40252"	"417.155"	"1.629"	"0.925138005747468"	"0.957287483848178"	"44.52"	"89.66"	"0.8"	"298.2"	"1.1"	"31.25"	"33.92"	"99.56"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001229"	"0.006104"	"1.72"	"28.23"
"67088"	"False"	"High"	"[K].VFCIGPVFR.[A]"	"1xCarbamidomethyl [C3]"	"0.0811698"	"0.00459494"	"1"	"1"	"2"	"Q922B2"	"Q922B2 [265-273]"	""	"0"	"1094.58155"	"153.867"	"3.047"	"0.435748277446407"	"0.906515362333117"	"66.38"	"76.71"	"2.4"	"290.9"	"6.7"	"39.05"	"55.65"	"58.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.001229"	"0.00611"	"1.71"	"49.60"
"22856"	"False"	"High"	"[R].GSAFYAFSYYYDR.[A]"	""	"0.0811698"	"0.00459494"	"1"	"1"	"2"	"Q9WUZ9"	"Q9WUZ9 [322-334]"	""	"0"	"1609.69578"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001229"	"0.006128"	"1.91"	""
"70678"	"False"	"High"	"[K].WQLAYR.[T]"	""	"0.0871027"	"0.00479181"	"1"	"1"	"3"	"Q8C166"	"Q8C166 [171-176]"	""	"0"	"836.44135"	"203.210"	"4.769"	"0.925138005747468"	"0.906515362333117"	"91.27"	"91.78"	"1.5"	"291.3"	"7.2"	"76.63"	"54.62"	"38.93"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006698"	"1.47"	"37.14"
"70849"	"False"	"High"	"[R].WVMWFGDGK.[F]"	"1xOxidation [M3]"	"0.0886478"	"0.00479181"	"1"	"2"	"1"	"O88508-1"	"O88508-1 [323-331]"	""	"0"	"1141.51353"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006858"	"2.09"	""
"23889"	"False"	"High"	"[R].GYSNLLK.[R]"	""	"0.0891685"	"0.00479181"	"1"	"1"	"7"	"Q61656"	"Q61656 [517-523]"	""	"0"	"794.44068"	"152.425"	"2.853"	"0.925138005747468"	"0.906515362333117"	"75.59"	"70.89"	"2.2"	"291.6"	"6.2"	"57.88"	"38.38"	"36.51"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006911"	"1.51"	"30.63"
"57611"	"False"	"High"	"[R].RPTFQQICFLLQEQAR.[L]"	"1xCarbamidomethyl [C8]"	"0.089692"	"0.00479181"	"1"	"1"	"1"	"P09581"	"P09581 [898-913]"	""	"0"	"2035.05419"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.00131"	"0.00697"	"3.25"	""
"36539"	"False"	"High"	"[K].LNWMNLR.[D]"	"1xOxidation [M4]"	"0.0891685"	"0.00479181"	"1"	"1"	"4"	"O55057"	"O55057 [17-23]"	""	"0"	"962.48765"	"162.644"	"2.703"	"0.406773260894653"	"0.916215054610739"	"43.03"	"71.03"	"1.9"	"293.8"	"4.3"	"38.19"	"28.50"	"65.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.00131"	"0.00691"	"1.84"	"39.64"
"18269"	"False"	"High"	"[R].FNIWPGYR.[W]"	""	"0.0902184"	"0.00479181"	"1"	"2"	"7"	"Q8R149"	"Q8R149 [594-601]"	""	"0"	"1052.53123"	"99.706"	"2.641"	"0.486459598296651"	"0.916215054610739"	"51.70"	"77.93"	"3.4"	"289.3"	"7.3"	"39.54"	"31.91"	"56.84"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.001342"	"0.007015"	"2.27"	"47.81"
"2108"	"False"	"High"	"[K].ALESPERPFLAILGGAK.[V]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"2"	"P09411"	"P09411 [200-216]"	""	"0"	"1768.99560"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001372"	"0.007232"	"1.88"	""
"25357"	"False"	"High"	"[K].HVVFGQVIK.[G]"	""	"0.0871027"	"0.00479181"	"1"	"1"	"2"	"Q9CR16"	"Q9CR16 [146-154]"	""	"0"	"1026.60948"	"104.823"	"1.286"	"0.429919125733816"	"0.906515362333117"	"68.11"	"74.80"	"3.1"	"292.9"	"4.0"	"52.43"	"45.95"	"77.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.00671"	"2.75"	"32.31"
"71996"	"False"	"High"	"[K].YMHSGPVVAMVWEGLNVVK.[T]"	"1xOxidation [M2]"	"0.0840874"	"0.00479181"	"1"	"1"	"2"	"P15532"	"P15532 [67-85]"	""	"0"	"2132.06673"	"1.240"	"1.543"	"0.925138005747468"	"0.916215054610739"	"62.46"	"54.89"	"79.5"	"102.6"	"117.9"	"39.43"	"194.35"	"52.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.001257"	"0.006379"	"3.78"	"59.02"
"168"	"False"	"High"	"[R].AAKMPR.[S]"	"1xBiotin [K3]; 1xOxidation [M4]"	"0.0840874"	"0.00479181"	"1"	"1"	"25"	"Q3UBX0"	"Q3UBX0 [233-238]"	"Q3UBX0 1xBiotin [K235]"	"1"	"915.45390"	"0.024"	"0.937"	"3.97676679121269E-05"	"0.906515362333117"	"89.47"	"52.32"	"145.1"	"3.9"	"151.1"	"28.67"	"67.23"	"36.61"	""	"High"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001292"	"0.006418"	"1.83"	"19.08"
"57463"	"False"	"High"	"[R].RPGPKAPDSPPSR.[F]"	"1xBiotin [K5]"	"0.0902184"	"0.00479181"	"1"	"1"	"2"	"Q8K1T1"	"Q8K1T1 [230-242]"	"Q8K1T1 1xBiotin [K234]"	"1"	"1587.80602"	"0.674"	"1.124"	"0.925138005747468"	"0.906515362333117"	"42.75"	"47.79"	"114.2"	"70.4"	"115.4"	"38.27"	"20.33"	"27.98"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001342"	"0.007008"	"3.06"	"24.83"
"30099"	"False"	"High"	"[R].KTVFDR.[H]"	"1xBiotin [K1]"	"0.0850815"	"0.00479181"	"1"	"1"	"4"	"Q9CR23"	"Q9CR23 [173-178]"	"Q9CR23 1xBiotin [K173]"	"1"	"991.50296"	"0.230"	"0.719"	"0.925138005747468"	"0.906515362333117"	"85.23"	"83.03"	"155.8"	"32.2"	"112.0"	"58.65"	"48.47"	"58.37"	""	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.00131"	"0.006481"	"1.75"	"35.88"
"59494"	"False"	"High"	"[K].SFSQFGK.[L]"	""	"0.0865932"	"0.00479181"	"1"	"2"	"2"	"Q7TMK9"	"Q7TMK9 [357-363]"	""	"0"	"800.39373"	"154.381"	"4.332"	"0.925138005747468"	"0.906515362333117"	"76.79"	"74.88"	"2.1"	"289.7"	"8.2"	"55.52"	"47.36"	"59.68"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006646"	"1.96"	"25.97"
"19704"	"False"	"High"	"[R].GCYFVLNWLQK.[T]"	"1xCarbamidomethyl [C2]"	"0.0826166"	"0.00479181"	"1"	"2"	"3"	"A2BE28"	"A2BE28 [157-167]"	""	"0"	"1427.71402"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.001257"	"0.006274"	"1.88"	""
"18986"	"False"	"High"	"[K].FVLVFPLMYHSLNGIR.[H]"	"1xOxidation [M8]"	"0.0902184"	"0.00479181"	"1"	"1"	"1"	"Q9CZB0"	"Q9CZB0 [118-133]"	""	"0"	"1922.03569"	"1.306"	"1.169"	"0.925138005747468"	""	"69.12"	"34.46"	"91.1"	"105.7"	"103.2"	"39.57"	"217.25"	"35.67"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001342"	"0.006989"	"3.53"	"58.45"
"21533"	"False"	"High"	"[K].GLLNAIVIR.[E]"	""	"0.0886478"	"0.00479181"	"1"	"1"	"3"	"P29758"	"P29758 [375-383]"	""	"0"	"968.62513"	"54.725"	"0.931"	"0.637477353296579"	"0.906515362333117"	"132.40"	"99.42"	"6.7"	"289.5"	"3.7"	"47.44"	"88.51"	"100.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006851"	"2.05"	"49.59"
"35345"	"False"	"High"	"[K].LLQKVEELKK.[I]"	"1xBiotin [K]"	"0.0855827"	"0.00479181"	"1"	"2"	"2"	"Q920B0"	"Q920B0 [441-450]"	"Q920B0 1xBiotin [K]"	"2"	"1453.84470"	"0.229"	"0.616"	"0.925138005747468"	"0.906515362333117"	"78.10"	"109.55"	"170.7"	"45.3"	"84.0"	"57.50"	"52.57"	"75.27"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.00131"	"0.006561"	"2.30"	"39.74"
"30239"	"False"	"High"	"[K].KVGYTPDWIFLLR.[N]"	""	"0.0850815"	"0.00479181"	"1"	"1"	"1"	"Q68FD5"	"Q68FD5 [507-519]"	""	"1"	"1607.89442"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006481"	"2.05"	""
"65525"	"False"	"High"	"[K].TQYHMGYFR.[D]"	"1xOxidation [M5]"	"0.0876149"	"0.00479181"	"1"	"1"	"2"	"Q8CFE2"	"Q8CFE2 [125-133]"	""	"0"	"1218.53605"	"269.999"	"4.376"	"0.925138005747468"	"0.906515362333117"	"47.48"	"37.71"	"1.2"	"293.7"	"5.0"	"28.55"	"44.08"	"24.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006738"	"1.69"	"23.30"
"35171"	"False"	"High"	"[R].LLNVWQVR.[S]"	""	"0.0865932"	"0.00479181"	"1"	"1"	"2"	"Q6ZQL4"	"Q6ZQL4 [244-251]"	""	"0"	"1027.60473"	"155.065"	"3.710"	"0.442721334384406"	"0.906515362333117"	"66.33"	"71.76"	"1.9"	"290.9"	"7.2"	"56.36"	"35.07"	"42.88"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006651"	"1.86"	"45.73"
"70897"	"False"	"High"	"[K].WYLGWK.[S]"	""	"0.0912798"	"0.00479181"	"1"	"1"	"3"	"Q9ERA6"	"Q9ERA6 [683-688]"	""	"0"	"852.44029"	"69.291"	"1.844"	"0.957624292330808"	"0.948604527806333"	"58.26"	"57.50"	"4.8"	"287.8"	"7.3"	"57.30"	"34.19"	"35.01"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.001342"	"0.007091"	"1.62"	"48.13"
"56229"	"False"	"High"	"[R].REEVKAK.[E]"	"1xBiotin [K5]"	"0.0871027"	"0.00479181"	"1"	"1"	"9"	"Q3U9G9"	"Q3U9G9 [182-188]"	"Q3U9G9 1xBiotin [K186]"	"2"	"1085.57719"	"0.194"	"0.750"	"0.00344785569694831"	"0.906515362333117"	"246.40"	"49.69"	"153.3"	"30.1"	"116.5"	"32.21"	"114.45"	"48.56"	""	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.00131"	"0.00668"	"2.13"	"17.72"
"18766"	"False"	"High"	"[K].FSSFFK.[S]"	""	"0.0907477"	"0.00479181"	"1"	"5"	"6"	"Q61466"	"Q61466 [233-238]"	""	"0"	"762.38210"	"232.634"	"5.914"	"0.925138005747468"	"0.906515362333117"	"77.02"	"73.95"	"1.2"	"292.5"	"6.3"	"59.45"	"47.70"	"24.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001342"	"0.007046"	"1.42"	"39.45"
"12866"	"False"	"High"	"[R].EKEELMLR.[L]"	"1xBiotin [K2]"	"0.0871027"	"0.00479181"	"1"	"1"	"1"	"P26040"	"P26040 [343-350]"	"P26040 1xBiotin [K344]"	"1"	"1273.62790"	"0.836"	"0.606"	"0.947989303413716"	"0.906515362333117"	"76.23"	"65.26"	"111.6"	"105.5"	"82.9"	"59.04"	"27.03"	"39.59"	""	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006709"	"1.78"	"42.48"
"72193"	"False"	"High"	"[R].YPSLWR.[R]"	""	"0.0840874"	"0.00479181"	"1"	"2"	"7"	"Q9Z0H3"	"Q9Z0H3 [47-52]"	""	"0"	"821.43045"	"115.798"	"5.404"	"0.947989303413716"	"0.906515362333117"	"63.68"	"65.49"	"2.4"	"285.0"	"12.6"	"22.30"	"74.70"	"56.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001257"	"0.006384"	"1.22"	"40.21"
"64365"	"False"	"High"	"[K].TKNAVQALIDK.[H]"	"1xBiotin [K2]"	"0.0816494"	"0.00479181"	"1"	"1"	"2"	"Q9D850-1"	"Q9D850-1 [296-306]"	"Q9D850-1 1xBiotin [K297]"	"1"	"1426.77226"	"0.613"	"0.806"	"0.925138005747468"	"0.906515362333117"	"61.00"	"63.24"	"106.9"	"95.3"	"97.8"	"49.54"	"42.71"	"32.85"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001229"	"0.006154"	"1.99"	"45.59"
"13065"	"False"	"High"	"[K].EKMVGGIAQIIAAQEEMLR.[K]"	"1xBiotin [K2]; 2xOxidation [M3; M17]"	"0.0928936"	"0.00479181"	"1"	"1"	"2"	"P26039"	"P26039 [2492-2510]"	"P26039 1xBiotin [K2493]"	"1"	"2345.16618"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.001372"	"0.007306"	"2.11"	""
"59451"	"False"	"High"	"[K].SFLYSHFK.[D]"	""	"0.0886478"	"0.00479181"	"1"	"1"	"1"	"P24527"	"P24527 [427-434]"	""	"0"	"1028.51999"	"272.912"	"6.445"	"0.434853540501642"	"0.906515362333117"	"78.13"	"89.34"	"1.1"	"291.2"	"7.7"	"62.06"	"36.44"	"62.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006854"	"1.12"	"34.98"
"72015"	"False"	"High"	"[K].YMMWFQR.[H]"	"1xOxidation [M2]"	"0.0923527"	"0.00479181"	"1"	"1"	"2"	"Q8K0V4"	"Q8K0V4 [700-706]"	""	"0"	"1077.46447"	"5.174"	"2.268"	"0.925138005747468"	"0.969054191468458"	"136.50"	"68.18"	"38.2"	"175.1"	"86.7"	"56.47"	"137.18"	"41.87"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.001372"	"0.007254"	"1.18"	"44.22"
"33962"	"False"	"High"	"[R].IKTSDVTSTK.[G]"	"1xBiotin [K2]"	"0.0845831"	"0.00479181"	"1"	"1"	"5"	"P54823"	"P54823 [85-94]"	"P54823 1xBiotin [K86]"	"1"	"1305.67188"	"0.733"	"3.319"	"0.100075296238178"	"0.906515362333117"	"142.26"	"112.73"	"64.0"	"30.7"	"205.4"	"82.41"	"219.60"	"40.43"	""	"High"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006471"	"1.39"	"27.02"
"10530"	"False"	"High"	"[R].EALQYFYFLR.[D]"	""	"0.0891685"	"0.00479181"	"1"	"2"	"2"	"Q8BJ71-1"	"Q8BJ71-1 [546-555]"	""	"0"	"1349.68885"	"21.058"	"1.093"	"0.835322069431012"	"0.906515362333117"	"82.65"	"47.75"	"12.9"	"272.6"	"14.5"	"15.33"	"79.69"	"41.55"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006914"	"1.64"	"58.90"
"70935"	"False"	"High"	"[R].YAGLLFSSR.[S]"	""	"0.08813"	"0.00479181"	"1"	"1"	"2"	"P52431"	"P52431 [807-815]"	""	"0"	"1013.54146"	"48.629"	"0.989"	"0.925138005747468"	""	"63.03"	"45.01"	"6.2"	"287.3"	"6.5"	"30.04"	"74.73"	"34.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006801"	"1.57"	"42.74"
"18813"	"False"	"High"	"[K].FSYSWR.[S]"	""	"0.0886478"	"0.00479181"	"1"	"1"	"5"	"Q91X20"	"Q91X20 [451-456]"	""	"0"	"845.39406"	"107.805"	"3.273"	"0.930511068991592"	"0.906515362333117"	"61.56"	"63.27"	"3.0"	"288.4"	"8.6"	"51.46"	"49.12"	"41.76"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.00131"	"0.006842"	"1.32"	"37.35"
"30891"	"False"	"High"	"[K].IAGYVTHLMK.[R]"	"1xOxidation [M9]"	"0.0821316"	"0.00479181"	"1"	"1"	"2"	"P63276"	"P63276 [50-59]"	""	"0"	"1148.61324"	"213.945"	"2.220"	"0.745377714452024"	"0.918917046413924"	"57.94"	"67.33"	"1.5"	"296.1"	"2.4"	"45.31"	"39.08"	"58.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.001257"	"0.006206"	"1.67"	"26.43"
"70958"	"False"	"High"	"[K].YAISMAR.[K]"	"1xOxidation [M5]"	"0.089692"	"0.00479181"	"1"	"1"	"8"	"Q61233"	"Q61233 [585-591]"	""	"0"	"827.40800"	"298.742"	"3.446"	"0.925138005747468"	"0.906515362333117"	"56.01"	"66.58"	"1.0"	"295.4"	"3.5"	"60.42"	"43.97"	"49.10"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006972"	"1.45"	"20.40"
"72232"	"False"	"High"	"[R].YQGVNLYVK.[N]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"4"	"P29341"	"P29341 [291-299]"	""	"0"	"1083.58332"	"128.577"	"1.136"	"0.456381964830803"	"0.906515362333117"	"36.35"	"64.45"	"2.6"	"294.5"	"2.9"	"26.27"	"27.88"	"65.17"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001372"	"0.007226"	"1.22"	"35.68"
"56925"	"False"	"High"	"[K].RLFPWK.[L]"	""	"0.0865932"	"0.00479181"	"1"	"1"	"6"	"P97369"	"P97369 [318-323]"	""	"1"	"846.49847"	"74.017"	"1.771"	"0.998769547666767"	"0.916215054610739"	"75.25"	"79.80"	"4.4"	"289.3"	"6.2"	"50.64"	"63.64"	"59.91"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.00131"	"0.006632"	"2.05"	"38.41"
"30547"	"False"	"High"	"[K].KYCQVIR.[I]"	"1xCarbamidomethyl [C3]"	"0.0902184"	"0.00479181"	"1"	"1"	"1"	"P27659"	"P27659 [155-161]"	""	"1"	"966.51895"	"44.933"	"2.708"	"0.925138005747468"	"0.909223670800027"	"136.95"	"70.39"	"4.8"	"282.4"	"12.8"	"38.11"	"77.99"	"62.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001342"	"0.007031"	"1.48"	"17.20"
"43306"	"False"	"High"	"[-].MFNLMK.[K]"	"2xOxidation [M1; M5]"	"0.0860866"	"0.00479181"	"1"	"4"	"1"	"Q9JMH9-1"	"Q9JMH9-1 [1-6]"	""	"0"	"815.37901"	"285.302"	"1.521"	"0.925138005747468"	"0.913565512658592"	"74.18"	"53.10"	"1.0"	"297.4"	"1.6"	"26.10"	"62.82"	"57.65"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006603"	"1.61"	"20.08"
"69939"	"False"	"High"	"[K].VWINTSDIILIGLR.[D]"	""	"0.0886478"	"0.00479181"	"1"	"1"	"2"	"Q60872"	"Q60872 [69-82]"	""	"0"	"1612.94210"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006875"	"1.98"	""
"31256"	"False"	"High"	"[K].IAVAAQNCYK.[V]"	"1xCarbamidomethyl [C8]"	"0.08813"	"0.00479181"	"1"	"1"	"3"	"P17751"	"P17751 [110-119]"	""	"0"	"1137.57211"	"8.075"	"1.271"	"0.999791625166089"	"0.906515362333117"	"181.15"	"39.13"	"29.7"	"233.1"	"37.2"	"39.93"	"115.59"	"27.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.00131"	"0.00678"	"1.97"	"23.14"
"23105"	"False"	"High"	"[K].GSQYWR.[YF]"	""	"0.0886478"	"0.00479181"	"1"	"2"	"16"	"Q8K3F2"	"Q8K3F2 [412-417]"	""	"0"	"796.37366"	"113.835"	"2.988"	"0.925158317651619"	"0.906515362333117"	"41.02"	"25.44"	"2.4"	"290.2"	"7.4"	"24.77"	"37.18"	"20.97"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.00131"	"0.006831"	"1.66"	"24.05"
"50011"	"False"	"High"	"[K].NGGFGFGR.[N]"	""	"0.0886478"	"0.00479181"	"1"	"1"	"4"	"Q9R0H5"	"Q9R0H5 [67-74]"	""	"0"	"811.38456"	"39.247"	"0.765"	"0.925138005747468"	"0.906515362333117"	"53.94"	"69.63"	"7.1"	"288.2"	"4.8"	"43.94"	"39.97"	"62.06"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006844"	"1.97"	"32.65"
"46711"	"False"	"High"	"[-].MPSAKQR.[G]"	"1xBiotin [K5]; 1xMet-loss [N-Term]"	"0.0902184"	"0.00479181"	"1"	"1"	"5"	"Q8BMK4"	"Q8BMK4 [1-7]"	"Q8BMK4 1xBiotin [K5]; 1xMet-loss [N-Term]"	"1"	"912.47200"	"0.131"	"0.809"	"0.0070650609928628"	"0.906515362333117"	"88.03"	"73.86"	"143.2"	"27.6"	"129.2"	"69.68"	"40.71"	"44.53"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.001342"	"0.00703"	"1.83"	"17.96"
"8058"	"False"	"High"	"[K].DKYVGVSSDSVGGFR.[Y]"	"1xBiotin [K2]"	"0.0891685"	"0.00479181"	"1"	"2"	"2"	"Q99KN9-1"	"Q99KN9-1 [165-179]"	"Q99KN9-1 1xBiotin [K166]"	"1"	"1798.84286"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006925"	"1.61"	""
"3027"	"False"	"High"	"[K].ANPFGGASHAKGIVLEK.[V]"	"1xBiotin [K11]"	"0.0860866"	"0.00479181"	"1"	"1"	"3"	"P62267"	"P62267 [38-54]"	"P62267 1xBiotin [K48]"	"1"	"1921.99528"	"0.451"	"0.773"	"0.925138005747468"	"0.906515362333117"	"48.98"	"74.41"	"136.4"	"63.9"	"99.7"	"40.36"	"17.18"	"70.73"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"0.00131"	"0.006577"	"3.22"	"44.18"
"17852"	"False"	"High"	"[K].FLLKTFTNIK.[S]"	"1xBiotin [K4]"	"0.0835944"	"0.00479181"	"1"	"2"	"1"	"Q8CDA1"	"Q8CDA1 [129-138]"	"Q8CDA1 1xBiotin [K132]"	"1"	"1450.81267"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001257"	"0.006368"	"2.13"	""
"70302"	"False"	"High"	"[K].WGLHVFR.[I]"	""	"0.0845831"	"0.00479181"	"1"	"3"	"2"	"Q01063"	"Q01063 [343-349]"	""	"0"	"914.49953"	"70.513"	"1.465"	"0.478597253695619"	"0.906777072223237"	"95.61"	"75.58"	"4.1"	"289.7"	"6.2"	"30.96"	"89.40"	"72.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.00131"	"0.006454"	"1.68"	"40.84"
"17031"	"False"	"High"	"[R].FCPFYK.[T]"	"1xCarbamidomethyl [C2]"	"0.0850815"	"0.00479181"	"1"	"1"	"3"	"P50516-1"	"P50516-1 [531-536]"	""	"0"	"861.39637"	"152.616"	"3.812"	"0.925138005747468"	"0.906515362333117"	"64.56"	"74.91"	"1.8"	"291.4"	"6.8"	"65.34"	"35.08"	"78.72"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006487"	"1.56"	"35.70"
"32664"	"False"	"High"	"[R].IFTPLLHK.[I]"	""	"0.0886478"	"0.00479181"	"1"	"2"	"3"	"Q00612"	"Q00612 [464-471]"	""	"0"	"968.59276"	"59.796"	"0.912"	"0.672194067384001"	"0.906515362333117"	"140.53"	"65.93"	"4.9"	"290.7"	"4.4"	"42.63"	"81.11"	"58.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.00131"	"0.006867"	"1.60"	"36.22"
"61743"	"False"	"High"	"[K].SQLLQYVYNLVPR.[G]"	""	"0.0865932"	"0.00479181"	"1"	"1"	"1"	"P49717"	"P49717 [516-528]"	""	"0"	"1592.87950"	"1.094"	"0.975"	"0.925138005747468"	"0.906515362333117"	"86.40"	"63.46"	"106.3"	"100.8"	"92.8"	"44.04"	"220.60"	"27.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006661"	"2.37"	"62.85"
"21124"	"False"	"High"	"[K].GKGLSVLLSHAKAPFFR.[G]"	"1xBiotin [K12]"	"0.0923527"	"0.00479181"	"1"	"1"	"1"	"Q99P91"	"Q99P91 [542-558]"	"Q99P91 1xBiotin [K553]"	"2"	"2054.13680"	"0.783"	"0.942"	"0.975052343286225"	"0.906515362333117"	"117.18"	"77.09"	"120.2"	"66.4"	"113.4"	"68.11"	"233.79"	"24.77"	""	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.001372"	"0.007206"	"4.00"	"56.50"
"72709"	"False"	"High"	"[K].YYLAPK.[I]"	""	"0.08813"	"0.00479181"	"1"	"1"	"18"	"P17918"	"P17918 [249-254]"	""	"0"	"754.41340"	"77.940"	"2.350"	"0.992871679916025"	"0.936688300042187"	"54.19"	"39.90"	"3.8"	"286.5"	"9.8"	"36.07"	"61.61"	"26.73"	"MandatoryModificationMissing"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.00131"	"0.00681"	"1.35"	"24.66"
"45631"	"False"	"High"	"[K].MIWWANK.[E]"	""	"0.0855827"	"0.00479181"	"1"	"1"	"1"	"E9PVA8"	"E9PVA8 [2573-2579]"	""	"0"	"948.47602"	"2.094"	"4.521"	"0.925138005747468"	"0.906515362333117"	"86.14"	"51.72"	"50.0"	"58.9"	"191.1"	"44.00"	"148.76"	"29.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006529"	"1.74"	"44.51"
"72719"	"False"	"High"	"[K].YYLLYYR.[E]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"1"	"Q8BHD8"	"Q8BHD8 [351-357]"	""	"0"	"1053.54039"	"64.683"	"1.253"	"0.925138005747468"	"0.906515362333117"	"58.73"	"61.09"	"4.2"	"290.6"	"5.2"	"46.35"	"35.63"	"54.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.001372"	"0.007216"	"1.64"	"45.62"
"32512"	"False"	"High"	"[R].LFLLPHK.[D]"	""	"0.0923527"	"0.00479181"	"1"	"2"	"1"	"Q08943"	"Q08943 [242-248]"	""	"0"	"867.54509"	"129.391"	"2.628"	"0.457511547490532"	"0.91732474952757"	"73.59"	"67.75"	"2.1"	"292.5"	"5.4"	"48.05"	"53.75"	"68.56"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001372"	"0.007246"	"1.55"	"38.07"
"17196"	"False"	"High"	"[R].FELFWK.[K]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"2"	"Q7TPV4"	"Q7TPV4 [279-284]"	""	"0"	"869.45560"	"83.076"	"2.550"	"0.478573781684308"	"0.923750342545975"	"34.59"	"61.70"	"3.5"	"288.1"	"8.4"	"24.59"	"23.85"	"62.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001372"	"0.007201"	"1.70"	"52.69"
"62539"	"False"	"High"	"[K].STELLIR.[K]"	""	"0.0923527"	"0.00479181"	"1"	"4"	"2"	"P84244"	"P84244 [58-64]"	""	"0"	"831.49344"	"127.062"	"1.602"	"0.434853540501642"	"0.916215054610739"	"95.97"	"52.23"	"3.3"	"292.1"	"4.7"	"42.62"	"235.73"	"33.26"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001372"	"0.007228"	"1.76"	"32.74"
"19570"	"False"	"High"	"[K].GATYGKPVHHGVNQLK.[F]"	""	"0.0840874"	"0.00479181"	"1"	"1"	"3"	"Q9CZM2"	"Q9CZM2 [78-93]"	""	"0"	"1705.91326"	"1.123"	"1.532"	"0.972075648754221"	"0.906515362333117"	"96.63"	"65.82"	"93.5"	"65.8"	"140.7"	"52.64"	"166.47"	"35.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001292"	"0.006406"	"2.69"	"16.96"
"39616"	"False"	"High"	"[K].LYGKPIR.[V]"	""	"0.0871027"	"0.00479181"	"1"	"1"	"4"	"Q8QZY9"	"Q8QZY9 [79-85]"	""	"0"	"846.51960"	"233.632"	"8.462"	"0.339573869323658"	"0.906515362333117"	"31.13"	"68.36"	"1.2"	"287.2"	"11.5"	"44.06"	"44.21"	"45.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006708"	"1.72"	"17.26"
"27613"	"False"	"High"	"[R].KLCQGLFFR.[V]"	"1xCarbamidomethyl [C3]"	"0.0826166"	"0.00479181"	"1"	"1"	"4"	"Q9JKR6"	"Q9JKR6 [803-811]"	""	"1"	"1168.62956"	"102.182"	"2.753"	"0.925138005747468"	"0.906515362333117"	"48.05"	"48.65"	"3.1"	"289.4"	"7.5"	"39.51"	"40.27"	"36.97"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001257"	"0.006272"	"2.37"	"39.53"
"4659"	"False"	"High"	"[R].AWYPLGR.[I]"	""	"0.0835944"	"0.00479181"	"2"	"2"	"4"	"P46978; Q3TDQ1"	"P46978 [76-82]; Q3TDQ1 [127-133]"	""	"0"	"862.45700"	"398.923"	"12.628"	"0.822477606805249"	"0.906515362333117"	"90.51"	"101.07"	"0.6"	"292.7"	"6.7"	"84.87"	"32.54"	"65.64"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001257"	"0.006332"	"1.68"	"40.15"
"71562"	"False"	"High"	"[K].YGVFLR.[V]"	""	"0.0928936"	"0.00479181"	"1"	"1"	"8"	"O35295"	"O35295 [253-258]"	""	"0"	"754.42464"	"296.934"	"8.722"	"0.925138005747468"	"0.906515362333117"	"65.76"	"52.39"	"1.3"	"287.9"	"10.8"	"60.28"	"82.16"	"26.80"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001372"	"0.007294"	"1.49"	"36.90"
"39724"	"False"	"High"	"[R].IYSLFNLYMGK.[L]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"1"	"Q60790"	"Q60790 [733-743]"	""	"0"	"1348.69697"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001372"	"0.007226"	"1.88"	""
"4733"	"False"	"High"	"[KR].AYVSLFMR.[H]"	"1xOxidation [M7]"	"0.0886478"	"0.00479181"	"1"	"2"	"1"	"Q6PDQ2"	"Q6PDQ2 [1451-1458]"	""	"0"	"1002.50771"	"246.431"	"3.413"	"0.604421892980025"	"0.906515362333117"	"72.97"	"80.64"	"1.1"	"295.2"	"3.7"	"62.88"	"36.83"	"30.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006872"	"1.58"	"41.29"
"39765"	"False"	"High"	"[K].LYWLMK.[S]"	"1xOxidation [M5]"	"0.0826166"	"0.00479181"	"1"	"1"	"10"	"Q8C129"	"Q8C129 [906-911]"	""	"0"	"869.45897"	"291.545"	"6.948"	"0.925138005747468"	"0.906515362333117"	"57.31"	"65.59"	"1.0"	"291.6"	"7.4"	"37.34"	"36.08"	"49.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"High"	"High"	"High"	"0.001257"	"0.006241"	"1.45"	"41.19"
"47554"	"False"	"High"	"[R].MSFIAPNLSIIIGASTAAK.[I]"	"1xOxidation [M1]"	"0.0816494"	"0.00479181"	"1"	"2"	"1"	"Q8CCF0"	"Q8CCF0 [212-230]"	""	"0"	"1921.04631"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001229"	"0.006141"	"2.18"	""
"47711"	"False"	"High"	"[K].MSKFGFAIGSQTAR.[K]"	"1xBiotin [K3]; 1xOxidation [M1]"	"0.0850815"	"0.00479181"	"1"	"1"	"1"	"Q6P8I4"	"Q6P8I4 [68-81]"	"Q6P8I4 1xBiotin [K70]"	"1"	"1742.83527"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006511"	"1.57"	""
"21175"	"False"	"High"	"[R].GKLWPFIK.[K]"	""	"0.0821316"	"0.00479181"	"1"	"5"	"1"	"Q80TY0"	"Q80TY0 [318-325]"	""	"1"	"988.59785"	"102.109"	"2.611"	"0.734599499256898"	"0.919235111389825"	"77.48"	"76.75"	"2.6"	"290.0"	"7.4"	"63.74"	"30.75"	"27.42"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001257"	"0.006199"	"1.60"	"45.80"
"32959"	"False"	"High"	"[R].LGKVADWTGATYQDKR.[Y]"	"1xBiotin [K3]"	"0.0821316"	"0.00479181"	"1"	"1"	"3"	"O70194"	"O70194 [39-54]"	"O70194 1xBiotin [K41]"	"2"	"2035.00657"	"0.637"	"1.090"	"0.925138005747468"	"0.906515362333117"	"73.22"	"67.00"	"131.3"	"65.2"	"103.4"	"39.94"	"58.88"	"81.09"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001257"	"0.006202"	"2.33"	"42.28"
"18085"	"False"	"High"	"[R].FLVYGR.[Y]"	""	"0.0912798"	"0.00479181"	"1"	"1"	"2"	"P27870"	"P27870 [277-282]"	""	"0"	"754.42464"	"67.205"	"1.064"	"0.701788200472087"	"0.906515362333117"	"29.51"	"33.66"	"4.7"	"291.0"	"4.4"	"21.46"	"51.40"	"24.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001372"	"0.007135"	"1.68"	"33.27"
"60574"	"False"	"High"	"[K].SIMLPKSLLSVVK.[S]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.0850815"	"0.00479181"	"1"	"1"	"3"	"P15261"	"P15261 [287-299]"	"P15261 1xBiotin [K292]"	"1"	"1656.94270"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.00131"	"0.006502"	"1.49"	""
"60"	"False"	"High"	"[K].AACLPLPGYR.[V]"	"1xCarbamidomethyl [C3]"	"0.0902184"	"0.00479181"	"1"	"1"	"3"	"Q61233"	"Q61233 [40-49]"	""	"0"	"1117.58228"	"210.911"	"5.802"	"0.354666974571227"	"0.906515362333117"	"61.93"	"63.07"	"1.4"	"291.2"	"7.3"	"53.27"	"21.91"	"25.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001342"	"0.007002"	"1.94"	"39.35"
"60577"	"False"	"High"	"[R].SLMPYFLLTQAVR.[T]"	""	"0.0891685"	"0.00479181"	"1"	"1"	"2"	"P14685"	"P14685 [352-364]"	""	"0"	"1538.83995"	"1.996"	"0.946"	"0.925138005747468"	"0.906515362333117"	"92.22"	"64.63"	"84.9"	"120.1"	"95.0"	"49.89"	"159.92"	"38.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.00131"	"0.006886"	"1.93"	"62.19"
"71782"	"False"	"High"	"[R].YIFTMLSSLAR.[L]"	"1xOxidation [M5]"	"0.0902184"	"0.00479181"	"1"	"1"	"3"	"Q64511"	"Q64511 [814-824]"	""	"0"	"1317.68713"	"79.876"	"1.155"	"0.925138005747468"	""	"56.22"	"58.04"	"3.5"	"292.7"	"3.8"	"46.58"	"42.85"	"43.40"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001342"	"0.007011"	"2.15"	"51.33"
"37847"	"False"	"High"	"[R].LSAYVSYGGLLMR.[L]"	"1xOxidation [M12]"	"0.0860866"	"0.00479181"	"1"	"1"	"1"	"Q923G2"	"Q923G2 [112-124]"	""	"0"	"1445.74571"	"135.015"	"2.377"	"0.372007186706233"	"0.937072062058245"	"76.39"	"67.72"	"2.2"	"292.9"	"4.9"	"50.98"	"71.27"	"62.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.00131"	"0.006589"	"2.27"	"46.17"
"60578"	"False"	"High"	"[R].SLMPYFLLTQAVR.[T]"	"1xOxidation [M3]"	"0.0886478"	"0.00479181"	"1"	"1"	"2"	"P14685"	"P14685 [352-364]"	""	"0"	"1554.83486"	"32.065"	"0.865"	"0.925138005747468"	""	"96.32"	"69.97"	"11.0"	"279.8"	"9.2"	"43.91"	"94.81"	"50.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.006862"	"1.83"	"57.63"
"21312"	"False"	"High"	"[R].GLAVGIALVMYGR.[M]"	""	"0.0855827"	"0.00479181"	"1"	"1"	"1"	"Q3TXS7"	"Q3TXS7 [547-559]"	""	"0"	"1319.75040"	"38.178"	"1.320"	"0.925138005747468"	"0.906515362333117"	"84.79"	"42.44"	"7.0"	"282.1"	"10.9"	"19.82"	"75.63"	"28.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00131"	"0.00652"	"2.24"	"58.32"
"66263"	"False"	"High"	"[R].TVWQYHFR.[T]"	""	"0.0826166"	"0.00479181"	"1"	"2"	"1"	"P35235"	"P35235 [418-425]"	""	"0"	"1136.56359"	"122.908"	"2.886"	"0.367277538787618"	"0.906515362333117"	"47.18"	"38.75"	"2.7"	"289.7"	"7.6"	"25.44"	"36.06"	"29.61"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001257"	"0.006261"	"1.64"	"37.23"
"33182"	"False"	"High"	"[R].LGSGSSASVYR.[V]"	""	"0.0816494"	"0.00479181"	"1"	"1"	"8"	"P97343"	"P97343 [29-39]"	""	"0"	"1083.54291"	"29.314"	"0.782"	"0.925138005747468"	"0.906515362333117"	"51.73"	"47.42"	"10.8"	"280.5"	"8.7"	"50.38"	"68.07"	"30.96"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001229"	"0.00614"	"2.28"	"24.90"
"38453"	"False"	"High"	"[K].ISVLFSFLR.[S]"	""	"0.089692"	"0.00479181"	"1"	"1"	"3"	"Q80Y44"	"Q80Y44 [301-309]"	""	"0"	"1081.64044"	"107.596"	"1.677"	"0.434188231119637"	"0.965817839578135"	"72.94"	"77.84"	"2.5"	"292.1"	"5.4"	"68.73"	"57.35"	"45.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001342"	"0.006982"	"1.78"	"61.30"
"37518"	"False"	"High"	"[R].IQVTGCNQDSDVQRK.[L]"	"1xBiotin [K15]; 1xCarbamidomethyl [C6]"	"0.0860866"	"0.00479181"	"1"	"1"	"1"	"Q5EE38-1"	"Q5EE38-1 [131-145]"	"Q5EE38-1 1xBiotin [K145]"	"1"	"1973.91677"	"1.157"	"2.222"	"0.989369718514603"	"0.906515362333117"	"69.87"	"100.63"	"53.6"	"75.3"	"171.1"	"141.31"	"27.67"	"89.31"	""	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.00131"	"0.006585"	"2.54"	"54.69"
"19167"	"False"	"High"	"[R].FYQMTGETWKLTAGHR.[L]"	"1xBiotin [K10]"	"0.0845831"	"0.00479181"	"1"	"1"	"1"	"Q9QZ49"	"Q9QZ49 [118-133]"	"Q9QZ49 1xBiotin [K127]"	"1"	"2152.01028"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.00131"	"0.00644"	"2.10"	""
"29558"	"False"	"High"	"[K].KSFFWSR.[K]"	""	"0.0923527"	"0.00479181"	"1"	"1"	"6"	"P52019"	"P52019 [450-456]"	""	"1"	"957.49411"	"60.018"	"1.313"	"0.947989303413716"	"0.998556184118602"	"31.02"	"32.80"	"4.5"	"290.2"	"5.3"	"23.34"	"26.56"	"28.96"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001372"	"0.007243"	"1.93"	"37.33"
"50719"	"False"	"High"	"[K].NLPWLFTFNVK.[F]"	""	"0.0962006"	"0.00507177"	"1"	"1"	"2"	"O70318"	"O70318 [278-288]"	""	"0"	"1378.75178"	"44.447"	"1.628"	"0.925138005747468"	"0.954461348772941"	"61.00"	"57.71"	"7.6"	"278.6"	"13.8"	"44.03"	"45.63"	"25.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007632"	"1.61"	"63.80"
"30888"	"False"	"High"	"[K].LAGVTALSCWLPLR.[A]"	"1xCarbamidomethyl [C9]"	"0.0945337"	"0.00507177"	"1"	"2"	"1"	"P97823-1"	"P97823-1 [136-149]"	""	"0"	"1556.86174"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001469"	"0.007479"	"2.24"	""
"23454"	"False"	"High"	"[K].GTWVQLK.[R]"	""	"0.0950864"	"0.00507177"	"1"	"1"	"2"	"O09167"	"O09167 [123-129]"	""	"0"	"831.47231"	"639.912"	"20.771"	"0.772666706291549"	"0.906515362333117"	"43.92"	"133.38"	"0.5"	"288.3"	"11.2"	"50.66"	"46.94"	"97.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.001469"	"0.007496"	"1.56"	"34.50"
"69523"	"False"	"High"	"[K].VTNILMLK.[G]"	"1xOxidation [M6]"	"0.0934373"	"0.00507177"	"1"	"5"	"2"	"P17225"	"P17225 [84-91]"	""	"0"	"947.55942"	"11.109"	"1.059"	"0.925138005747468"	""	"348.39"	"23.87"	"28.3"	"242.3"	"29.4"	"32.98"	"110.84"	"23.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001407"	"0.007359"	"1.51"	"39.94"
"29825"	"False"	"High"	"[R].KSVFDR.[H]"	"1xBiotin [K1]"	"0.0967623"	"0.00507177"	"1"	"1"	"4"	"Q9JJR8"	"Q9JJR8 [189-194]"	"Q9JJR8 1xBiotin [K189]"	"1"	"977.48731"	"0.105"	"1.013"	"0.0116103974908708"	"0.906515362333117"	"35.84"	"29.63"	"141.7"	"14.8"	"143.5"	"20.35"	"41.39"	"36.45"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001501"	"0.007711"	"1.64"	"36.25"
"1706"	"False"	"High"	"[K].AKAVSTGK.[K]"	"1xBiotin [K2]"	"0.0967623"	"0.00507177"	"1"	"1"	"1"	"Q9Z2A7"	"Q9Z2A7 [234-241]"	"Q9Z2A7 1xBiotin [K235]"	"1"	"987.52918"	"0.371"	"0.726"	"0.925138005747468"	"0.906515362333117"	"70.95"	"40.50"	"134.8"	"63.8"	"101.4"	"38.61"	"60.25"	"28.38"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.00766"	"1.36"	"22.00"
"21383"	"False"	"High"	"[R].GIFFSHR.[D]"	""	"0.0934373"	"0.00507177"	"1"	"2"	"3"	"P32921"	"P32921 [139-145]"	""	"0"	"863.45225"	"152.124"	"3.292"	"0.925138005747468"	"0.906515362333117"	"42.78"	"39.79"	"2.0"	"292.9"	"5.2"	"18.62"	"35.93"	"29.94"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001372"	"0.007319"	"1.55"	"31.10"
"66185"	"False"	"High"	"[R].TVPQYKYAAGVR.[N]"	"1xBiotin [K6]"	"0.097327"	"0.00507177"	"1"	"1"	"1"	"P29341"	"P29341 [507-518]"	"P29341 1xBiotin [K512]"	"1"	"1578.80971"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001501"	"0.007775"	"2.17"	""
"71480"	"False"	"High"	"[K].YGLAAAVFTK.[D]"	""	"0.0967623"	"0.00507177"	"1"	"1"	"1"	"P47738"	"P47738 [444-453]"	""	"0"	"1040.57751"	"172.600"	"5.395"	"0.925138005747468"	"0.906515362333117"	"45.24"	"64.30"	"1.8"	"290.3"	"7.9"	"44.88"	"14.52"	"37.90"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007661"	"1.58"	"42.40"
"1075"	"False"	"High"	"[R].AFHMTKDMLPGSYPR.[T]"	"1xBiotin [K6]"	"0.095642"	"0.00507177"	"1"	"1"	"1"	"Q9D6J5"	"Q9D6J5 [29-43]"	"Q9D6J5 1xBiotin [K34]"	"1"	"1976.91796"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001469"	"0.007585"	"3.54"	""
"17970"	"False"	"High"	"[K].FLQFFK.[H]"	""	"0.0939841"	"0.00507177"	"1"	"3"	"5"	"Q8BFY9"	"Q8BFY9 [187-192]"	""	"0"	"829.46069"	"141.380"	"3.388"	"0.925138005747468"	"0.906515362333117"	"48.29"	"42.43"	"2.0"	"291.5"	"6.5"	"53.35"	"29.20"	"22.93"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001441"	"0.007419"	"1.48"	"48.84"
"19042"	"False"	"High"	"[R].FWFNYR.[H]"	""	"0.0962006"	"0.00507177"	"1"	"1"	"3"	"Q9CXY9"	"Q9CXY9 [55-60]"	""	"0"	"932.44135"	"94.017"	"1.791"	"0.952296833469404"	"0.938162963724392"	"42.60"	"42.32"	"3.2"	"291.4"	"5.4"	"28.99"	"62.01"	"48.04"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007605"	"1.35"	"48.32"
"19258"	"False"	"High"	"[R].GADKVNTFSALLLEPYKPPSTQ.[-]"	"1xBiotin [K4]"	"0.0939841"	"0.00507177"	"1"	"1"	"1"	"O54984"	"O54984 [327-348]"	"O54984 1xBiotin [K330]"	"1"	"2602.32215"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001441"	"0.007389"	"2.96"	""
"35684"	"False"	"High"	"[R].IITLTGPTNAIFK.[A]"	""	"0.0962006"	"0.00507177"	"1"	"1"	"1"	"P60335"	"P60335 [58-70]"	""	"0"	"1388.81478"	"49.959"	"1.247"	"0.925138005747468"	"0.906515362333117"	"75.57"	"54.35"	"5.8"	"287.6"	"6.6"	"36.58"	"66.70"	"51.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001469"	"0.007627"	"2.40"	"50.33"
"35657"	"False"	"High"	"[R].LLTGQYR.[D]"	""	"0.0939841"	"0.00507177"	"1"	"1"	"2"	"P47758"	"P47758 [82-88]"	""	"0"	"850.47813"	"108.337"	"2.173"	"0.426189213581087"	"0.998316466510713"	"33.29"	"44.67"	"2.8"	"290.8"	"6.4"	"21.52"	"30.69"	"64.48"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001441"	"0.007402"	"1.64"	"23.89"
"18559"	"False"	"High"	"[K].FRPSFPASSPYVTTVGGTSFK.[N]"	""	"0.0962006"	"0.00507177"	"1"	"1"	"2"	"O89023"	"O89023 [373-393]"	""	"0"	"2233.12879"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001469"	"0.007616"	"2.48"	""
"30572"	"False"	"High"	"[K].KYGLFK.[E]"	"1xBiotin [K1]"	"0.0945337"	"0.00507177"	"1"	"1"	"1"	"Q8R143"	"Q8R143 [161-166]"	"Q8R143 1xBiotin [K161]"	"1"	"981.52264"	"0.379"	"1.192"	"0.925138005747468"	"0.916215054610739"	"46.72"	"53.66"	"125.2"	"45.6"	"129.2"	"36.69"	"42.74"	"43.69"	""	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007471"	"1.62"	"43.72"
"24392"	"False"	"High"	"[K].HKDSKSTWVILHHK.[V]"	"1xBiotin [K5]"	"0.0945337"	"0.00507177"	"1"	"1"	"3"	"P56395"	"P56395 [20-33]"	"P56395 1xBiotin [K24]"	"2"	"1942.01160"	"0.112"	"1.338"	"0.425904733810833"	"0.936688300042187"	"58.63"	"43.73"	"130.9"	"14.4"	"154.7"	"32.37"	"51.92"	"34.85"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007458"	"2.89"	"33.74"
"32003"	"False"	"High"	"[K].LEFAPKAVLNR.[N]"	"1xBiotin [K6]"	"0.0945337"	"0.00507177"	"1"	"1"	"2"	"Q78RX3"	"Q78RX3 [76-86]"	"Q78RX3 1xBiotin [K81]"	"1"	"1483.80898"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001469"	"0.007465"	"1.76"	""
"24362"	"False"	"High"	"[K].HHGPQTLYLPVTLSSIPVFQR.[G]"	""	"0.0950864"	"0.00507177"	"1"	"3"	"2"	"Q8BHN3"	"Q8BHN3 [785-805]"	""	"0"	"2390.29793"	"0.898"	"0.776"	"0.925138005747468"	"0.906515362333117"	"77.73"	"64.70"	"117.3"	"96.9"	"85.8"	"41.04"	"205.75"	"44.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001469"	"0.007488"	"2.32"	"56.54"
"21208"	"False"	"High"	"[R].GKPLFVR.[H]"	""	"0.0962006"	"0.00507177"	"1"	"1"	"7"	"Q9CR68"	"Q9CR68 [171-177]"	""	"0"	"816.50903"	"157.013"	"4.757"	"0.925138005747468"	"0.906515362333117"	"44.88"	"56.18"	"1.8"	"289.1"	"9.1"	"44.73"	"15.58"	"41.03"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.001469"	"0.007624"	"1.68"	"23.45"
"22324"	"False"	"High"	"[R].GPLGPNWK.[QK]"	""	"0.0945337"	"0.00507177"	"2"	"2"	"4"	"P53810; P53811"	"P53810 [172-179]; P53811 [171-178]"	""	"0"	"868.46756"	"232.038"	"8.982"	"0.339573869323658"	"0.906515362333117"	"57.25"	"65.31"	"1.4"	"285.9"	"12.6"	"36.95"	"47.78"	"52.26"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001441"	"0.007444"	"1.91"	"32.60"
"3198"	"False"	"High"	"[K].APLVLKD.[-]"	"1xBiotin [K6]"	"0.0945337"	"0.00507177"	"1"	"1"	"2"	"Q99LX0"	"Q99LX0 [183-189]"	"Q99LX0 1xBiotin [K188]"	"1"	"981.54376"	"0.499"	"1.498"	"0.925138005747468"	"0.971511797192901"	"69.66"	"68.65"	"101.5"	"48.9"	"149.6"	"56.57"	"30.07"	"35.36"	""	"Peak Found"	"Not Found"	"High"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001469"	"0.007483"	"1.82"	"46.24"
"28819"	"False"	"High"	"[R].KPFFSWW.[-]"	""	"0.0939841"	"0.00507177"	"1"	"1"	"3"	"Q2TBE6"	"Q2TBE6 [473-479]"	""	"0"	"997.49305"	"76.620"	"2.053"	"0.998769547666767"	"0.94306020666367"	"35.62"	"40.56"	"3.7"	"288.7"	"7.7"	"39.00"	"15.82"	"33.41"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.001441"	"0.0074"	"2.04"	"60.91"
"1112"	"False"	"High"	"[K].AFMGPLKK.[D]"	"1xOxidation [M3]"	"0.097327"	"0.00507177"	"1"	"1"	"2"	"P27659"	"P27659 [387-394]"	""	"1"	"907.50699"	"307.396"	"3.481"	"0.925138005747468"	"0.906515362333117"	"70.27"	"64.83"	"1.2"	"295.6"	"3.2"	"44.71"	"50.56"	"59.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001501"	"0.007728"	"1.57"	"19.82"
"63872"	"False"	"High"	"[K].TFYILVVR.[S]"	""	"0.0984654"	"0.00536594"	"1"	"3"	"1"	"P06800"	"P06800 [503-510]"	""	"0"	"1010.60333"	"151.871"	"2.665"	"0.433180228049634"	"0.919235111389825"	"38.49"	"35.72"	"1.9"	"293.0"	"5.1"	"30.51"	"26.56"	"40.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001534"	"0.007862"	"1.57"	"50.60"
"19053"	"False"	"High"	"[R].FWMVVK.[E]"	"1xOxidation [M3]"	"0.0990392"	"0.00536594"	"1"	"1"	"1"	"Q922Q1"	"Q922Q1 [92-97]"	""	"0"	"825.43276"	"119.217"	"0.896"	"0.403329629085267"	""	"55.17"	"44.16"	"3.1"	"294.5"	"2.4"	"36.08"	"59.86"	"14.99"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001534"	"0.007945"	"1.49"	"37.67"
"34032"	"False"	"High"	"[R].LLAAGTFTHSYPFCWR.[S]"	"1xCarbamidomethyl [C14]"	"0.0984654"	"0.00536594"	"1"	"1"	"1"	"Q8BU30"	"Q8BU30 [387-402]"	""	"0"	"1926.93195"	"115.997"	"2.289"	"0.427089858136149"	"0.963994276545741"	"47.49"	"76.69"	"2.8"	"290.5"	"6.8"	"41.83"	"42.14"	"59.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.001534"	"0.007882"	"1.69"	"52.45"
"28028"	"False"	"High"	"[R].KLPFQR.[L]"	""	"0.0978947"	"0.00536594"	"1"	"4"	"93"	"P84244"	"P84244 [65-70]"	""	"1"	"788.47773"	"145.975"	"3.016"	"0.925138005747468"	"0.906515362333117"	"55.36"	"69.35"	"2.0"	"291.8"	"6.1"	"57.57"	"52.48"	"59.55"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001501"	"0.007803"	"2.10"	"27.18"
"2002"	"False"	"High"	"[R].ALCCKGPPPARPEYDLVCIGLTGSGK.[T]"	"1xBiotin [K5]; 3xCarbamidomethyl [C3; C4; C18]"	"0.0990392"	"0.00536594"	"1"	"1"	"1"	"Q8BGR6"	"Q8BGR6 [20-45]"	"Q8BGR6 1xBiotin [K24]"	"1"	"3042.46680"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001534"	"0.007915"	"3.62"	""
"34456"	"False"	"High"	"[R].ILFIWAIR.[H]"	""	"0.0990392"	"0.00536594"	"1"	"2"	"2"	"Q8R5A6"	"Q8R5A6 [304-311]"	""	"0"	"1031.64005"	"47.689"	"0.892"	"0.925138005747468"	"0.906515362333117"	"62.33"	"47.39"	"6.8"	"287.2"	"5.9"	"28.76"	"53.73"	"44.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001534"	"0.007912"	"1.65"	"61.34"
"227"	"False"	"High"	"[R].AALSGLLHR.[T]"	""	"0.0990392"	"0.00536594"	"1"	"1"	"1"	"Q99JY0"	"Q99JY0 [83-91]"	""	"0"	"937.55778"	"107.065"	"2.466"	"0.380827439155979"	"0.933662009773179"	"34.60"	"74.05"	"2.7"	"289.6"	"7.7"	"30.01"	"31.45"	"70.52"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001568"	"0.007958"	"2.04"	"33.73"
"20556"	"False"	"High"	"[R].GFWYDAEITTLK.[T]"	""	"0.0990392"	"0.00536594"	"1"	"2"	"8"	"Q7TMI3-1"	"Q7TMI3-1 [262-273]"	""	"0"	"1443.71546"	"0.018"	"0.956"	"2.65079519846029E-05"	"0.907537409695571"	"52.03"	"74.97"	"150.7"	"2.6"	"146.7"	"46.26"	"28.77"	"51.83"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001568"	"0.007947"	"2.16"	"31.25"
"38007"	"False"	"High"	"[K].ISGWFR.[S]"	""	"0.0984654"	"0.00536594"	"1"	"1"	"6"	"Q9JKN1"	"Q9JKN1 [22-27]"	""	"0"	"765.40423"	"137.254"	"3.906"	"0.925138005747468"	"0.906515362333117"	"74.54"	"61.17"	"1.8"	"291.6"	"6.6"	"63.53"	"24.74"	"29.80"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.001534"	"0.007894"	"1.52"	"38.75"
"17299"	"False"	"High"	"[K].FFSAYK.[S]"	""	"0.0990392"	"0.00536594"	"1"	"1"	"1"	"Q9Z103"	"Q9Z103 [85-90]"	""	"0"	"762.38210"	"79.770"	"3.846"	"0.531519546327845"	"0.906515362333117"	"144.19"	"62.11"	"2.9"	"284.9"	"12.2"	"55.78"	"106.66"	"38.74"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001568"	"0.00795"	"1.36"	"30.22"
"67450"	"False"	"High"	"[R].VHIGQVIMSIR.[T]"	"1xOxidation [M8]"	"0.0984654"	"0.00536594"	"1"	"2"	"2"	"P86048"	"P86048 [129-139]"	""	"0"	"1268.71435"	"41.232"	"0.668"	"0.925138005747468"	""	"141.59"	"56.42"	"6.9"	"289.3"	"3.8"	"34.50"	"91.61"	"48.34"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001534"	"0.007851"	"2.36"	"38.41"
"15291"	"False"	"High"	"[R].EQLQQQLK.[R]"	""	"0.0978947"	"0.00536594"	"1"	"2"	"2"	"Q8K1N2"	"Q8K1N2 [698-705]"	""	"0"	"1014.55783"	"46.333"	"0.577"	"0.925138005747468"	"0.906515362333117"	"95.18"	"99.00"	"5.5"	"291.2"	"3.3"	"66.09"	"62.54"	"84.94"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001501"	"0.007784"	"2.16"	"30.96"
"1111"	"False"	"High"	"[K].AFMGPLK.[K]"	""	"0.0990392"	"0.00536594"	"1"	"1"	"2"	"P27659"	"P27659 [387-393]"	""	"0"	"763.41711"	"1.334"	"2.418"	"0.925138005747468"	"0.933091578902049"	"74.18"	"79.32"	"64.0"	"87.5"	"148.5"	"56.07"	"29.97"	"35.27"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001534"	"0.007924"	"1.37"	"34.05"
"71391"	"False"	"High"	"[K].YFWQNFR.[K]"	""	"0.0984654"	"0.00536594"	"1"	"1"	"5"	"P59808"	"P59808 [146-152]"	""	"0"	"1060.49993"	"126.392"	"2.994"	"0.857409145698756"	"0.906515362333117"	"56.20"	"76.86"	"2.6"	"290.5"	"6.9"	"42.42"	"38.78"	"67.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Peak Found"	"High"	"0.001534"	"0.00785"	"1.22"	"50.19"
"18054"	"False"	"High"	"[R].FLTVMMK.[H]"	""	"0.103143"	"0.00564683"	"1"	"1"	"5"	"P62245"	"P62245 [37-43]"	""	"0"	"869.46234"	"9.874"	"4.383"	"0.925138005747468"	"0.906515362333117"	"224.33"	"64.79"	"20.6"	"188.1"	"91.3"	"46.75"	"129.72"	"42.51"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.00166"	"0.008366"	"1.60"	"40.57"
"39093"	"False"	"High"	"[R].LVGIISSR.[D]"	""	"0.102547"	"0.00564683"	"1"	"1"	"2"	"P24547"	"P24547 [154-161]"	""	"0"	"844.52508"	"131.718"	"3.658"	"0.404158525623697"	"0.906515362333117"	"96.85"	"68.44"	"2.0"	"290.5"	"7.5"	"59.99"	"70.01"	"41.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001628"	"0.008308"	"1.66"	"31.85"
"31451"	"False"	"High"	"[R].LCQYKSK.[Y]"	"1xBiotin [K5]; 1xCarbamidomethyl [C2]"	"0.103143"	"0.00564683"	"1"	"1"	"2"	"Q80W37"	"Q80W37 [28-34]"	"Q80W37 1xBiotin [K32]"	"1"	"1152.55401"	"0.827"	"0.724"	"0.945683295219289"	"0.906515362333117"	"54.07"	"64.39"	"119.5"	"102.9"	"77.6"	"55.18"	"31.10"	"50.75"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.00166"	"0.008364"	"1.33"	"27.13"
"21320"	"False"	"High"	"[K].GICFIR.[T]"	"1xCarbamidomethyl [C3]"	"0.103143"	"0.00564683"	"1"	"1"	"13"	"P40142"	"P40142 [466-471]"	""	"0"	"765.40761"	"92.054"	"3.277"	"0.956696724328118"	"0.906515362333117"	"38.30"	"45.57"	"3.3"	"286.5"	"10.2"	"30.90"	"25.83"	"31.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.00166"	"0.008355"	"1.51"	"36.48"
"37954"	"False"	"High"	"[K].LSFMPFFLK.[A]"	""	"0.0996161"	"0.00564683"	"1"	"1"	"4"	"P53395"	"P53395 [305-313]"	""	"0"	"1129.61145"	"1.893"	"1.838"	"0.925138005747468"	"0.945186929151139"	"86.65"	"69.96"	"79.0"	"111.7"	"109.3"	"43.43"	"144.49"	"57.95"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.001603"	"0.007988"	"2.13"	"63.20"
"18954"	"False"	"High"	"[K].FVFSFK.[V]"	""	"0.103143"	"0.00564683"	"1"	"1"	"12"	"P61082"	"P61082 [76-81]"	""	"0"	"774.41849"	"122.264"	"3.729"	"0.925138005747468"	"0.906515362333117"	"62.30"	"65.87"	"2.6"	"288.6"	"8.7"	"48.39"	"54.21"	"38.51"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.00166"	"0.008393"	"1.69"	"46.67"
"23442"	"False"	"High"	"[K].GTVLIKTAEELMNFSK.[G]"	"1xBiotin [K6]; 1xOxidation [M12]"	"0.102547"	"0.00564683"	"1"	"1"	"3"	"P42932"	"P42932 [255-270]"	"P42932 1xBiotin [K260]"	"1"	"2023.02386"	"0.578"	"1.005"	"0.925138005747468"	"0.906515362333117"	"49.48"	"40.59"	"119.7"	"68.9"	"111.4"	"30.41"	"40.70"	"31.50"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.001628"	"0.008298"	"2.78"	"59.15"
"67924"	"False"	"High"	"[K].VIGWYR.[F]"	""	"0.0996161"	"0.00564683"	"1"	"1"	"10"	"Q3TCJ1"	"Q3TCJ1 [91-96]"	""	"0"	"793.43554"	"107.736"	"3.098"	"0.94340856990521"	"0.906515362333117"	"62.39"	"73.64"	"2.7"	"289.8"	"7.6"	"52.34"	"55.31"	"69.50"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001603"	"0.007993"	"1.59"	"36.30"
"49870"	"False"	"High"	"[R].NFAIGYYLK.[E]"	""	"0.101365"	"0.00564683"	"1"	"2"	"5"	"D3Z7P3-1"	"D3Z7P3-1 [393-401]"	""	"0"	"1088.57751"	"93.638"	"2.516"	"0.801950165495267"	"0.935866453494337"	"50.65"	"63.30"	"2.8"	"289.7"	"7.5"	"41.64"	"38.21"	"46.21"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"0.001628"	"0.008158"	"1.88"	"48.44"
"68061"	"False"	"High"	"[R].VIISAPSADAPMFVMGVNHEK.[Y]"	"2xOxidation [M12; M15]"	"0.101955"	"0.00564683"	"1"	"1"	"2"	"P16858"	"P16858 [117-137]"	""	"0"	"2245.09915"	"1.326"	"1.100"	"0.966090293805027"	"0.916215054610739"	"108.41"	"100.59"	"106.3"	"99.2"	"94.5"	"65.70"	"157.04"	"118.04"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001628"	"0.008238"	"2.09"	"40.61"
"19203"	"False"	"High"	"[K].FYYSWK.[K]"	""	"0.100779"	"0.00564683"	"1"	"1"	"7"	"Q8CFE3"	"Q8CFE3 [226-231]"	""	"0"	"893.41922"	"99.843"	"3.567"	"0.944967096116098"	"0.906515362333117"	"60.84"	"61.51"	"3.4"	"285.7"	"10.9"	"44.77"	"45.27"	"44.66"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"0.001628"	"0.008149"	"1.71"	"39.89"
"62138"	"False"	"High"	"[R].SSFSHYSGLK.[H]"	""	"0.101955"	"0.00564683"	"1"	"3"	"1"	"Q9CY58"	"Q9CY58 [202-211]"	""	"0"	"1112.53710"	"1.092"	"1.006"	"0.925138005747468"	"0.906515362333117"	"71.11"	"39.30"	"102.1"	"106.5"	"91.3"	"23.96"	"146.88"	"49.30"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.001628"	"0.008269"	"1.82"	"25.33"
"72748"	"False"	"High"	"[K].YYTPVLAKAVDGYVKPQIK.[Q]"	"1xBiotin [K8]"	"0.100779"	"0.00564683"	"1"	"1"	"2"	"P42230"	"P42230 [682-700]"	"P42230 1xBiotin [K689]"	"1"	"2379.27810"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001628"	"0.008133"	"2.41"	""
"1178"	"False"	"High"	"[K].AFVSTSFHKCGLPAETEWMK.[T]"	"1xBiotin [K9]; 1xCarbamidomethyl [C10]"	"0.101365"	"0.00564683"	"1"	"1"	"1"	"Q8CJF7"	"Q8CJF7 [1257-1276]"	"Q8CJF7 1xBiotin [K1265]"	"1"	"2552.17708"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001628"	"0.008204"	"2.32"	""
"70476"	"False"	"High"	"[R].WLIGGGR.[E]"	""	"0.101365"	"0.00564683"	"1"	"2"	"1"	"Q3UDP0"	"Q3UDP0 [4-10]"	""	"0"	"758.43078"	"94.548"	"0.982"	"0.428134753822885"	""	"65.60"	"69.23"	"4.0"	"292.8"	"3.3"	"47.02"	"41.03"	"47.31"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001628"	"0.008161"	"1.55"	"31.35"
"71490"	"False"	"High"	"[K].YGLNMCR.[Q]"	"1xCarbamidomethyl [C6]; 1xOxidation [M5]"	"0.100779"	"0.00564683"	"1"	"1"	"3"	"P62274"	"P62274 [34-40]"	""	"0"	"929.39678"	"351.569"	"3.139"	"0.925138005747468"	"0.906515362333117"	"39.44"	"52.33"	"0.9"	"296.6"	"2.5"	"27.11"	"32.68"	"89.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001628"	"0.008097"	"1.43"	"20.78"
"32622"	"False"	"High"	"[R].LFSFFSR.[D]"	""	"0.103143"	"0.00564683"	"1"	"1"	"1"	"Q9JJC6"	"Q9JJC6 [359-365]"	""	"0"	"903.47231"	"56.104"	"1.034"	"0.925138005747468"	"0.906515362333117"	"67.16"	"68.37"	"6.0"	"287.1"	"6.9"	"51.56"	"40.02"	"38.02"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00166"	"0.008369"	"1.77"	"51.80"
"35832"	"False"	"High"	"[K].ILWFIPFR.[Q]"	""	"0.101955"	"0.00564683"	"1"	"1"	"4"	"Q9D270"	"Q9D270 [243-250]"	""	"0"	"1091.64005"	"55.884"	"0.976"	"0.69920017797184"	"0.906515362333117"	"32.43"	"18.61"	"5.2"	"289.7"	"5.2"	"7.25"	"31.25"	"26.71"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.001628"	"0.008273"	"1.89"	"64.46"
"21959"	"False"	"High"	"[R].GMLYYR.[M]"	"1xOxidation [M2]"	"0.0996161"	"0.00564683"	"1"	"1"	"12"	"O70145"	"O70145 [78-83]"	""	"0"	"818.38654"	"239.092"	"2.866"	"0.925138005747468"	"0.906515362333117"	"55.09"	"60.02"	"1.1"	"295.8"	"3.1"	"55.48"	"25.84"	"40.03"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001568"	"0.007965"	"1.55"	"23.61"
"31315"	"False"	"High"	"[R].LAYKDLEISR.[K]"	"1xBiotin [K4]"	"0.100779"	"0.00564683"	"1"	"1"	"1"	"Q9D8S3"	"Q9D8S3 [277-286]"	"Q9D8S3 1xBiotin [K280]"	"1"	"1433.74571"	"0.296"	"0.622"	"0.925138005747468"	"0.906515362333117"	"57.00"	"55.99"	"167.4"	"45.6"	"87.0"	"31.62"	"222.94"	"44.15"	""	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001628"	"0.008143"	"1.45"	"45.65"
"47540"	"False"	"High"	"[-].MSETSFNLISEKCDILSILR.[D]"	"1xAcetyl [N-Term]; 1xCarbamidomethyl [C13]"	"0.104949"	"0.00590391"	"1"	"1"	"1"	"Q9CQX0"	"Q9CQX0 [1-20]"	"Q9CQX0 1xAcetyl [N-Term]"	"1"	"2398.19926"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001714"	"0.008587"	"2.45"	""
"47952"	"False"	"High"	"[-].MSPTISHKDSSR.[Q]"	"1xAcetyl [N-Term]; 1xBiotin [K8]"	"0.105557"	"0.00590391"	"1"	"1"	"1"	"Q99J27"	"Q99J27 [1-12]"	"Q99J27 1xAcetyl [N-Term]; 1xBiotin [K8]"	"1"	"1613.74104"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.00864"	"1.83"	""
"45522"	"False"	"High"	"[K].MITGLSKDQQIGEK.[I]"	"1xBiotin [K7]"	"0.106784"	"0.00590391"	"1"	"1"	"2"	"P97310"	"P97310 [463-476]"	"P97310 1xBiotin [K469]"	"1"	"1773.88737"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008752"	"2.61"	""
"21136"	"False"	"High"	"[R].GKGSSGLNLGNFFASR.[K]"	"1xBiotin [K2]"	"0.106784"	"0.00590391"	"1"	"1"	"1"	"P97467"	"P97467 [921-936]"	"P97467 1xBiotin [K922]"	"1"	"1837.90138"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001714"	"0.008756"	"2.62"	""
"26757"	"False"	"High"	"[K].KFMEENEK.[L]"	"1xBiotin [K1]"	"0.107402"	"0.00590391"	"1"	"1"	"1"	"Q61334"	"Q61334 [150-157]"	"Q61334 1xBiotin [K150]"	"1"	"1280.56497"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008846"	"1.76"	""
"27760"	"False"	"High"	"[K].KIGGIFAFK.[V]"	""	"0.106169"	"0.00590391"	"1"	"2"	"7"	"P32020"	"P32020 [454-462]"	""	"1"	"980.59276"	"159.866"	"2.725"	"0.698394517820836"	"0.916215054610739"	"52.07"	"78.93"	"1.8"	"292.1"	"6.1"	"37.05"	"67.98"	"63.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.001714"	"0.008732"	"1.76"	"41.53"
"2996"	"False"	"High"	"[K].ANIIFNTALGTIFGVK.[K]"	""	"0.104949"	"0.00590391"	"1"	"1"	"1"	"Q9R112"	"Q9R112 [225-240]"	""	"0"	"1678.95267"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008562"	"2.52"	""
"20520"	"False"	"High"	"[R].GFSGYNTR.[W]"	""	"0.108024"	"0.00590391"	"1"	"1"	"7"	"Q9DB29"	"Q9DB29 [53-60]"	""	"0"	"901.41626"	"54.287"	"1.103"	"0.945683295219289"	"0.916215054610739"	"50.64"	"31.30"	"5.7"	"288.0"	"6.4"	"27.48"	"35.10"	"24.74"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"0.001714"	"0.0089"	"1.55"	"26.09"
"67865"	"False"	"High"	"[R].VIFFLPWEK.[M]"	""	"0.107402"	"0.00590391"	"1"	"1"	"4"	"Q64521"	"Q64521 [340-348]"	""	"0"	"1178.66084"	"40.462"	"1.622"	"0.925138005747468"	"0.960422171904683"	"43.54"	"36.96"	"6.8"	"282.9"	"10.4"	"35.48"	"22.37"	"20.72"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008824"	"2.00"	"61.74"
"72689"	"False"	"High"	"[R].YYGHWK.[K]"	""	"0.104344"	"0.00590391"	"1"	"1"	"7"	"Q9WV70"	"Q9WV70 [619-624]"	""	"0"	"853.39915"	"92.231"	"3.269"	"0.959544012046536"	"0.906515362333117"	"54.36"	"51.18"	"3.7"	"284.5"	"11.8"	"41.22"	"34.63"	"32.98"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.001714"	"0.0085"	"1.25"	"21.41"
"67460"	"False"	"High"	"[K].VHLVGIDIFTGK.[K]"	""	"0.104344"	"0.00590391"	"1"	"2"	"3"	"P63242"	"P63242 [56-67]"	""	"0"	"1298.74670"	"35.511"	"1.323"	"0.925138005747468"	"0.906515362333117"	"142.69"	"45.24"	"7.9"	"282.7"	"9.4"	"37.14"	"88.45"	"41.67"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008532"	"1.95"	"49.72"
"57440"	"False"	"High"	"[R].RPFEKSR.[L]"	"1xBiotin [K5]"	"0.106169"	"0.00590391"	"1"	"1"	"1"	"Q6ZWN5"	"Q6ZWN5 [18-24]"	"Q6ZWN5 1xBiotin [K22]"	"1"	"1145.58842"	"0.529"	"0.702"	"0.925138005747468"	"0.906515362333117"	"90.60"	"102.78"	"133.3"	"68.4"	"98.3"	"83.76"	"56.34"	"30.77"	""	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.00871"	"2.62"	"26.64"
"24502"	"False"	"High"	"[R].HIFLIR.[H]"	""	"0.103742"	"0.00590391"	"1"	"2"	"2"	"Q8BX10-1"	"Q8BX10-1 [98-103]"	""	"0"	"798.49847"	"163.118"	"3.987"	"0.925138005747468"	"0.906515362333117"	"54.52"	"56.74"	"1.7"	"291.7"	"6.6"	"79.30"	"25.09"	"36.58"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00166"	"0.008419"	"1.60"	"35.04"
"19034"	"False"	"High"	"[K].FWAYAFVLSK.[A]"	""	"0.108024"	"0.00590391"	"1"	"1"	"1"	"Q920L5"	"Q920L5 [111-120]"	""	"0"	"1231.65101"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008906"	"1.68"	""
"69980"	"False"	"High"	"[R].VYGALMWSLGK.[VI]"	""	"0.104949"	"0.00590391"	"2"	"3"	"2"	"Q9EQP2; Q9QXY6"	"Q9EQP2 [235-245]; Q9QXY6 [232-242]"	""	"0"	"1224.64454"	"2.376"	"2.612"	"0.997258123671644"	"0.913702580837398"	"92.15"	"67.80"	"74.8"	"102.1"	"123.1"	"51.60"	"143.81"	"56.51"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"0.001714"	"0.008589"	"1.44"	"52.55"
"27870"	"False"	"High"	"[K].KILGYIK.[S]"	""	"0.108024"	"0.00590391"	"1"	"1"	"1"	"P47738"	"P47738 [371-377]"	""	"1"	"834.54475"	"241.678"	"1.251"	"0.925138005747468"	""	"140.82"	"82.56"	"1.0"	"297.4"	"1.6"	"63.16"	"57.01"	"33.98"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008954"	"1.82"	"28.40"
"52937"	"False"	"High"	"[R].QEPSDSPMFIINR.[K]"	"1xOxidation [M8]"	"0.103742"	"0.00590391"	"1"	"2"	"1"	"Q61495"	"Q61495 [201-213]"	""	"0"	"1549.73152"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008463"	"1.63"	""
"23727"	"False"	"High"	"[K].GWMDWAAHK.[L]"	""	"0.108024"	"0.00590391"	"1"	"2"	"1"	"Q9QYG0"	"Q9QYG0 [177-185]"	""	"0"	"1101.49346"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001714"	"0.008904"	"1.58"	""
"3225"	"False"	"High"	"[R].APPNATLEHFYQTSGKQPK.[Q]"	"1xBiotin [K16]"	"0.104344"	"0.00590391"	"1"	"1"	"3"	"Q924Z4"	"Q924Z4 [78-96]"	"Q924Z4 1xBiotin [K93]"	"1"	"2340.14413"	"0.794"	"0.975"	"0.926348515180336"	"0.906515362333117"	"59.11"	"77.99"	"111.9"	"88.1"	"100.0"	"46.18"	"47.13"	"58.13"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001714"	"0.008529"	"2.56"	"42.06"
"19067"	"False"	"High"	"[R].FYAFGR.[V]"	""	"0.107402"	"0.00590391"	"1"	"1"	"30"	"P58252"	"P58252 [410-415]"	""	"0"	"760.37769"	"122.514"	"2.571"	"0.925138005747468"	"0.906515362333117"	"61.46"	"51.21"	"2.4"	"291.6"	"6.1"	"56.90"	"36.54"	"29.93"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"0.001714"	"0.008832"	"1.57"	"35.38"
"63985"	"False"	"High"	"[R].TGLIKGSGTAEVELK.[K]"	"1xBiotin [K5]"	"0.106784"	"0.00590391"	"1"	"2"	"3"	"P52480"	"P52480 [121-135]"	"P52480 1xBiotin [K125]"	"1"	"1728.92005"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001714"	"0.008805"	"3.14"	""
"72756"	"False"	"High"	"[R].YYYQGCASWK.[W]"	"1xCarbamidomethyl [C6]"	"0.106169"	"0.00590391"	"1"	"2"	"3"	"Q9DBR1"	"Q9DBR1 [552-561]"	""	"0"	"1325.56193"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"High"	"0.001714"	"0.008687"	"1.99"	""
"55705"	"False"	"High"	"[K].QYAGTGALKTDFTR.[T]"	"1xBiotin [K9]"	"0.103742"	"0.00590391"	"1"	"1"	"2"	"Q9EP69"	"Q9EP69 [448-461]"	"Q9EP69 1xBiotin [K456]"	"1"	"1754.85303"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.00166"	"0.00843"	"2.68"	""
"14277"	"False"	"High"	"[K].EMFGGFFKSVVK.[S]"	"1xBiotin [K8]; 1xOxidation [M2]"	"0.108024"	"0.00590391"	"1"	"1"	"2"	"Q9D8U8"	"Q9D8U8 [181-192]"	"Q9D8U8 1xBiotin [K188]"	"1"	"1617.78038"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001714"	"0.008903"	"2.00"	""
"57108"	"False"	"High"	"[R].RLQTQVFK.[L]"	""	"0.105557"	"0.00590391"	"1"	"1"	"3"	"Q6ZWN5"	"Q6ZWN5 [109-116]"	""	"1"	"1019.59964"	"163.805"	"5.717"	"0.925138005747468"	"0.906515362333117"	"126.77"	"92.57"	"1.3"	"290.9"	"7.8"	"72.65"	"60.75"	"38.28"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001714"	"0.008639"	"2.22"	"23.45"
"9583"	"False"	"High"	"[K].DSSGWSSSKDKDAYSSFGSR.[G]"	"1xBiotin [K9]"	"0.106169"	"0.00590391"	"1"	"1"	"1"	"Q62167"	"Q62167 [56-75]"	"Q62167 1xBiotin [K64]"	"2"	"2380.01463"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001714"	"0.008711"	"2.02"	""
"9537"	"False"	"High"	"[RK].DSPSNKLLYAK.[ED]"	"1xBiotin [K6]"	"0.104949"	"0.00590391"	"1"	"6"	"1"	"P70206"	"P70206 [1792-1802]"	"P70206 1xBiotin [K1797]"	"1"	"1461.74063"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001714"	"0.008567"	"1.91"	""
"30032"	"False"	"High"	"[K].KTPVAPGPPSHFSPNKLPTFGAPGQSLDSK.[A]"	"1xBiotin [K16]"	"0.106784"	"0.00590391"	"1"	"1"	"2"	"Q61510"	"Q61510 [392-421]"	"Q61510 1xBiotin [K407]"	"2"	"3285.67249"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"High"	"0.001714"	"0.008789"	"3.02"	""
"36859"	"False"	"High"	"[K].LPPPKPLPGTLK.[R]"	"1xBiotin [K5]"	"0.105557"	"0.00590391"	"1"	"1"	"2"	"O35598"	"O35598 [711-722]"	"O35598 1xBiotin [K715]"	"0"	"1483.87052"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"High"	"0.001714"	"0.008675"	"2.03"	""
"36464"	"False"	"High"	"[R].LNQYFQK.[E]"	""	"0.104949"	"0.00590391"	"1"	"2"	"3"	"O70133"	"O70133 [187-193]"	""	"0"	"940.48869"	"103.077"	"2.694"	"0.521973927803249"	"0.91398852688127"	"75.92"	"58.58"	"2.7"	"290.0"	"7.3"	"36.19"	"71.81"	"39.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001714"	"0.008569"	"2.19"	"26.19"
"35389"	"False"	"High"	"[K].LIQSPTTHKNHSESLILEAEK.[N]"	"1xBiotin [K9]"	"0.104344"	"0.00590391"	"1"	"1"	"1"	"Q8C398"	"Q8C398 [412-432]"	"Q8C398 1xBiotin [K420]"	"1"	"2601.33411"	"0.990"	"0.878"	"0.925138005747468"	"0.906515362333117"	"92.73"	"82.25"	"108.2"	"107.2"	"84.6"	"66.54"	"39.47"	"44.11"	""	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.001714"	"0.008489"	"2.61"	"39.60"
"1157"	"False"	"High"	"[K].AFSQFVRPLIAAK.[N]"	""	"0.11574"	"0.00646271"	"1"	"1"	"1"	"Q6PDQ2"	"Q6PDQ2 [173-185]"	""	"0"	"1447.84200"	"49.242"	"1.050"	"0.925138005747468"	"0.906515362333117"	"36.03"	"60.17"	"5.6"	"288.4"	"6.1"	"22.05"	"53.38"	"43.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001795"	"0.009794"	"2.17"	"44.94"
"20645"	"False"	"High"	"[K].GGFLYLNR.[V]"	""	"0.115079"	"0.00646271"	"1"	"2"	"1"	"Q9Z277"	"Q9Z277 [647-654]"	""	"0"	"939.50468"	"151.462"	"2.450"	"0.434853540501642"	"0.937500052802293"	"62.91"	"90.04"	"1.8"	"294.1"	"4.1"	"37.27"	"54.96"	"110.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001795"	"0.009771"	"1.80"	"41.15"
"21610"	"False"	"High"	"[R].GLPFGCTK.[E]"	"1xCarbamidomethyl [C6]"	"0.109908"	"0.00646271"	"1"	"2"	"2"	"Q9Z2X1-1"	"Q9Z2X1-1 [117-124]"	""	"0"	"879.43930"	"120.932"	"4.001"	"0.824226193796321"	"0.906515362333117"	"72.53"	"78.98"	"2.1"	"288.0"	"9.9"	"68.01"	"39.11"	"45.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"0.001767"	"0.009114"	"1.29"	"32.05"
"22987"	"False"	"High"	"[R].GSKVHFVPGWDCHGLPIETK.[V]"	"1xBiotin [K3]; 1xCarbamidomethyl [C12]"	"0.11442"	"0.00646271"	"1"	"1"	"1"	"Q8BIJ6"	"Q8BIJ6 [144-163]"	"Q8BIJ6 1xBiotin [K146]"	"1"	"2490.20568"	"0.700"	"1.355"	"0.925138005747468"	"0.916215054610739"	"41.91"	"61.83"	"90.7"	"65.1"	"144.3"	"21.16"	"40.13"	"51.46"	""	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001795"	"0.009698"	"2.47"	"47.91"
"25190"	"False"	"High"	"[K].HTAMVSWGGVSIPNSPFR.[V]"	""	"0.113766"	"0.00646271"	"1"	"1"	"3"	"Q8BTM8"	"Q8BTM8 [743-760]"	""	"0"	"1942.95923"	"1.311"	"1.395"	"0.982626859977453"	"0.906515362333117"	"95.48"	"55.18"	"89.4"	"84.5"	"126.1"	"38.42"	"150.91"	"53.36"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"0.001795"	"0.009605"	"3.45"	"51.61"
"23589"	"False"	"High"	"[K].GVINMGSYNYLGFAR.[N]"	"1xOxidation [M5]"	"0.110542"	"0.00646271"	"1"	"1"	"2"	"P97363"	"P97363 [167-181]"	""	"0"	"1677.80535"	"4.553"	"0.943"	"0.949662611758987"	""	"153.14"	"47.41"	"46.2"	"202.9"	"50.9"	"31.42"	"118.57"	"41.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001767"	"0.009185"	"2.12"	"47.63"
"20500"	"False"	"High"	"[K].GFPTWLK.[L]"	""	"0.11442"	"0.00646271"	"1"	"1"	"9"	"P26040"	"P26040 [54-60]"	""	"0"	"848.46650"	"164.240"	"5.486"	"0.925138005747468"	"0.906515362333117"	"84.46"	"74.42"	"2.1"	"288.1"	"9.8"	"57.68"	"79.11"	"64.36"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.001795"	"0.009645"	"1.17"	"46.12"
"26996"	"False"	"High"	"[K].KGIAFPTSISVNNCVCHFSPLK.[S]"	"2xCarbamidomethyl [C14; C16]"	"0.113114"	"0.00646271"	"1"	"2"	"1"	"P50580"	"P50580 [72-93]"	""	"1"	"2476.24755"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001767"	"0.009509"	"2.94"	""
"32091"	"False"	"High"	"[R].LEKPAK.[Y]"	"1xBiotin [K3]"	"0.109276"	"0.00646271"	"1"	"1"	"2"	"P16858"	"P16858 [247-252]"	"P16858 1xBiotin [K249]"	"0"	"911.50190"	"0.170"	"0.770"	"0.925138005747468"	"0.906515362333117"	"47.14"	"42.92"	"157.5"	"27.9"	"114.6"	"25.45"	"42.86"	"31.20"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009035"	"1.63"	"27.56"
"4707"	"False"	"High"	"[R].AYQFAGR.[S]"	""	"0.111822"	"0.00646271"	"1"	"1"	"3"	"Q9CRD2"	"Q9CRD2 [267-273]"	""	"0"	"812.40496"	"90.620"	"1.405"	"0.441437074255845"	"0.906515362333117"	"39.82"	"57.82"	"3.4"	"292.2"	"4.4"	"32.25"	"31.08"	"52.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.001767"	"0.009383"	"1.53"	"23.75"
"16225"	"False"	"High"	"[R].ETMVSKMLDR.[L]"	"1xBiotin [K6]; 1xOxidation [M3]"	"0.109276"	"0.00646271"	"1"	"1"	"1"	"Q9QZL0"	"Q9QZL0 [337-346]"	"Q9QZL0 1xBiotin [K342]"	"1"	"1451.66912"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001767"	"0.009037"	"2.57"	""
"18463"	"False"	"High"	"[K].FQHILR.[V]"	""	"0.111822"	"0.00646271"	"1"	"1"	"3"	"P62270"	"P62270 [9-14]"	""	"0"	"813.47298"	"275.796"	"1.705"	"0.925138005747468"	"0.998099211977233"	"44.01"	"96.00"	"1.2"	"297.0"	"1.8"	"19.85"	"36.66"	"86.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001767"	"0.00937"	"1.24"	"23.04"
"18428"	"False"	"High"	"[R].FPVFMGR.[V]"	"1xOxidation [M5]"	"0.111822"	"0.00646271"	"1"	"1"	"1"	"P97290"	"P97290 [492-498]"	""	"0"	"869.43382"	"16.576"	"1.076"	"0.864404439444444"	""	"295.85"	"68.16"	"20.6"	"257.8"	"21.6"	"55.47"	"154.98"	"28.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001767"	"0.009337"	"1.52"	"36.04"
"18090"	"False"	"High"	"[K].FLWMVR.[I]"	"1xOxidation [M4]"	"0.11574"	"0.00646271"	"2"	"2"	"6"	"P46978; Q3TDQ1"	"P46978 [596-601]; Q3TDQ1 [672-677]"	""	"0"	"867.45456"	"319.947"	"5.408"	"0.925138005747468"	"0.906515362333117"	"63.29"	"67.48"	"0.8"	"294.3"	"4.8"	"61.96"	"26.67"	"15.71"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.001795"	"0.009793"	"1.26"	"44.99"
"56574"	"False"	"High"	"[R].RGQPLLVFR.[A]"	""	"0.113766"	"0.00646271"	"1"	"1"	"2"	"Q61753"	"Q61753 [461-469]"	""	"1"	"1085.65782"	"217.056"	"4.386"	"0.434853540501642"	"0.906515362333117"	"58.39"	"59.30"	"1.3"	"292.6"	"6.1"	"45.10"	"44.59"	"42.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001795"	"0.009588"	"2.12"	"37.68"
"34864"	"False"	"High"	"[R].LLLGGGSYK.[C]"	""	"0.110542"	"0.00646271"	"1"	"1"	"3"	"P70338"	"P70338 [249-257]"	""	"0"	"907.52474"	"134.487"	"3.114"	"0.925138005747468"	"0.906515362333117"	"52.89"	"38.67"	"2.4"	"290.3"	"7.3"	"28.54"	"40.87"	"27.49"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009235"	"2.20"	"38.14"
"9926"	"False"	"High"	"[K].DVLGPSTVVANSDEPQHLTPGKMSQR.[Q]"	"1xBiotin [K22]; 1xOxidation [M23]"	"0.11574"	"0.00646271"	"1"	"1"	"1"	"B9EJ86"	"B9EJ86 [21-46]"	"B9EJ86 1xBiotin [K42]"	"1"	"3005.44553"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001795"	"0.009796"	"3.48"	""
"10317"	"False"	"High"	"[R].EAEESSKIR.[A]"	"1xBiotin [K7]"	"0.110542"	"0.00646271"	"1"	"1"	"6"	"Q9DBG7"	"Q9DBG7 [123-131]"	"Q9DBG7 1xBiotin [K129]"	"1"	"1274.60453"	"0.059"	"0.718"	"0.000253234510193949"	"0.906515362333117"	"40.54"	"28.17"	"171.3"	"10.1"	"118.6"	"26.49"	"35.99"	"14.58"	""	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.001767"	"0.009194"	"2.93"	"28.46"
"58398"	"False"	"High"	"[R].RYFLLR.[A]"	""	"0.111822"	"0.00646271"	"1"	"1"	"5"	"Q8R5A3"	"Q8R5A3 [333-338]"	""	"1"	"867.51993"	"82.293"	"1.704"	"0.989440770281069"	"0.969054191468458"	"72.29"	"94.34"	"4.2"	"287.1"	"8.8"	"47.04"	"57.83"	"102.61"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009358"	"2.05"	"36.00"
"4569"	"False"	"High"	"[R].AVTIFIR.[G]"	""	"0.109276"	"0.00646271"	"1"	"1"	"2"	"P80316"	"P80316 [382-388]"	""	"0"	"819.50870"	"182.697"	"3.837"	"0.334285145275372"	"0.906515362333117"	"68.59"	"79.75"	"2.0"	"292.0"	"6.0"	"51.26"	"53.84"	"87.87"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009067"	"1.78"	"40.02"
"39685"	"False"	"High"	"[R].IYNSFR.[E]"	""	"0.109276"	"0.00646271"	"1"	"1"	"7"	"Q99LC3"	"Q99LC3 [327-332]"	""	"0"	"799.40971"	"81.981"	"2.567"	"0.999765140504802"	"0.916215054610739"	"77.37"	"61.56"	"4.3"	"282.6"	"13.1"	"54.94"	"52.54"	"31.19"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.001767"	"0.009084"	"1.73"	"24.72"
"42274"	"False"	"High"	"[-].MDVEEVK.[A]"	"1xBiotin [K7]; 1xOxidation [M1]"	"0.112466"	"0.00646271"	"1"	"1"	"1"	"P97358"	"P97358 [1-7]"	"P97358 1xBiotin [K7]"	"0"	"1091.47476"	"26.317"	"0.656"	"0.925138005747468"	"0.906515362333117"	"55.38"	"46.26"	"10.4"	"282.0"	"7.6"	"28.47"	"55.91"	"34.25"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009443"	"1.56"	"30.01"
"43237"	"False"	"High"	"[R].MFGGSGTSSRPSSNR.[S]"	""	"0.110542"	"0.00646271"	"1"	"1"	"2"	"P20152"	"P20152 [14-28]"	""	"0"	"1527.69686"	"1.025"	"3.742"	"0.987000067345905"	"0.906515362333117"	"58.00"	"74.55"	"57.1"	"48.4"	"194.5"	"32.18"	"220.70"	"58.75"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009245"	"2.51"	"17.90"
"66006"	"False"	"High"	"[R].TTVQKSDHPS.[-]"	"1xBiotin [K5]"	"0.11574"	"0.00646271"	"1"	"1"	"3"	"O88736"	"O88736 [325-334]"	"O88736 1xBiotin [K329]"	"1"	"1325.61543"	"1.662"	"2.331"	"0.935694807094878"	"0.910227350242735"	"64.95"	"72.36"	"61.7"	"103.7"	"134.6"	"102.72"	"32.10"	"58.69"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001795"	"0.009798"	"1.91"	"24.76"
"67108"	"False"	"High"	"[R].VFFYNPTTR.[L]"	""	"0.108648"	"0.00646271"	"1"	"3"	"6"	"Q8CGF7-1"	"Q8CGF7-1 [546-554]"	""	"0"	"1144.57857"	"148.946"	"5.789"	"0.925138005747468"	"0.906515362333117"	"109.69"	"89.71"	"1.9"	"286.7"	"11.4"	"112.95"	"46.43"	"41.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.001767"	"0.009012"	"2.11"	"41.26"
"46416"	"False"	"High"	"[K].MPESVPLEFIPAKGLLGR.[Q]"	"1xBiotin [K13]; 1xOxidation [M1]"	"0.11574"	"0.00646271"	"1"	"1"	"1"	"Q8BHY2"	"Q8BHY2 [487-504]"	"Q8BHY2 1xBiotin [K499]"	"1"	"2196.15554"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001795"	"0.009841"	"2.21"	""
"32720"	"False"	"High"	"[K].LGAKGK.[E]"	"1xBiotin [K]"	"0.113766"	"0.00646271"	"1"	"1"	"12"	"Q5XJY5"	"Q5XJY5 [228-233]"	"Q5XJY5 1xBiotin [K]"	"1"	"799.44947"	"0.042"	"0.798"	"0.000127034037165597"	"0.906515362333117"	"106.67"	"41.49"	"177.4"	"6.6"	"115.9"	"25.05"	"180.99"	"34.63"	""	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001795"	"0.009609"	"1.65"	"22.92"
"58157"	"False"	"High"	"[K].RTQFWR.[Y]"	""	"0.110542"	"0.00646271"	"1"	"1"	"8"	"P51881"	"P51881 [106-111]"	""	"1"	"893.47405"	"114.694"	"2.660"	"0.925138005747468"	"0.906515362333117"	"48.25"	"54.04"	"2.5"	"291.3"	"6.2"	"34.19"	"32.44"	"44.28"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"0.001767"	"0.009211"	"1.98"	"25.97"
"50243"	"False"	"High"	"[R].NKDQLK.[L]"	"1xBiotin [K2]"	"0.113766"	"0.00646271"	"1"	"1"	"1"	"Q9D8U6"	"Q9D8U6 [34-39]"	"Q9D8U6 1xBiotin [K35]"	"1"	"971.49788"	"0.028"	"0.783"	"5.27084136617551E-05"	"0.906515362333117"	"24.43"	"13.87"	"165.0"	"4.2"	"130.8"	"15.45"	"18.47"	"9.59"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001795"	"0.009612"	"2.50"	"26.24"
"16939"	"False"	"High"	"[K].FAQLQYLWK.[V]"	""	"0.11574"	"0.00646271"	"1"	"1"	"1"	"Q8C6U2"	"Q8C6U2 [130-138]"	""	"0"	"1196.64626"	"1.238"	"1.179"	"0.998769547666767"	"0.906515362333117"	"58.27"	"47.22"	"89.0"	"107.3"	"103.7"	"28.61"	"224.02"	"36.60"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001828"	"0.009857"	"2.45"	"51.32"
"2808"	"False"	"High"	"[R].AMGVGWWVR.[N]"	"1xOxidation [M2]"	"0.113766"	"0.00646271"	"1"	"1"	"2"	"Q6PNC0"	"Q6PNC0 [1603-1611]"	""	"0"	"1077.52985"	"67.831"	"1.262"	"0.790750276745078"	"0.906515362333117"	"43.19"	"61.07"	"4.8"	"289.3"	"5.9"	"49.27"	"23.38"	"39.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.001767"	"0.009575"	"1.62"	"44.57"
"70130"	"False"	"High"	"[R].WAYYLR.[Q]"	""	"0.111822"	"0.00646271"	"1"	"2"	"2"	"O88879-1"	"O88879-1 [338-343]"	""	"0"	"871.44610"	"128.347"	"4.579"	"0.925138005747468"	"0.906515362333117"	"80.62"	"66.38"	"2.3"	"289.3"	"8.4"	"50.73"	"58.10"	"40.71"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001767"	"0.009355"	"1.58"	"40.37"
"63084"	"False"	"High"	"[R].SYKPVYWSPSSR.[T]"	""	"0.117074"	"0.00675666"	"1"	"1"	"1"	"Q8BIJ6"	"Q8BIJ6 [239-250]"	""	"0"	"1456.72194"	"137.553"	"3.650"	"0.382153176583616"	"0.906515362333117"	"44.58"	"44.01"	"1.9"	"291.1"	"6.9"	"39.49"	"20.89"	"20.83"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001892"	"0.00999"	"2.17"	"33.14"
"18804"	"False"	"High"	"[K].FSWHVIK.[Q]"	""	"0.116405"	"0.00675666"	"1"	"2"	"1"	"P47791"	"P47791 [116-122]"	""	"0"	"916.50395"	"114.702"	"3.272"	"0.452844787848141"	"0.906515362333117"	"41.03"	"50.45"	"2.7"	"289.5"	"7.8"	"28.51"	"40.40"	"42.22"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001828"	"0.009867"	"1.63"	"37.58"
"45517"	"False"	"High"	"[K].MLTFLMLVR.[L]"	""	"0.116405"	"0.00675666"	"1"	"1"	"3"	"Q6ZQ38"	"Q6ZQ38 [1121-1129]"	""	"0"	"1123.63662"	"52.260"	"3.932"	"0.635812728928775"	"0.906515362333117"	"43.61"	"44.83"	"5.4"	"276.8"	"17.7"	"30.60"	"55.83"	"31.18"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001828"	"0.009877"	"1.84"	"62.48"
"23333"	"False"	"High"	"[K].GTLGGMFGMLK.[G]"	""	"0.117746"	"0.00675666"	"1"	"1"	"2"	"Q9DBG7"	"Q9DBG7 [313-323]"	""	"0"	"1111.56385"	"1.172"	"1.125"	"0.925138005747468"	"0.906515362333117"	"96.08"	"55.72"	"100.7"	"97.9"	"101.3"	"37.30"	"164.14"	"37.16"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"0.001892"	"0.01008"	"1.99"	"52.89"
"23443"	"False"	"High"	"[R].GTVLLSGPR.[K]"	""	"0.116405"	"0.00675666"	"1"	"1"	"3"	"P35980"	"P35980 [135-143]"	""	"0"	"899.53089"	"138.527"	"2.175"	"0.430383505746853"	"0.984757285686748"	"50.84"	"81.27"	"2.4"	"292.4"	"5.2"	"37.24"	"31.59"	"71.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001828"	"0.009902"	"1.42"	"29.42"
"39771"	"False"	"High"	"[R].IYYWYWR.[R]"	""	"0.116405"	"0.00675666"	"1"	"1"	"2"	"Q8R2Y0-1"	"Q8R2Y0-1 [37-43]"	""	"0"	"1149.55163"	"48.479"	"0.696"	"0.532649343107428"	"0.906515362333117"	"49.13"	"63.04"	"6.3"	"289.3"	"4.4"	"49.14"	"35.47"	"49.46"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001828"	"0.00989"	"1.72"	"52.97"
"18950"	"False"	"High"	"[K].FVFDVFQFAK.[N]"	""	"0.117074"	"0.00675666"	"1"	"2"	"1"	"Q3TW96-1"	"Q3TW96-1 [384-393]"	""	"0"	"1247.64592"	"80.421"	"0.920"	"0.461454191032477"	""	"49.95"	"55.21"	"3.7"	"292.3"	"4.0"	"40.47"	"20.48"	"47.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001861"	"0.009937"	"1.29"	"62.17"
"37481"	"False"	"High"	"[R].IQTLENALELQK.[R]"	""	"0.119101"	"0.00703207"	"1"	"2"	"3"	"Q0KK56"	"Q0KK56 [105-116]"	""	"0"	"1399.77912"	"66.673"	"0.494"	"0.982626859977453"	"0.906515362333117"	"123.97"	"124.56"	"4.3"	"293.6"	"2.0"	"112.55"	"90.43"	"109.01"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.001915"	"0.01025"	"2.49"	"40.59"
"36537"	"False"	"High"	"[K].LNWKPR.[V]"	""	"0.119783"	"0.00703207"	"1"	"1"	"5"	"Q8K0C9"	"Q8K0C9 [343-348]"	""	"0"	"813.47298"	"177.626"	"4.997"	"0.925138005747468"	"0.906515362333117"	"54.35"	"61.29"	"1.8"	"289.7"	"8.4"	"50.36"	"36.66"	"38.04"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001915"	"0.01029"	"1.56"	"23.04"
"43283"	"False"	"High"	"[K].MFIGGLSWDTTKK.[D]"	"1xOxidation [M1]"	"0.119783"	"0.00703207"	"1"	"4"	"2"	"Q60668-1"	"Q60668-1 [99-111]"	""	"1"	"1499.75628"	"78.961"	"0.926"	"0.473701528498292"	"0.906515362333117"	"63.52"	"80.93"	"4.2"	"292.4"	"3.4"	"40.64"	"50.22"	"65.59"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01032"	"2.15"	"41.84"
"17288"	"False"	"High"	"[R].FFPLEAWQIGKK.[G]"	"1xBiotin [K11]"	"0.120469"	"0.00703207"	"1"	"1"	"1"	"O35215"	"O35215 [100-111]"	"O35215 1xBiotin [K110]"	"1"	"1689.88215"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01038"	"1.82"	""
"1060"	"False"	"High"	"[K].AFFSPFR.[I]"	""	"0.119783"	"0.00703207"	"1"	"1"	"4"	"Q3UQ28"	"Q3UQ28 [1098-1104]"	""	"0"	"871.44610"	"91.510"	"3.440"	"0.478765405428235"	"0.906515362333117"	"45.88"	"54.86"	"3.3"	"286.1"	"10.7"	"36.13"	"23.30"	"54.73"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001915"	"0.01034"	"1.72"	"46.62"
"28203"	"False"	"High"	"[R].KITYYR.[E]"	""	"0.118422"	"0.00703207"	"1"	"1"	"8"	"P23116"	"P23116 [803-808]"	""	"1"	"843.47231"	"133.316"	"3.440"	"0.925138005747468"	"0.906515362333117"	"55.66"	"109.34"	"2.2"	"290.6"	"7.2"	"39.80"	"53.95"	"93.99"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.001915"	"0.01015"	"1.69"	"17.93"
"43625"	"False"	"High"	"[R].MGFFLSLK.[Q]"	"1xOxidation [M1]"	"0.120469"	"0.00703207"	"1"	"1"	"2"	"Q9D2V5"	"Q9D2V5 [75-82]"	""	"0"	"958.50665"	"64.415"	"1.496"	"0.925138005747468"	""	"98.47"	"45.46"	"4.2"	"289.3"	"6.5"	"41.91"	"73.67"	"27.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01039"	"1.42"	"49.85"
"32440"	"False"	"High"	"[R].LFGFVLR.[T]"	""	"0.120469"	"0.00703207"	"1"	"1"	"5"	"Q8K3H0"	"Q8K3H0 [582-588]"	""	"0"	"851.51379"	"222.680"	"4.610"	"0.235451120482585"	"0.906515362333117"	"79.47"	"113.14"	"1.5"	"289.1"	"9.4"	"58.07"	"64.69"	"92.84"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001915"	"0.0104"	"1.37"	"53.70"
"69138"	"False"	"High"	"[R].VSDHAAAMNKR.[I]"	"1xBiotin [K10]"	"0.118422"	"0.00703207"	"1"	"1"	"1"	"Q8BGD6"	"Q8BGD6 [56-66]"	"Q8BGD6 1xBiotin [K65]"	"1"	"1425.67256"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01012"	"2.21"	""
"70524"	"False"	"High"	"[R].WLVFFHFGK.[N]"	""	"0.119783"	"0.00703207"	"1"	"1"	"1"	"Q9DC23"	"Q9DC23 [367-375]"	""	"0"	"1180.63021"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01028"	"1.65"	""
"70640"	"False"	"High"	"[K].WPYWFK.[K]"	""	"0.118422"	"0.00703207"	"1"	"1"	"7"	"Q6P5D8"	"Q6P5D8 [772-777]"	""	"0"	"926.45594"	"115.341"	"2.816"	"0.938080087920557"	"0.906515362333117"	"56.75"	"67.31"	"2.8"	"291.0"	"6.2"	"50.39"	"23.97"	"44.02"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001915"	"0.01017"	"1.61"	"52.94"
"62964"	"False"	"High"	"[K].SVTAFFTWLR.[E]"	""	"0.119101"	"0.00703207"	"1"	"4"	"1"	"Q80XI3-1"	"Q80XI3-1 [1561-1570]"	""	"0"	"1227.65207"	"33.065"	"1.095"	"0.925138005747468"	"0.906515362333117"	"72.85"	"59.14"	"9.1"	"281.8"	"9.1"	"47.00"	"62.01"	"34.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01022"	"1.98"	"61.94"
"61711"	"False"	"High"	"[R].SQHKGIQLYDTPYEPEGQSVDSDSESTVSLR.[L]"	"1xBiotin [K4]"	"0.118422"	"0.00703207"	"1"	"2"	"4"	"Q6PD21"	"Q6PD21 [283-313]"	"Q6PD21 1xBiotin [K286]"	"1"	"3678.68642"	"1.065"	"2.179"	""	"0.937945192250145"	"49.38"	"36.29"	"72.1"	"74.9"	"153.0"	"24.21"	"39.53"	"41.55"	""	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"High"	"0.001915"	"0.01014"	"3.80"	"46.67"
"35850"	"False"	"High"	"[K].LLYFNMR.[G]"	""	"0.119101"	"0.00703207"	"1"	"1"	"3"	"Q9JHF7"	"Q9JHF7 [6-12]"	""	"0"	"956.50223"	"38.531"	"3.374"	"0.585226218463654"	"0.906515362333117"	"145.87"	"54.62"	"7.0"	"269.3"	"23.7"	"52.82"	"107.03"	"20.72"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001915"	"0.01022"	"1.97"	"45.88"
"1864"	"False"	"High"	"[R].AKPVYLVPQR.[L]"	"1xBiotin [K2]"	"0.120469"	"0.00703207"	"1"	"2"	"1"	"Q8VDI1-1"	"Q8VDI1-1 [97-106]"	"Q8VDI1-1 1xBiotin [K98]"	"0"	"1396.77695"	"0.453"	"1.419"	"0.925138005747468"	"0.984757285686748"	"101.43"	"75.02"	"106.2"	"43.1"	"150.7"	"64.61"	"49.11"	"55.10"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001915"	"0.01041"	"1.45"	"42.56"
"70252"	"False"	"High"	"[R].WFFLPR.[R]"	""	"0.125371"	"0.0072761"	"1"	"2"	"1"	"Q8VCF1-1"	"Q8VCF1-1 [297-302]"	""	"0"	"865.47192"	"84.239"	"3.058"	"0.925138005747468"	"0.906515362333117"	"29.58"	"53.04"	"3.4"	"287.2"	"9.4"	"39.46"	"23.83"	"50.82"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01097"	"1.35"	"54.69"
"30904"	"False"	"High"	"[R].LAHYNKR.[S]"	"1xBiotin [K6]"	"0.123249"	"0.0072761"	"2"	"13"	"6"	"Q64525; Q6ZWY9"	"Q64525 [81-87]; Q6ZWY9 [81-87]"	"Q64525 1xBiotin [K86]; Q6ZWY9 1xBiotin [K86]"	"1"	"1127.57786"	"0.170"	"0.857"	"0.925138005747468"	"0.906515362333117"	"60.02"	"53.72"	"155.5"	"23.6"	"120.9"	"43.19"	"50.02"	"31.29"	"NotUnique"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001943"	"0.01074"	"1.63"	"24.27"
"67653"	"False"	"High"	"[R].VKNQYEK.[H]"	"1xBiotin [K2]"	"0.12466"	"0.0072761"	"1"	"1"	"1"	"Q05D44"	"Q05D44 [911-917]"	"Q05D44 1xBiotin [K912]"	"1"	"1134.56121"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001966"	"0.01089"	"1.66"	""
"38754"	"False"	"High"	"[K].LTIYTTLVGLLNAR.[N]"	""	"0.12466"	"0.0072761"	"1"	"1"	"1"	"Q3UYV9"	"Q3UYV9 [83-96]"	""	"0"	"1547.91555"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001966"	"0.01092"	"1.29"	""
"59520"	"False"	"High"	"[K].SFYMQR.[C]"	"1xOxidation [M4]"	"0.121852"	"0.0072761"	"1"	"1"	"12"	"Q8BP47"	"Q8BP47 [457-462]"	""	"0"	"847.37670"	"137.686"	"2.265"	"0.925138005747468"	"0.924306229746472"	"65.21"	"25.83"	"1.9"	"293.6"	"4.5"	"20.10"	"57.20"	"29.23"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001943"	"0.01059"	"1.31"	"21.10"
"38861"	"False"	"High"	"[K].LTSFFR.[G]"	""	"0.123952"	"0.0072761"	"1"	"1"	"1"	"P70677"	"P70677 [139-144]"	""	"0"	"770.41955"	"123.395"	"3.275"	"0.929016530787821"	"0.906515362333117"	"64.33"	"58.34"	"2.2"	"290.2"	"7.6"	"47.29"	"32.09"	"26.11"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.0108"	"1.62"	"38.22"
"65015"	"False"	"High"	"[R].TMWVIGLVFK.[K]"	"1xOxidation [M2]"	"0.126804"	"0.0072761"	"1"	"3"	"1"	"Q61183-1"	"Q61183-1 [435-444]"	""	"0"	"1209.67003"	"4.132"	"1.430"	"0.9501044796578"	""	"234.96"	"57.32"	"37.9"	"206.8"	"55.2"	"52.75"	"124.40"	"37.01"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001966"	"0.01117"	"1.67"	"59.31"
"13788"	"False"	"High"	"[R].ELNDFISYLQR.[E]"	""	"0.123952"	"0.0072761"	"1"	"1"	"1"	"P27773"	"P27773 [472-482]"	""	"0"	"1397.70596"	"48.620"	"1.420"	"0.925138005747468"	"0.906515362333117"	"143.31"	"55.85"	"5.2"	"286.8"	"8.0"	"43.92"	"86.55"	"30.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.001943"	"0.01078"	"2.36"	"54.44"
"9830"	"False"	"High"	"[K].DTYLKGLVK.[G]"	"1xBiotin [K5]"	"0.122548"	"0.0072761"	"1"	"1"	"1"	"Q3TZZ7-1"	"Q3TZZ7-1 [325-333]"	"Q3TZZ7-1 1xBiotin [K329]"	"1"	"1262.68132"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001943"	"0.01062"	"2.13"	""
"20557"	"False"	"High"	"[R].GFYAVYR.[V]"	""	"0.121159"	"0.0072761"	"1"	"1"	"4"	"E9Q8D0"	"E9Q8D0 [106-112]"	""	"0"	"875.44101"	"252.694"	"3.305"	"0.925138005747468"	"0.906515362333117"	"60.92"	"89.10"	"1.2"	"295.5"	"3.3"	"51.71"	"31.51"	"76.06"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01044"	"1.53"	"34.34"
"43395"	"False"	"High"	"[-].MFSWMGR.[Q]"	"1xAcetyl [N-Term]; 1xOxidation [M5]"	"0.12466"	"0.0072761"	"1"	"1"	"1"	"Q9EQP2"	"Q9EQP2 [1-7]"	"Q9EQP2 1xAcetyl [N-Term]"	"0"	"972.40662"	"54.201"	"3.807"	"0.524858088591736"	"0.906515362333117"	"84.92"	"46.66"	"5.4"	"273.0"	"21.7"	"43.14"	"61.88"	"12.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01092"	"1.20"	"53.23"
"71925"	"False"	"High"	"[R].YLTNAYSR.[D]"	""	"0.125371"	"0.0072761"	"1"	"1"	"1"	"Q9QYB1"	"Q9QYB1 [220-227]"	""	"0"	"987.48942"	"190.730"	"5.225"	"0.925138005747468"	"0.906515362333117"	"51.31"	"31.65"	"1.7"	"290.2"	"8.1"	"26.22"	"40.84"	"25.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01097"	"1.19"	"24.26"
"69936"	"False"	"High"	"[R].VWLFFMR.[G]"	"1xOxidation [M6]"	"0.123249"	"0.0072761"	"1"	"1"	"2"	"Q99PV0"	"Q99PV0 [636-642]"	""	"0"	"1014.52297"	"103.216"	"0.853"	"0.925138005747468"	"0.906515362333117"	"78.91"	"82.35"	"2.8"	"294.8"	"2.3"	"59.68"	"40.85"	"41.21"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001943"	"0.01075"	"1.76"	"55.96"
"61239"	"False"	"High"	"[K].SNYFLK.[I]"	""	"0.123952"	"0.0072761"	"1"	"1"	"4"	"P14869"	"P14869 [11-16]"	""	"0"	"771.40357"	"150.375"	"5.496"	"0.925138005747468"	"0.906515362333117"	"68.43"	"57.09"	"2.0"	"286.9"	"11.1"	"47.62"	"43.86"	"25.27"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01084"	"1.71"	"31.37"
"39932"	"False"	"High"	"[R].MAAESRR.[V]"	"1xOxidation [M1]"	"0.121159"	"0.0072761"	"1"	"1"	"1"	"P27790"	"P27790 [285-291]"	""	"1"	"836.40431"	"0.778"	"3.042"	""	"0.906515362333117"	"53.69"	"108.75"	"76.0"	"52.4"	"171.6"	"27.55"	"49.01"	"80.85"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01044"	"1.83"	"37.57"
"4657"	"False"	"High"	"[R].AWVAWR.[TA]"	""	"0.126804"	"0.0072761"	"1"	"2"	"15"	"P17897"	"P17897 [126-131]"	""	"0"	"788.42022"	"125.139"	"4.349"	"0.925138005747468"	"0.906515362333117"	"62.84"	"69.80"	"2.7"	"286.4"	"10.9"	"32.17"	"93.44"	"62.82"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01114"	"1.82"	"40.31"
"18803"	"False"	"High"	"[K].FSWGYR.[R]"	""	"0.121852"	"0.0072761"	"1"	"1"	"5"	"Q99KR8"	"Q99KR8 [294-299]"	""	"0"	"815.38350"	"129.117"	"3.853"	"0.928461841781804"	"0.906515362333117"	"32.75"	"27.30"	"2.2"	"289.2"	"8.6"	"17.62"	"27.64"	"25.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.001943"	"0.01054"	"1.28"	"38.29"
"22006"	"False"	"High"	"[K].GMTGIWR.[Y]"	"1xOxidation [M2]"	"0.12466"	"0.0072761"	"1"	"1"	"12"	"Q9QYB1"	"Q9QYB1 [213-219]"	""	"0"	"836.40833"	"327.225"	"4.863"	"0.925138005747468"	"0.906515362333117"	"47.28"	"39.39"	"0.9"	"295.2"	"3.9"	"17.34"	"34.56"	"28.30"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.001966"	"0.0109"	"1.96"	"27.44"
"35179"	"False"	"High"	"[R].IIPAIWFR.[Y]"	""	"0.126804"	"0.0072761"	"1"	"1"	"1"	"Q9DC16"	"Q9DC16 [225-232]"	""	"0"	"1015.60875"	"113.866"	"3.272"	"0.334285145275372"	"0.906515362333117"	"49.26"	"70.67"	"2.3"	"290.2"	"7.5"	"46.37"	"23.66"	"65.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.001966"	"0.01114"	"1.61"	"54.72"
"1171"	"False"	"High"	"[R].AFVGPLSPSKAEDFR.[K]"	"1xBiotin [K10]"	"0.121852"	"0.0072761"	"1"	"3"	"1"	"Q6P1H6-1"	"Q6P1H6-1 [529-543]"	"Q6P1H6-1 1xBiotin [K538]"	"1"	"1846.91563"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001943"	"0.01054"	"2.29"	""
"19199"	"False"	"High"	"[K].FYWGHK.[E]"	""	"0.121159"	"0.0072761"	"1"	"1"	"19"	"Q91V92"	"Q91V92 [531-536]"	""	"0"	"837.40423"	"74.357"	"2.597"	"0.998769547666767"	"0.906515362333117"	"69.78"	"60.10"	"3.7"	"285.5"	"10.7"	"55.40"	"33.63"	"33.76"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.001915"	"0.0105"	"1.42"	"28.12"
"16585"	"False"	"High"	"[K].EVPMVAVPPVGSKASSPATSSQGK.[K]"	"1xBiotin [K13]; 1xOxidation [M4]"	"0.121159"	"0.0072761"	"1"	"9"	"1"	"Q99PL5-1"	"Q99PL5-1 [176-199]"	"Q99PL5-1 1xBiotin [K188]"	"1"	"2553.26873"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001915"	"0.01044"	"2.29"	""
"57771"	"False"	"High"	"[R].RRFPPYYMR.[R]"	"1xOxidation [M8]"	"0.125371"	"0.0072761"	"1"	"1"	"19"	"P62960"	"P62960 [189-197]"	""	"2"	"1301.65717"	"79.113"	"1.276"	"0.98927749808913"	"0.983025330649738"	"64.61"	"65.21"	"3.3"	"292.1"	"4.6"	"63.94"	"43.84"	"37.87"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"0.001966"	"0.01104"	"2.18"	"23.49"
"25295"	"False"	"High"	"[KR].HVDWVR.[AS]"	""	"0.123249"	"0.0072761"	"1"	"2"	"3"	"P40124"	"P40124 [178-183]"	""	"0"	"811.42095"	"178.488"	"4.786"	"0.786556628498804"	"0.906515362333117"	"71.69"	"78.81"	"1.9"	"289.8"	"8.3"	"37.06"	"61.01"	"69.94"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001943"	"0.01069"	"1.54"	"22.42"
"57491"	"False"	"High"	"[R].RPLFFQNLGIR.[C]"	""	"0.126085"	"0.0072761"	"1"	"1"	"3"	"P15307"	"P15307 [98-108]"	""	"0"	"1360.78482"	"72.325"	"1.026"	"0.987144754730324"	"0.906515362333117"	"68.66"	"58.57"	"5.2"	"288.7"	"6.1"	"51.24"	"53.28"	"42.30"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.001966"	"0.01112"	"3.20"	"48.17"
"36287"	"False"	"High"	"[R].INFDKYHPGYFGK.[V]"	"1xBiotin [K5]"	"0.12466"	"0.0072761"	"1"	"1"	"1"	"P14115"	"P14115 [43-55]"	"P14115 1xBiotin [K47]"	"1"	"1811.85739"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.001966"	"0.01088"	"2.61"	""
"37296"	"False"	"High"	"[K].IQLGKIH.[-]"	"1xBiotin [K5]"	"0.121852"	"0.0072761"	"1"	"1"	"1"	"Q9DC16"	"Q9DC16 [284-290]"	"Q9DC16 1xBiotin [K288]"	"1"	"1034.58155"	"0.095"	"0.708"	"0.00559403995312396"	"0.906515362333117"	"32.71"	"33.56"	"167.8"	"14.8"	"117.3"	"25.50"	"25.38"	"23.34"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.001943"	"0.01054"	"1.69"	"40.74"
"3064"	"False"	"High"	"[K].ANVEKK.[A]"	"1xBiotin [K5]"	"0.12466"	"0.0072761"	"1"	"1"	"4"	"Q9CZW4"	"Q9CZW4 [266-271]"	"Q9CZW4 1xBiotin [K270]"	"1"	"914.47641"	"0.258"	"0.861"	"0.925138005747468"	"0.906515362333117"	"122.26"	"49.82"	"153.8"	"32.7"	"113.5"	"33.63"	"142.71"	"39.99"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.001966"	"0.01088"	"1.80"	"20.69"
"30492"	"False"	"High"	"[K].KWGFTK.[F]"	""	"0.127526"	"0.00753645"	"1"	"2"	"16"	"P86048"	"P86048 [170-175]"	""	"1"	"766.42464"	"115.031"	"3.599"	"0.925138005747468"	"0.906515362333117"	"54.58"	"52.47"	"2.6"	"288.0"	"9.4"	"27.87"	"44.52"	"38.55"	"MandatoryModificationMissing"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.002026"	"0.01131"	"1.89"	"25.47"
"71623"	"False"	"High"	"[R].YHPMDYYWWLR.[M]"	"1xOxidation [M4]"	"0.128251"	"0.00753645"	"1"	"1"	"1"	"Q80XN0"	"Q80XN0 [315-325]"	""	"0"	"1645.72565"	"91.325"	"0.954"	"0.455173944416713"	""	"74.54"	"85.08"	"3.7"	"292.7"	"3.6"	"58.15"	"53.47"	"52.29"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002026"	"0.01134"	"1.90"	"51.42"
"63014"	"False"	"High"	"[K].SWFWTR.[L]"	""	"0.13045"	"0.00753645"	"1"	"2"	"3"	"P22366-1"	"P22366-1 [283-288]"	""	"0"	"882.42570"	"86.872"	"2.229"	"0.972075648754221"	"0.906515362333117"	"69.15"	"57.96"	"2.9"	"289.5"	"7.6"	"56.09"	"40.10"	"46.08"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002051"	"0.01164"	"1.47"	"48.47"
"39688"	"False"	"High"	"[K].IYNYYK.[K]"	""	"0.129714"	"0.00753645"	"1"	"1"	"12"	"Q93092"	"Q93092 [220-225]"	""	"0"	"863.42978"	"117.796"	"2.934"	"0.925138005747468"	"0.906515362333117"	"55.18"	"31.87"	"2.6"	"290.0"	"7.4"	"22.31"	"42.90"	"25.16"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"0.002051"	"0.01156"	"1.71"	"25.49"
"22974"	"False"	"High"	"[K].GSKGSEDSPPK.[H]"	"1xBiotin [K3]"	"0.128981"	"0.00753645"	"1"	"1"	"5"	"Q99LH2"	"Q99LH2 [435-445]"	"Q99LH2 1xBiotin [K437]"	"1"	"1314.59944"	"0.296"	"0.934"	"0.925138005747468"	"0.906515362333117"	"64.65"	"63.66"	"134.0"	"45.0"	"121.0"	"49.00"	"55.52"	"41.06"	""	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.002026"	"0.01148"	"1.99"	"22.50"
"36222"	"False"	"High"	"[R].IMWSQR.[D]"	"1xOxidation [M2]"	"0.128981"	"0.00753645"	"1"	"1"	"16"	"P29341"	"P29341 [84-89]"	""	"0"	"836.40833"	"167.528"	"3.166"	"0.925138005747468"	"0.906515362333117"	"63.37"	"63.62"	"1.7"	"291.2"	"7.1"	"52.12"	"53.79"	"45.93"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"0.002026"	"0.01146"	"1.27"	"24.45"
"16735"	"False"	"High"	"[K].EYDAQKASK.[R]"	"1xBiotin [K6]"	"0.127526"	"0.00753645"	"1"	"1"	"1"	"Q922Q8"	"Q922Q8 [202-210]"	"Q922Q8 1xBiotin [K207]"	"1"	"1265.58306"	"0.765"	"1.057"	"0.954159466554789"	"0.913702580837398"	"48.80"	"94.11"	"107.6"	"84.5"	"107.9"	"37.96"	"32.43"	"67.70"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002026"	"0.01131"	"1.81"	"24.89"
"20479"	"False"	"High"	"[R].GFLYFNR.[Q]"	""	"0.128981"	"0.00753645"	"1"	"1"	"3"	"Q9EPU4"	"Q9EPU4 [984-990]"	""	"0"	"916.46756"	"109.900"	"2.968"	"0.940042144832625"	"0.906515362333117"	"53.51"	"75.94"	"2.2"	"290.4"	"7.3"	"61.86"	"26.29"	"59.70"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.002026"	"0.01144"	"1.67"	"44.43"
"23785"	"False"	"High"	"[K].GYFIFK.[L]"	""	"0.128251"	"0.00753645"	"1"	"1"	"1"	"Q0VGB7"	"Q0VGB7 [47-52]"	""	"0"	"774.41849"	"138.520"	"4.725"	"0.925138005747468"	"0.906515362333117"	"57.56"	"89.79"	"2.5"	"289.7"	"7.8"	"56.62"	"34.10"	"63.07"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002026"	"0.01137"	"1.47"	"45.35"
"39395"	"False"	"High"	"[R].IVSWWMTGR.[S]"	"1xOxidation [M6]"	"0.128981"	"0.00753645"	"1"	"2"	"2"	"O88508-1"	"O88508-1 [306-314]"	""	"0"	"1151.56663"	"283.203"	"6.796"	"0.925138005747468"	"0.906515362333117"	"27.13"	"47.99"	"1.0"	"293.9"	"5.1"	"31.37"	"24.87"	"34.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002026"	"0.01149"	"1.98"	"44.55"
"13183"	"False"	"High"	"[K].EKVFYNIMR.[E]"	"1xBiotin [K2]; 1xOxidation [M8]"	"0.129714"	"0.00753645"	"1"	"1"	"3"	"Q9D379"	"Q9D379 [287-295]"	"Q9D379 1xBiotin [K288]"	"1"	"1441.69665"	"0.752"	"0.822"	"0.949662611758987"	"0.906515362333117"	"78.27"	"88.50"	"107.7"	"90.7"	"101.6"	"60.38"	"38.83"	"50.12"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.002051"	"0.01155"	"1.92"	"43.59"
"23917"	"False"	"High"	"[R].GYYSLETFTYLLALK.[A]"	""	"0.128251"	"0.00753645"	"1"	"1"	"2"	"Q9CQR6"	"Q9CQR6 [86-100]"	""	"0"	"1781.93601"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002026"	"0.01135"	"2.17"	""
"18178"	"False"	"High"	"[R].FMLLFSR.[Q]"	""	"0.131191"	"0.00753645"	"1"	"1"	"3"	"P61967"	"P61967 [4-10]"	""	"0"	"913.49642"	"5.528"	"1.976"	"0.97864233222105"	"0.989845584388546"	"240.04"	"68.33"	"31.0"	"202.3"	"66.7"	"50.37"	"120.42"	"54.76"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"Not Found"	"High"	"Not Found"	"High"	"0.002051"	"0.01178"	"1.40"	"53.05"
"22620"	"False"	"High"	"[R].GQPIYIQFSNHK.[E]"	""	"0.129714"	"0.00753645"	"1"	"1"	"1"	"P17225"	"P17225 [122-133]"	""	"0"	"1431.73792"	"190.567"	"4.775"	"0.392886486650146"	"0.906515362333117"	"44.71"	"71.28"	"1.6"	"290.4"	"8.0"	"45.89"	"38.64"	"58.33"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002051"	"0.01158"	"2.17"	"36.21"
"17946"	"False"	"High"	"[K].FLPLFDR.[V]"	""	"0.129714"	"0.00753645"	"1"	"1"	"6"	"Q64433"	"Q64433 [9-15]"	""	"0"	"907.50361"	"176.843"	"4.141"	"0.339573869323658"	"0.906515362333117"	"63.41"	"79.78"	"1.7"	"290.4"	"7.9"	"34.58"	"86.81"	"60.45"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"High"	"0.002051"	"0.01156"	"1.77"	"49.60"
"59725"	"False"	"High"	"[R].SGQGAFGNMCR.[G]"	"1xCarbamidomethyl [C10]; 1xOxidation [M9]"	"0.13045"	"0.00753645"	"1"	"1"	"5"	"Q9D8E6"	"Q9D8E6 [87-97]"	""	"0"	"1200.48845"	"135.701"	"1.287"	"0.453469753187132"	"0.906515362333117"	"31.35"	"49.45"	"2.1"	"295.2"	"2.7"	"18.98"	"23.14"	"45.25"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002051"	"0.01166"	"2.21"	"17.33"
"3787"	"False"	"High"	"[R].ASFAEKTAQLER.[T]"	"1xBiotin [K6]"	"0.127526"	"0.00753645"	"1"	"16"	"1"	"Q9QXS1-1"	"Q9QXS1-1 [1728-1739]"	"Q9QXS1-1 1xBiotin [K1733]"	"1"	"1576.77880"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.001999"	"0.01129"	"2.49"	""
"35573"	"False"	"High"	"[K].LLSNMMLQYR.[G]"	"1xOxidation [M]"	"0.131191"	"0.00753645"	"1"	"1"	"3"	"P28063"	"P28063 [154-163]"	""	"0"	"1284.64389"	"49.834"	"2.496"	"0.925138005747468"	"0.916215054610739"	"59.32"	"49.23"	"6.3"	"280.0"	"13.8"	"38.58"	"57.21"	"37.28"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002051"	"0.01174"	"1.95"	"39.82"
"39492"	"False"	"High"	"[R].LWFTYR.[R]"	""	"0.129714"	"0.00753645"	"1"	"2"	"1"	"Q8C9S8"	"Q8C9S8 [53-58]"	""	"0"	"885.46175"	"97.261"	"2.363"	"0.947989303413716"	"0.906515362333117"	"38.57"	"31.92"	"3.2"	"289.3"	"7.5"	"19.97"	"33.44"	"22.30"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002026"	"0.0115"	"1.48"	"46.51"
"71777"	"False"	"High"	"[K].YIFTLR.[T]"	""	"0.131935"	"0.00783146"	"1"	"1"	"9"	"P46460"	"P46460 [45-50]"	""	"0"	"812.46650"	"208.755"	"6.533"	"0.925138005747468"	"0.906515362333117"	"59.09"	"58.79"	"1.3"	"289.5"	"9.2"	"47.93"	"37.77"	"35.82"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"High"	"0.002051"	"0.0118"	"1.48"	"42.97"
"17060"	"False"	"High"	"[R].FDDHKGPTITLTQIV.[-]"	"1xBiotin [K5]"	"0.131935"	"0.00783146"	"1"	"1"	"16"	"Q9R1Q9"	"Q9R1Q9 [449-463]"	"Q9R1Q9 1xBiotin [K453]"	"1"	"1910.96806"	"0.033"	"0.815"	"7.31039480172466E-05"	"0.906515362333117"	"25.27"	"22.29"	"159.6"	"5.5"	"134.9"	"25.83"	"43.34"	"20.17"	""	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.002051"	"0.01185"	"3.81"	"56.74"
"60264"	"False"	"High"	"[R].SIATLAITTLLK.[T]"	""	"0.131935"	"0.00783146"	"1"	"4"	"1"	"Q9QXK3"	"Q9QXK3 [339-350]"	""	"0"	"1244.78241"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.002051"	"0.01182"	"1.60"	""
"40029"	"False"	"High"	"[-].MAANSQGNFDGKFEALDLAELTK.[K]"	"1xBiotin [K12]; 1xMet-loss+Acetyl [N-Term]"	"0.133434"	"0.0080555"	"1"	"1"	"2"	"Q9D6K8"	"Q9D6K8 [1-23]"	"Q9D6K8 1xBiotin [K12]; 1xMet-loss+Acetyl [N-Term]"	"1"	"2607.23954"	"1.153"	"1.705"	""	"0.985364111986862"	"72.89"	"66.61"	"75.5"	"96.9"	"127.6"	"54.86"	"42.74"	"51.81"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.012"	"2.26"	"64.80"
"71852"	"False"	"High"	"[K].YIMIFR.[N]"	"1xOxidation [M3]"	"0.139584"	"0.0080555"	"1"	"1"	"4"	"Q9ERK4"	"Q9ERK4 [487-492]"	""	"0"	"858.45422"	"357.473"	"5.836"	"0.886352798835681"	"0.906515362333117"	"65.96"	"59.07"	"1.1"	"293.7"	"5.3"	"60.46"	"37.70"	"26.31"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002126"	"0.01285"	"1.38"	"40.57"
"24181"	"False"	"High"	"[R].HFAEWR.[H]"	""	"0.134949"	"0.0080555"	"1"	"1"	"3"	"Q9D554"	"Q9D554 [425-430]"	""	"0"	"845.40530"	"177.277"	"5.101"	"0.474571969629549"	"0.906515362333117"	"51.59"	"50.21"	"1.9"	"289.1"	"9.0"	"34.31"	"49.09"	"39.91"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002096"	"0.01225"	"1.58"	"25.73"
"32877"	"False"	"High"	"[R].LGGIGQFLAK.[A]"	""	"0.136478"	"0.0080555"	"1"	"3"	"1"	"O70133"	"O70133 [812-821]"	""	"0"	"1003.59349"	"119.554"	"1.998"	"0.925138005747468"	"0.950055801575781"	"77.56"	"85.59"	"2.3"	"293.0"	"4.7"	"81.47"	"29.78"	"49.55"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01242"	"1.70"	"45.00"
"35892"	"False"	"High"	"[R].LMAKMGFR.[E]"	"1xBiotin [K4]"	"0.138802"	"0.0080555"	"1"	"1"	"2"	"Q9DBC3"	"Q9DBC3 [93-100]"	"Q9DBC3 1xBiotin [K96]"	"1"	"1179.58354"	"0.178"	"0.971"	"0.925138005747468"	"0.916215054610739"	"69.45"	"27.15"	"141.6"	"22.4"	"136.0"	"22.59"	"56.85"	"27.53"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01275"	"1.80"	"45.15"
"21233"	"False"	"High"	"[R].GKSALLER.[A]"	"1xBiotin [K2]"	"0.138023"	"0.0080555"	"1"	"1"	"1"	"Q9CQA1"	"Q9CQA1 [8-15]"	"Q9CQA1 1xBiotin [K9]"	"1"	"1099.59284"	"0.194"	"0.880"	"0.925138005747468"	"0.906515362333117"	"86.77"	"71.97"	"139.5"	"28.0"	"132.5"	"59.64"	"41.50"	"40.93"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.0127"	"1.95"	"37.71"
"66322"	"False"	"High"	"[K].TYGICGAIR.[R]"	"1xCarbamidomethyl [C5]"	"0.133434"	"0.0080555"	"1"	"1"	"1"	"Q9CQR2"	"Q9CQR2 [52-60]"	""	"0"	"1010.50878"	"186.739"	"4.900"	"0.925138005747468"	"0.906515362333117"	"47.25"	"74.01"	"1.5"	"291.9"	"6.6"	"25.54"	"44.71"	"72.11"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01207"	"1.70"	"32.49"
"14062"	"False"	"High"	"[K].EITALAPSTMKIK.[I]"	"1xBiotin [K11]; 1xOxidation [M10]"	"0.138802"	"0.0080555"	"1"	"6"	"2"	"P60710"	"P60710 [316-328]"	"P60710 1xBiotin [K326]"	"1"	"1644.86993"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.002096"	"0.01281"	"2.59"	""
"60051"	"False"	"High"	"[K].SKFLQLR.[K]"	"1xBiotin [K2]"	"0.134949"	"0.0080555"	"1"	"1"	"1"	"P58681"	"P58681 [999-1005]"	"P58681 1xBiotin [K1000]"	"1"	"1117.61866"	"5.656"	"0.706"	"0.925138005747468"	"0.906515362333117"	"141.72"	"47.20"	"40.8"	"230.9"	"28.2"	"46.46"	"104.24"	"20.71"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01225"	"1.56"	"46.07"
"2122"	"False"	"High"	"[R].AIFFNR.[I]"	""	"0.139584"	"0.0080555"	"1"	"1"	"15"	"O35129"	"O35129 [49-54]"	""	"0"	"767.41989"	"125.448"	"3.394"	"0.925138005747468"	"0.906515362333117"	"87.33"	"65.55"	"2.3"	"288.3"	"9.4"	"65.91"	"97.93"	"32.22"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.002126"	"0.01292"	"1.75"	"36.06"
"36755"	"False"	"High"	"[R].LPLFGLGR.[L]"	""	"0.138802"	"0.0080555"	"1"	"1"	"6"	"Q9JIK9"	"Q9JIK9 [71-78]"	""	"0"	"872.53525"	"99.050"	"2.566"	"0.457987646513303"	"0.916215054610739"	"50.13"	"54.07"	"2.9"	"290.6"	"6.5"	"36.83"	"36.90"	"49.09"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.002096"	"0.01277"	"2.32"	"48.96"
"29944"	"False"	"High"	"[K].KTGSKSVDAAK.[L]"	"1xBiotin [K5]"	"0.138023"	"0.0080555"	"1"	"1"	"1"	"Q61712"	"Q61712 [189-199]"	"Q61712 1xBiotin [K193]"	"2"	"1317.68311"	"0.227"	"0.884"	"0.925138005747468"	"0.906515362333117"	"59.20"	"47.13"	"135.6"	"35.7"	"128.7"	"33.09"	"53.22"	"32.81"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002096"	"0.01264"	"2.44"	"20.62"
"16992"	"False"	"High"	"[R].FAYWSGYVK.[S]"	""	"0.13419"	"0.0080555"	"1"	"1"	"1"	"Q6ZQH8"	"Q6ZQH8 [1072-1080]"	""	"0"	"1120.54621"	"79.487"	"1.778"	"0.481285487216449"	"0.961669539409908"	"32.45"	"59.02"	"3.4"	"290.9"	"5.7"	"24.13"	"10.85"	"46.68"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.002096"	"0.01214"	"1.81"	"44.25"
"71988"	"False"	"High"	"[R].YMFFNR.[E]"	"1xOxidation [M2]"	"0.135712"	"0.0080555"	"1"	"2"	"3"	"Q5SWD9-1"	"Q5SWD9-1 [714-719]"	""	"0"	"893.39744"	"497.613"	"8.656"	"0.698394517820836"	"0.906515362333117"	"86.77"	"81.95"	"0.5"	"294.9"	"4.5"	"76.43"	"45.49"	"67.46"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002096"	"0.01236"	"1.10"	"36.32"
"60372"	"False"	"High"	"[K].SLGALKK.[-]"	"1xBiotin [K]"	"0.137249"	"0.0080555"	"1"	"1"	"6"	"Q9R099"	"Q9R099 [436-442]"	"Q9R099 1xBiotin [K]"	"1"	"942.54410"	"0.074"	"0.663"	"0.0028103014004041"	"0.906515362333117"	"42.95"	"28.10"	"172.4"	"13.2"	"114.4"	"43.52"	"29.74"	"42.48"	""	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002096"	"0.01253"	"1.66"	"35.37"
"41541"	"False"	"High"	"[-].MAVAGAKR.[R]"	"1xBiotin [K7]; 1xMet-loss+Acetyl [N-Term]"	"0.137249"	"0.0080555"	"1"	"1"	"2"	"Q9Z127"	"Q9Z127 [1-8]"	"Q9Z127 1xBiotin [K7]; 1xMet-loss+Acetyl [N-Term]"	"1"	"940.50330"	"0.504"	"0.934"	"0.94340856990521"	"0.913565512658592"	"115.21"	"113.72"	"123.3"	"61.8"	"114.9"	"84.75"	"34.92"	"60.60"	""	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"High"	"0.002096"	"0.01255"	"1.69"	"32.23"
"4231"	"False"	"High"	"[K].ATPLSPTVTLSMSADVPLVVEYK.[I]"	"1xOxidation [M12]"	"0.138023"	"0.0080555"	"1"	"1"	"2"	"P17918"	"P17918 [218-240]"	""	"0"	"2434.27855"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.0127"	"2.80"	""
"66070"	"False"	"High"	"[R].TVFFWAPIMK.[W]"	""	"0.136478"	"0.0080555"	"1"	"1"	"3"	"Q9D023"	"Q9D023 [40-49]"	""	"0"	"1239.65946"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01241"	"2.07"	""
"22440"	"False"	"High"	"[R].GPYHFR.[A]"	""	"0.135712"	"0.0080555"	"1"	"1"	"12"	"P19253"	"P19253 [69-74]"	""	"0"	"776.38383"	"175.733"	"3.781"	"0.925138005747468"	"0.906515362333117"	"83.90"	"85.16"	"2.3"	"288.8"	"9.0"	"71.75"	"63.99"	"47.71"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01239"	"1.88"	"20.52"
"23835"	"False"	"High"	"[R].GYIYWR.[L]"	""	"0.13419"	"0.0080555"	"1"	"3"	"28"	"O35643"	"O35643 [523-528]"	""	"0"	"857.43045"	"84.879"	"3.438"	"0.975052343286225"	"0.906515362333117"	"53.10"	"68.03"	"3.3"	"283.8"	"13.0"	"47.65"	"42.03"	"54.93"	"MandatoryModificationMissing"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"0.002096"	"0.01217"	"1.56"	"39.29"
"72682"	"False"	"High"	"[K].YYFAVDTVYVGKK.[L]"	"1xBiotin [K12]"	"0.138802"	"0.0080555"	"1"	"2"	"1"	"Q9CX30-1"	"Q9CX30-1 [108-120]"	"Q9CX30-1 1xBiotin [K119]"	"1"	"1778.88220"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01271"	"2.26"	""
"58403"	"False"	"High"	"[R].RYFYLFPNR.[L]"	""	"0.133434"	"0.0080555"	"1"	"2"	"3"	"Q99MK8"	"Q99MK8 [579-587]"	""	"1"	"1275.66330"	"92.167"	"1.771"	"0.477067253044389"	"0.963994276545741"	"50.50"	"54.12"	"2.7"	"292.4"	"4.9"	"46.67"	"27.80"	"13.92"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01208"	"2.03"	"44.94"
"72221"	"False"	"High"	"[R].YQFTPAFLR.[L]"	""	"0.134949"	"0.0080555"	"1"	"2"	"2"	"Q8C4B4"	"Q8C4B4 [142-150]"	""	"0"	"1142.59931"	"99.129"	"2.369"	"0.815031019872958"	"0.906515362333117"	"65.26"	"66.05"	"3.6"	"288.0"	"8.4"	"46.51"	"43.47"	"58.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002096"	"0.01219"	"2.14"	"48.96"
"21907"	"False"	"High"	"[R].GMGPGTPAGYGR.[G]"	"1xOxidation [M2]"	"0.132683"	"0.0080555"	"1"	"1"	"1"	"Q8VIJ6"	"Q8VIJ6 [674-685]"	""	"0"	"1136.51532"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002082"	"0.01195"	"1.99"	""
"20497"	"False"	"High"	"[K].GFPLITITVSGR.[N]"	""	"0.138802"	"0.0080555"	"1"	"1"	"1"	"Q9EQH2"	"Q9EQH2 [518-529]"	""	"0"	"1260.73105"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01273"	"2.19"	""
"18089"	"False"	"High"	"[K].FLWMVR.[I]"	""	"0.132683"	"0.0080555"	"2"	"2"	"2"	"P46978; Q3TDQ1"	"P46978 [596-601]; Q3TDQ1 [672-677]"	""	"0"	"851.45964"	"28.153"	"1.951"	"0.925138005747468"	"0.969227082684272"	"68.43"	"61.07"	"7.6"	"277.1"	"15.3"	"49.13"	"35.23"	"20.20"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002082"	"0.01195"	"1.52"	"50.32"
"53837"	"False"	"High"	"[R].QIFNGTFVK.[L]"	""	"0.136478"	"0.0080555"	"1"	"1"	"3"	"P14148"	"P14148 [138-146]"	""	"0"	"1053.57276"	"87.669"	"1.029"	"0.432224089536881"	""	"63.34"	"46.53"	"3.5"	"292.7"	"3.8"	"29.16"	"66.84"	"35.63"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.0125"	"2.05"	"39.18"
"26929"	"False"	"High"	"[K].KGFLFR.[G]"	""	"0.139584"	"0.0080555"	"1"	"4"	"1"	"P17710-1"	"P17710-1 [820-825]"	""	"1"	"767.45627"	"7.911"	"2.670"	"0.525161429132432"	"0.923750342545975"	"687.07"	"71.55"	"31.6"	"191.8"	"76.6"	"31.18"	"109.04"	"61.60"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002126"	"0.01287"	"1.48"	"33.02"
"18112"	"False"	"High"	"[K].FMALICEASGGGAFLVLPLGK.[T]"	"1xCarbamidomethyl [C6]; 1xOxidation [M2]"	"0.13419"	"0.0080555"	"1"	"1"	"1"	"O89053"	"O89053 [46-66]"	""	"0"	"2167.12899"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01214"	"2.15"	""
"24658"	"False"	"High"	"[K].HLVTSEELISEGKWVK.[F]"	"1xBiotin [K13]"	"0.13419"	"0.0080555"	"1"	"1"	"2"	"Q9JKX6"	"Q9JKX6 [14-29]"	"Q9JKX6 1xBiotin [K26]"	"1"	"2081.07359"	"1.002"	"1.636"	"0.975052343286225"	"0.954461348772941"	"54.48"	"84.46"	"85.3"	"84.2"	"130.5"	"28.60"	"216.22"	"66.29"	""	"Peak Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.002096"	"0.01213"	"2.55"	"49.56"
"49294"	"False"	"High"	"[R].MYSSYSVEPKK.[L]"	"1xBiotin [K11]; 1xOxidation [M1]"	"0.138802"	"0.0080555"	"1"	"1"	"1"	"Q8VCB1"	"Q8VCB1 [394-404]"	"Q8VCB1 1xBiotin [K404]"	"1"	"1560.70728"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002096"	"0.01273"	"2.04"	""
"71348"	"False"	"High"	"[R].YFMLSGAYQGK.[L]"	"1xOxidation [M3]"	"0.139584"	"0.0080555"	"1"	"1"	"2"	"Q91YX0"	"Q91YX0 [312-322]"	""	"0"	"1280.59799"	"7.838"	"0.930"	"0.982626859977453"	""	"195.51"	"56.08"	"41.3"	"221.7"	"37.0"	"41.93"	"113.21"	"38.70"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002126"	"0.01289"	"1.53"	"38.10"
"54250"	"False"	"High"	"[R].QMALLSSAFSFGWSKWNMVCNSTR.[V]"	"1xCarbamidomethyl [C20]"	"0.141954"	"0.00832211"	"1"	"1"	"2"	"Q6TDU8"	"Q6TDU8 [613-636]"	""	"1"	"2808.30547"	"136.394"	"3.953"	"0.45774144663631"	"0.906515362333117"	"47.01"	"33.48"	"2.5"	"287.4"	"10.1"	"44.21"	"27.10"	"35.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"High"	"0.002149"	"0.0132"	"2.37"	"45.82"
"64638"	"False"	"High"	"[K].TLLFFNK.[C]"	""	"0.141954"	"0.00832211"	"1"	"1"	"1"	"Q8BHZ4"	"Q8BHZ4 [623-629]"	""	"0"	"882.50837"	"208.697"	"4.116"	"0.925138005747468"	"0.906515362333117"	"57.51"	"50.62"	"1.2"	"293.6"	"5.2"	"44.67"	"38.51"	"30.47"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002149"	"0.01317"	"1.24"	"53.19"
"39247"	"False"	"High"	"[K].LVNCTCESPHCK.[R]"	"1xBiotin [K12]; 3xCarbamidomethyl [C4; C6; C11]"	"0.141954"	"0.00832211"	"1"	"1"	"1"	"Q61288"	"Q61288 [30-41]"	"Q61288 1xBiotin [K41]"	"0"	"1730.71173"	"2.796"	"0.578"	"0.925138005747468"	"0.906515362333117"	"424.03"	"50.81"	"69.1"	"188.1"	"42.8"	"27.34"	"131.00"	"45.36"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002149"	"0.0132"	"1.50"	"13.79"
"37719"	"False"	"High"	"[K].LRQPFFQK.[RS]"	""	"0.141954"	"0.00832211"	"1"	"3"	"8"	"Q9EQU5"	"Q9EQU5 [75-82]"	""	"1"	"1063.60473"	"142.290"	"4.573"	"0.925138005747468"	"0.906515362333117"	"64.27"	"62.65"	"2.3"	"284.4"	"13.3"	"48.16"	"61.96"	"32.36"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002149"	"0.01318"	"2.00"	"30.22"
"70267"	"False"	"High"	"[R].WFPFPYPWR.[R]"	""	"0.14116"	"0.00832211"	"1"	"2"	"1"	"Q99KU6"	"Q99KU6 [226-234]"	""	"0"	"1295.63603"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002149"	"0.01311"	"1.38"	""
"63161"	"False"	"High"	"[R].TAAYGHFGR.[D]"	""	"0.141954"	"0.00832211"	"1"	"1"	"2"	"Q3THS6"	"Q3THS6 [374-382]"	""	"0"	"979.47444"	"37.951"	"1.537"	"0.69920017797184"	"0.916215054610739"	"144.43"	"40.83"	"7.6"	"280.1"	"12.3"	"21.81"	"111.95"	"81.03"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002149"	"0.01324"	"1.30"	"21.05"
"34543"	"False"	"High"	"[R].IIGLDQVAGMSETALPGAFK.[T]"	""	"0.142751"	"0.00832211"	"1"	"1"	"1"	"Q8VDD5"	"Q8VDD5 [618-637]"	""	"0"	"2018.06269"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002149"	"0.01329"	"2.67"	""
"30531"	"False"	"High"	"[K].KWYTIFK.[D]"	""	"0.14116"	"0.00832211"	"1"	"1"	"1"	"Q9EPV8"	"Q9EPV8 [46-52]"	""	"1"	"985.55056"	"89.129"	"0.976"	"0.487524984662636"	""	"76.28"	"57.30"	"2.9"	"294.1"	"2.9"	"37.38"	"53.00"	"40.40"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002149"	"0.01312"	"1.82"	"41.33"
"30158"	"False"	"High"	"[R].KVAVHEDGYPVVSWVPEEGEMMDQK.[G]"	"1xBiotin [K1]; 1xOxidation [M22]"	"0.141954"	"0.00832211"	"1"	"1"	"2"	"P31651"	"P31651 [4-28]"	"P31651 1xBiotin [K4]"	"1"	"3101.40530"	"0.929"	"1.038"	""	"0.906515362333117"	"63.06"	"65.36"	"111.0"	"89.5"	"99.6"	"29.65"	"56.78"	"45.33"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.002149"	"0.01321"	"2.77"	"49.97"
"37314"	"False"	"High"	"[K].LQLNYLGNYIPR.[F]"	""	"0.143553"	"0.00832211"	"1"	"1"	"1"	"Q9R0E2"	"Q9R0E2 [249-260]"	""	"0"	"1463.80052"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002149"	"0.01345"	"2.11"	""
"67329"	"False"	"High"	"[K].VGMLWR.[E]"	""	"0.14116"	"0.00832211"	"1"	"2"	"3"	"Q6NZJ6"	"Q6NZJ6 [1392-1397]"	""	"0"	"761.41269"	"47.804"	"10.652"	"0.707100800615602"	"0.906515362333117"	"133.49"	"82.25"	"6.0"	"246.5"	"47.4"	"72.83"	"115.88"	"42.31"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002149"	"0.01304"	"1.73"	"39.14"
"3876"	"False"	"High"	"[K].ASLKER.[F]"	"1xBiotin [K4]"	"0.14037"	"0.00832211"	"1"	"1"	"1"	"P58544"	"P58544 [59-64]"	"P58544 1xBiotin [K62]"	"1"	"929.48731"	"0.139"	"0.717"	"0.925138005747468"	"0.906515362333117"	"40.52"	"61.35"	"161.5"	"20.8"	"117.7"	"20.58"	"50.04"	"76.26"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002149"	"0.01298"	"1.86"	"26.97"
"39502"	"False"	"High"	"[R].IWHSSTYR.[L]"	""	"0.142751"	"0.00832211"	"1"	"1"	"3"	"O55029"	"O55029 [255-262]"	""	"0"	"1049.51630"	"346.406"	"3.282"	"0.925138005747468"	"0.906515362333117"	"68.43"	"37.98"	"1.2"	"295.2"	"3.6"	"25.01"	"53.69"	"30.08"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002149"	"0.01328"	"1.60"	"20.34"
"56628"	"False"	"High"	"[K].RGWFSGFWGK.[K]"	""	"0.14762"	"0.00850342"	"1"	"3"	"9"	"Q8BX70-1"	"Q8BX70-1 [470-479]"	""	"1"	"1227.60579"	"117.696"	"1.524"	"0.940224683987853"	"0.937945192250145"	"77.47"	"111.27"	"2.5"	"292.6"	"5.0"	"74.00"	"46.31"	"67.94"	"MandatoryModificationMissing"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"0.002187"	"0.01404"	"2.03"	"52.43"
"23529"	"False"	"High"	"[K].GVGKALIDTLLDGYETAR.[Y]"	"1xBiotin [K4]"	"0.14762"	"0.00850342"	"1"	"3"	"1"	"Q8R092"	"Q8R092 [148-165]"	"Q8R092 1xBiotin [K151]"	"1"	"2118.08997"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.002187"	"0.01396"	"2.32"	""
"23972"	"False"	"High"	"[K].HANSKPFEVPFLKF.[-]"	"1xBiotin [K13]"	"0.146799"	"0.00850342"	"1"	"1"	"1"	"Q9JKX6"	"Q9JKX6 [205-218]"	"Q9JKX6 1xBiotin [K217]"	"1"	"1886.96219"	"0.553"	"1.813"	"0.925138005747468"	"0.974602183325639"	"50.07"	"57.21"	"84.8"	"49.0"	"166.2"	"49.69"	"34.88"	"37.11"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01383"	"2.89"	"60.14"
"58344"	"False"	"High"	"[K].RVVFLK.[Q]"	""	"0.148446"	"0.00850342"	"1"	"1"	"4"	"P47911"	"P47911 [169-174]"	""	"1"	"761.50322"	"135.901"	"3.643"	"0.928611703535518"	"0.906515362333117"	"68.96"	"91.76"	"2.1"	"286.9"	"11.0"	"84.40"	"61.19"	"42.21"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01408"	"1.68"	"26.27"
"58275"	"False"	"High"	"[R].RVILLVK.[A]"	""	"0.146799"	"0.00850342"	"1"	"1"	"2"	"Q9DCD0"	"Q9DCD0 [70-76]"	""	"1"	"840.60293"	"156.802"	"4.071"	"0.925138005747468"	"0.906515362333117"	"77.49"	"50.41"	"2.6"	"287.3"	"10.1"	"54.13"	"71.18"	"26.98"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.0139"	"2.06"	"30.14"
"57628"	"False"	"High"	"[R].RPVLLLHPLGGWTK.[D]"	""	"0.148446"	"0.00850342"	"1"	"1"	"2"	"Q60967"	"Q60967 [446-459]"	""	"0"	"1586.95294"	"70.690"	"2.800"	"0.430383505746853"	"0.906515362333117"	"74.26"	"74.84"	"3.6"	"284.4"	"12.0"	"73.43"	"34.61"	"30.30"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01417"	"2.67"	"45.35"
"23306"	"False"	"High"	"[K].GTHFNFAIVFMDLK.[R]"	"1xOxidation [M11]"	"0.151788"	"0.00850342"	"1"	"1"	"1"	"O55128"	"O55128 [84-97]"	""	"0"	"1655.82503"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01463"	"2.73"	""
"4168"	"False"	"High"	"[K].ATGPGKK.[A]"	"1xBiotin [K6]"	"0.155195"	"0.00850342"	"1"	"1"	"2"	"Q9CR57"	"Q9CR57 [168-174]"	"Q9CR57 1xBiotin [K173]"	"1"	"884.46585"	"0.215"	"0.931"	"0.925138005747468"	"0.906515362333117"	"34.16"	"62.17"	"146.3"	"35.3"	"118.4"	"29.90"	"23.44"	"63.85"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002214"	"0.01507"	"1.83"	"19.13"
"57392"	"False"	"High"	"[K].RPAIFTYHDVGLNYK.[S]"	""	"0.152634"	"0.00850342"	"1"	"2"	"1"	"Q9QYG0"	"Q9QYG0 [62-76]"	""	"0"	"1793.93333"	"137.255"	"3.326"	"0.427089858136149"	"0.906515362333117"	"61.37"	"78.17"	"2.3"	"288.8"	"8.9"	"39.78"	"45.87"	"71.86"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.0148"	"2.62"	"39.96"
"22753"	"False"	"High"	"[R].GRIPLLLTSLSFK.[V]"	""	"0.149275"	"0.00850342"	"1"	"1"	"5"	"Q6NS46"	"Q6NS46 [1187-1199]"	""	"1"	"1444.88861"	"84.040"	"2.544"	"0.925138005747468"	"0.906515362333117"	"39.63"	"94.65"	"3.1"	"288.9"	"8.0"	"28.27"	"49.19"	"66.89"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Peak Found"	"High"	"High"	"0.002187"	"0.0142"	"2.46"	"55.70"
"4663"	"False"	"High"	"[R].AYALCVLFR.[N]"	"1xCarbamidomethyl [C5]"	"0.150109"	"0.00850342"	"1"	"4"	"1"	"Q9ES52-1"	"Q9ES52-1 [42-50]"	""	"0"	"1112.59211"	"1.866"	"1.468"	"0.925138005747468"	""	"70.22"	"51.63"	"66.5"	"128.9"	"104.5"	"45.50"	"193.40"	"34.24"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01436"	"1.80"	"53.48"
"12037"	"False"	"High"	"[R].EFLLIFR.[K]"	""	"0.155195"	"0.00850342"	"1"	"1"	"2"	"Q9D8Y0"	"Q9D8Y0 [152-158]"	""	"0"	"937.55056"	"65.425"	"0.968"	"0.477067253044389"	"0.906515362333117"	"45.10"	"49.72"	"4.5"	"290.7"	"4.8"	"38.54"	"35.21"	"43.20"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002214"	"0.0151"	"1.82"	"57.73"
"21958"	"False"	"High"	"[R].GMLYYR.[M]"	""	"0.152634"	"0.00850342"	"1"	"1"	"3"	"O70145"	"O70145 [78-83]"	""	"0"	"802.39162"	"5.377"	"3.643"	"0.525161429132432"	"0.906515362333117"	"218.86"	"56.28"	"35.5"	"127.3"	"137.2"	"54.87"	"143.33"	"19.74"	"MandatoryModificationMissing"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"0.002187"	"0.01469"	"1.52"	"31.26"
"17257"	"False"	"High"	"[K].FFGLLAGR.[F]"	""	"0.155195"	"0.00850342"	"1"	"2"	"10"	"Q8C5N3-1"	"Q8C5N3-1 [505-512]"	""	"0"	"880.50395"	"154.818"	"4.451"	"0.771831764609108"	"0.906515362333117"	"66.99"	"61.61"	"1.7"	"290.6"	"7.7"	"57.75"	"31.31"	"18.06"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"0.002214"	"0.01517"	"1.81"	"48.94"
"21578"	"False"	"High"	"[R].GLMKPPSLSK.[R]"	"1xBiotin [K4]; 1xOxidation [M3]"	"0.148446"	"0.00850342"	"1"	"2"	"2"	"Q8BH73"	"Q8BH73 [17-26]"	"Q8BH73 1xBiotin [K20]"	"0"	"1299.67994"	"0.369"	"0.553"	"0.925138005747468"	"0.906515362333117"	"64.22"	"58.82"	"158.7"	"53.6"	"87.8"	"53.39"	"24.97"	"40.69"	""	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01409"	"1.50"	"37.80"
"27223"	"False"	"High"	"[R].KGWIPR.[L]"	""	"0.150109"	"0.00850342"	"1"	"1"	"5"	"Q9CSN1"	"Q9CSN1 [48-53]"	""	"1"	"756.45152"	"97.372"	"3.117"	"0.925138005747468"	"0.906515362333117"	"79.55"	"80.71"	"3.5"	"282.5"	"13.9"	"69.23"	"100.03"	"44.09"	"MandatoryModificationMissing"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01441"	"1.76"	"24.56"
"28124"	"False"	"High"	"[R].KLSGFLR.[T]"	""	"0.150946"	"0.00850342"	"1"	"1"	"1"	"Q8CD15"	"Q8CD15 [307-313]"	""	"1"	"820.50395"	"125.416"	"1.007"	"0.379580591663705"	""	"58.58"	"41.72"	"2.7"	"294.4"	"2.9"	"38.19"	"74.18"	"25.78"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01453"	"2.12"	"29.12"
"13736"	"False"	"High"	"[K].EIISEVQR.[M]"	""	"0.150109"	"0.00850342"	"1"	"1"	"1"	"Q7SIG6-1"	"Q7SIG6-1 [425-432]"	""	"0"	"973.53129"	"0.847"	"0.813"	"0.0802596334022458"	""	"87.09"	"65.74"	"112.8"	"99.6"	"87.6"	"46.21"	"241.94"	"44.43"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01443"	"1.93"	"32.90"
"17856"	"False"	"High"	"[R].FLLLFTFLKK.[N]"	""	"0.155195"	"0.00850342"	"1"	"1"	"2"	"Q8K363"	"Q8K363 [403-412]"	""	"1"	"1269.79694"	"48.023"	"0.836"	"0.59812663870404"	"0.906515362333117"	"106.22"	"57.19"	"6.8"	"288.3"	"4.9"	"39.30"	"82.23"	"39.10"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.002214"	"0.01519"	"1.93"	"62.52"
"20512"	"False"	"High"	"[R].GFQYYR.[A]"	""	"0.145982"	"0.00850342"	"1"	"1"	"1"	"Q78JE5"	"Q78JE5 [329-334]"	""	"0"	"833.39406"	"172.285"	"0.965"	"0.925138005747468"	"0.906515362333117"	"95.50"	"74.59"	"1.8"	"296.4"	"1.8"	"76.37"	"65.07"	"58.36"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01379"	"1.47"	"28.75"
"38127"	"False"	"High"	"[K].LSLMPWFHGK.[I]"	""	"0.149275"	"0.00850342"	"1"	"4"	"1"	"P41241"	"P41241 [77-86]"	""	"0"	"1215.63431"	"52.715"	"4.935"	"0.478573781684308"	"0.906515362333117"	"142.94"	"66.18"	"5.1"	"267.1"	"27.9"	"46.89"	"101.42"	"52.00"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.0143"	"1.86"	"50.97"
"37524"	"False"	"High"	"[R].IQVVGTYR.[C]"	""	"0.149275"	"0.00850342"	"1"	"1"	"4"	"P25206"	"P25206 [235-242]"	""	"0"	"935.53089"	"66.805"	"1.229"	"0.58073776037668"	"0.906515362333117"	"114.67"	"87.01"	"5.6"	"290.3"	"4.1"	"50.79"	"85.41"	"98.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01428"	"2.11"	"28.17"
"35129"	"False"	"High"	"[R].LLNILMQLR.[K]"	"1xOxidation [M6]"	"0.145168"	"0.00850342"	"1"	"3"	"1"	"Q6PGB8"	"Q6PGB8 [453-461]"	""	"0"	"1129.67618"	"85.041"	"1.565"	"0.46793915438748"	""	"42.56"	"42.50"	"3.4"	"290.7"	"5.9"	"29.39"	"53.05"	"36.47"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002177"	"0.01361"	"2.10"	"53.22"
"35055"	"False"	"High"	"[K].ILLWSGR.[F]"	""	"0.153483"	"0.00850342"	"1"	"1"	"9"	"Q9D6U8"	"Q9D6U8 [71-77]"	""	"0"	"844.50395"	"175.419"	"4.878"	"0.925138005747468"	"0.906515362333117"	"23.89"	"25.22"	"1.7"	"290.3"	"8.0"	"18.84"	"18.25"	"44.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"High"	"High"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002187"	"0.01489"	"1.55"	"43.14"
"35023"	"False"	"High"	"[K].IILTAQPFR.[L]"	""	"0.145982"	"0.00850342"	"1"	"2"	"1"	"Q8BHN3"	"Q8BHN3 [149-157]"	""	"0"	"1058.63569"	"8.110"	"0.716"	"0.992801922882858"	""	"222.60"	"58.34"	"36.6"	"242.1"	"21.3"	"43.00"	"105.22"	"44.05"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002177"	"0.01373"	"1.98"	"41.48"
"34473"	"False"	"High"	"[R].ILGADTSVDLEETGR.[V]"	""	"0.155195"	"0.00850342"	"1"	"1"	"1"	"Q03265"	"Q03265 [59-73]"	""	"0"	"1575.78606"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002214"	"0.01507"	"1.64"	""
"33868"	"False"	"High"	"[R].LKQDYLR.[I]"	"1xBiotin [K2]"	"0.144358"	"0.00850342"	"1"	"1"	"3"	"Q6P073"	"Q6P073 [17-23]"	"Q6P073 1xBiotin [K18]"	"1"	"1161.60849"	"0.198"	"0.762"	"0.925138005747468"	"0.906515362333117"	"45.69"	"38.31"	"155.6"	"29.5"	"115.0"	"33.34"	"39.38"	"13.47"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002177"	"0.01359"	"1.52"	"37.70"
"19046"	"False"	"High"	"[K].FWKMPAEENLK.[E]"	"1xBiotin [K3]"	"0.155195"	"0.00850342"	"1"	"2"	"3"	"Q8R570"	"Q8R570 [183-193]"	"Q8R570 1xBiotin [K185]"	"1"	"1618.77563"	"0.526"	"0.822"	"0.927805988299929"	"0.906515362333117"	"36.07"	"54.00"	"124.7"	"69.5"	"105.7"	"34.28"	"28.63"	"56.63"	""	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.002214"	"0.01517"	"2.18"	"49.85"
"33630"	"False"	"High"	"[K].LKEIVTNFLAGFEP.[-]"	""	"0.144358"	"0.00850342"	"1"	"1"	"5"	"Q03265"	"Q03265 [540-553]"	""	"1"	"1577.85737"	"196.677"	"11.403"	"0.716607214650224"	"0.906515362333117"	"78.62"	"62.87"	"1.3"	"283.7"	"15.0"	"33.40"	"63.47"	"63.32"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"High"	"0.002149"	"0.01352"	"2.70"	"61.61"
"33347"	"False"	"High"	"[R].LHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGK.[R]"	"1xBiotin [K3]; 1xCarbamidomethyl [C33]"	"0.144358"	"0.00850342"	"1"	"2"	"3"	"P97287"	"P97287 [78-117]"	"P97287 1xBiotin [K80]"	"1"	"4310.10292"	"0.918"	"1.770"	""	"0.94306020666367"	"68.03"	"76.90"	"75.5"	"98.4"	"126.2"	"39.54"	"48.35"	"71.25"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Not Found"	"High"	"High"	"Peak Found"	"High"	"0.002177"	"0.01355"	"2.54"	"63.57"
"19150"	"False"	"High"	"[R].FYNLVLLPR.[V]"	""	"0.151788"	"0.00850342"	"1"	"1"	"1"	"O54825"	"O54825 [248-256]"	""	"0"	"1134.66699"	"115.974"	"1.266"	"0.431625879740687"	"0.906515362333117"	"50.55"	"51.75"	"2.9"	"293.1"	"4.0"	"31.07"	"42.39"	"41.14"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"0.002187"	"0.01458"	"1.86"	"53.34"
"33006"	"False"	"High"	"[R].LGLIPEEFFQFLYPK.[T]"	""	"0.154337"	"0.00850342"	"1"	"1"	"1"	"Q9CQQ7"	"Q9CQQ7 [56-70]"	""	"0"	"1840.98838"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01498"	"2.02"	""
"20807"	"False"	"High"	"[K].GGPLSDSYR.[L]"	""	"0.149275"	"0.00850342"	"1"	"1"	"3"	"P00920"	"P00920 [81-89]"	""	"0"	"951.45304"	"174.240"	"6.453"	"0.925138005747468"	"0.906515362333117"	"91.84"	"43.90"	"1.6"	"287.8"	"10.5"	"35.77"	"82.84"	"54.58"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01423"	"1.52"	"24.93"
"736"	"False"	"High"	"[R].AEATQDLASGASASSADPMIPGVLGGAEGPMAK.[K]"	"2xOxidation [M19; M31]"	"0.150109"	"0.00850342"	"1"	"1"	"1"	"Q921J4"	"Q921J4 [166-198]"	""	"0"	"3089.44017"	"1.063"	"49.220"	""	"0.0412650142443358"	"48.62"	"65.28"	"7.0"	"6.5"	"286.5"	"37.75"	"35.88"	"60.80"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01431"	"2.19"	"31.34"
"39384"	"False"	"High"	"[R].IVSQLLTLMDGLK.[Q]"	"1xOxidation [M9]"	"0.145168"	"0.00850342"	"1"	"1"	"2"	"Q01853"	"Q01853 [324-336]"	""	"0"	"1446.82363"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002177"	"0.01367"	"2.88"	""
"72757"	"False"	"High"	"[K].YYYSWK.[K]"	""	"0.146799"	"0.00850342"	"1"	"3"	"3"	"Q6PGA0"	"Q6PGA0 [182-187]"	""	"0"	"909.41413"	"163.177"	"5.533"	"0.423976448584242"	"0.906515362333117"	"50.29"	"73.62"	"2.0"	"289.6"	"8.4"	"35.82"	"38.07"	"74.44"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01392"	"1.47"	"35.75"
"25392"	"False"	"High"	"[R].HYELYR.[R]"	""	"0.152634"	"0.00850342"	"1"	"10"	"1"	"Q8C650-1"	"Q8C650-1 [291-296]"	""	"0"	"880.43118"	"81.806"	"3.498"	"0.861442719681534"	"0.906515362333117"	"86.95"	"84.89"	"4.0"	"285.4"	"10.6"	"47.27"	"70.36"	"71.13"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01479"	"1.34"	"22.38"
"71927"	"False"	"High"	"[R].YLTVAAIFR.[G]"	""	"0.145982"	"0.00850342"	"1"	"2"	"3"	"Q7TMM9"	"Q7TMM9 [310-318]"	""	"0"	"1053.60914"	"99.265"	"1.792"	"0.386257319295821"	"0.998099211977233"	"33.70"	"46.21"	"2.9"	"291.6"	"5.5"	"33.19"	"26.01"	"31.65"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002187"	"0.01379"	"1.46"	"53.22"
"14701"	"False"	"High"	"[K].ENPGFDFSGAEISGNYTKGGPDFSNLEK.[-]"	"1xBiotin [K18]"	"0.146799"	"0.00850342"	"1"	"1"	"1"	"Q9CQ48"	"Q9CQ48 [130-157]"	"Q9CQ48 1xBiotin [K147]"	"1"	"3203.42623"	"0.714"	"3.301"	""	"0.906515362333117"	"55.72"	"62.37"	"61.7"	"35.0"	"203.3"	"26.74"	"39.87"	"54.99"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"High"	"0.002187"	"0.0139"	"2.59"	"55.55"
"14306"	"False"	"High"	"[R].EMHKTLK.[L]"	"1xBiotin [K4]"	"0.151788"	"0.00850342"	"1"	"1"	"3"	"B1AVY7"	"B1AVY7 [1221-1227]"	"B1AVY7 1xBiotin [K1224]"	"1"	"1112.55910"	"0.027"	"0.809"	"5.1926043445364E-05"	"0.906515362333117"	"77.43"	"80.88"	"178.3"	"4.7"	"117.1"	"57.41"	"37.78"	"65.93"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002187"	"0.01461"	"2.12"	"23.04"
"50201"	"False"	"High"	"[R].NHQLYKPYTNGIIAKDPTSLEEEIK.[E]"	"1xBiotin [K15]"	"0.149275"	"0.00850342"	"1"	"1"	"1"	"Q8K2C8"	"Q8K2C8 [69-93]"	"Q8K2C8 1xBiotin [K83]"	"1"	"3127.57686"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01424"	"3.06"	""
"48939"	"False"	"High"	"[-].MVNPEMYK.[L]"	"1xMet-loss [N-Term]"	"0.155195"	"0.00850342"	"1"	"1"	"1"	"Q8BV79-2"	"Q8BV79-2 [1-8]"	"Q8BV79-2 1xMet-loss [N-Term]"	"0"	"880.42331"	"0.056"	"0.645"	"0.0027048566206556"	"0.906515362333117"	"61.58"	"42.98"	"175.9"	"10.6"	"113.5"	"46.39"	"50.47"	"35.32"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002214"	"0.01508"	"1.47"	"23.75"
"50062"	"False"	"High"	"[R].NGIDLLMK.[Y]"	"1xBiotin [K8]; 1xOxidation [M7]"	"0.150109"	"0.00850342"	"1"	"1"	"4"	"Q9D898"	"Q9D898 [103-110]"	"Q9D898 1xBiotin [K110]"	"0"	"1145.56933"	"76.319"	"0.666"	"0.994201151226993"	"0.906515362333117"	"68.13"	"95.39"	"4.2"	"292.8"	"3.0"	"45.58"	"53.80"	"151.36"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002187"	"0.01442"	"2.20"	"19.97"
"51676"	"False"	"High"	"[K].NSWGSNWGESGYFR.[I]"	""	"0.146799"	"0.00850342"	"1"	"1"	"1"	"P97821"	"P97821 [426-439]"	""	"0"	"1646.69824"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002187"	"0.01387"	"2.21"	""
"21568"	"False"	"High"	"[K].GILVQTKGTGASGSFK.[L]"	"1xBiotin [K7]"	"0.145168"	"0.00850342"	"1"	"1"	"2"	"P15864"	"P15864 [91-106]"	"P15864 1xBiotin [K97]"	"1"	"1776.93128"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002177"	"0.01368"	"2.42"	""
"51542"	"False"	"High"	"[K].NSLESYAFNMK.[A]"	"1xOxidation [M10]"	"0.145982"	"0.00850342"	"1"	"1"	"1"	"P63017"	"P63017 [540-550]"	""	"0"	"1319.59363"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002177"	"0.01377"	"1.99"	""
"53729"	"False"	"High"	"[R].QLDKALDDSR.[F]"	"1xBiotin [K4]"	"0.156057"	"0.00878945"	"1"	"4"	"1"	"Q6ZWR6-1"	"Q6ZWR6-1 [8340-8349]"	"Q6ZWR6-1 1xBiotin [K8343]"	"1"	"1386.66819"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"High"	"0.002214"	"0.01521"	"1.86"	""
"21901"	"False"	"High"	"[R].GMGLSLMR.[L]"	"2xOxidation [M2; M7]"	"0.156057"	"0.00878945"	"1"	"1"	"4"	"P19096"	"P19096 [505-512]"	""	"0"	"896.43283"	"523.880"	"2.796"	"0.912740719034667"	"0.906515362333117"	"45.41"	"35.90"	"0.5"	"297.9"	"1.5"	"32.02"	"29.67"	"19.35"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002214"	"0.01522"	"1.43"	"25.15"
"21277"	"False"	"High"	"[K].GKYFVTFPYPYMNGR.[L]"	""	"0.156057"	"0.00878945"	"1"	"1"	"2"	"Q8BMJ2"	"Q8BMJ2 [46-60]"	""	"1"	"1839.88869"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"High"	"0.002214"	"0.01524"	"2.13"	""
"50488"	"False"	"High"	"[K].NLFLVIFQR.[F]"	""	"0.159547"	"0.00904314"	"1"	"1"	"1"	"Q3UYV9"	"Q3UYV9 [708-716]"	""	"0"	"1149.67789"	"26.069"	"1.199"	"0.925138005747468"	"0.906515362333117"	"86.67"	"56.44"	"10.0"	"277.5"	"12.5"	"37.38"	"77.37"	"39.10"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"High"	"0.002298"	"0.01585"	"1.74"	"61.66"
"33944"	"False"	"High"	"[R].LKSSTSFANIQENAT.[-]"	"1xBiotin [K2]"	"0.156923"	"0.00904314"	"1"	"1"	"2"	"Q8BGT0"	"Q8BGT0 [324-338]"	"Q8BGT0 1xBiotin [K325]"	"1"	"1836.87964"	"0.181"	"0.576"	"0.925138005747468"	"0.906515362333117"	"49.63"	"55.50"	"161.7"	"33.0"	"105.3"	"46.94"	"41.32"	"39.20"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002245"	"0.01535"	"2.14"	"44.40"
"19694"	"False"	"High"	"[R].GCTATLGNFAK.[A]"	"1xCarbamidomethyl [C2]"	"0.159547"	"0.00904314"	"1"	"1"	"1"	"P25444"	"P25444 [228-238]"	""	"0"	"1139.55137"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002298"	"0.01584"	"2.17"	""
"31806"	"False"	"High"	"[K].LDVQFSGLAKGDAVR.[D]"	"1xBiotin [K10]"	"0.16043"	"0.00904314"	"1"	"1"	"3"	"Q8BTM8"	"Q8BTM8 [907-921]"	"Q8BTM8 1xBiotin [K916]"	"1"	"1801.92653"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.002298"	"0.01597"	"1.40"	""
"46572"	"False"	"High"	"[K].MPIVGLGTWK.[S]"	"1xOxidation [M1]"	"0.16043"	"0.00904314"	"1"	"2"	"3"	"P45377"	"P45377 [13-22]"	""	"0"	"1117.60743"	"103.588"	"0.667"	"0.477067253044389"	"0.906515362333117"	"45.33"	"56.11"	"3.0"	"295.1"	"2.0"	"31.14"	"32.99"	"64.15"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002298"	"0.01588"	"1.87"	"43.24"
"26711"	"False"	"High"	"[R].KFGFIGFK.[S]"	""	"0.16043"	"0.00904314"	"1"	"2"	"1"	"Q8R3C6-1"	"Q8R3C6-1 [43-50]"	""	"1"	"943.54000"	"414.801"	"10.844"	"0.925138005747468"	"0.906515362333117"	"48.48"	"49.06"	"0.8"	"290.6"	"8.6"	"47.96"	"38.80"	"28.57"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002298"	"0.01597"	"2.42"	"42.64"
"70960"	"False"	"High"	"[K].YALVWGLSVK.[H]"	""	"0.156923"	"0.00904314"	"1"	"1"	"3"	"P32233"	"P32233 [335-344]"	""	"0"	"1135.65101"	"31.060"	"1.334"	"0.925138005747468"	"0.906515362333117"	"139.00"	"67.97"	"6.4"	"284.9"	"8.7"	"51.45"	"75.47"	"43.69"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.002245"	"0.01533"	"1.95"	"52.72"
"44800"	"False"	"High"	"[K].MICAGYKEGGK.[D]"	"2xBiotin [K7; K11]; 1xCarbamidomethyl [C3]; 1xOxidation [M1]"	"0.16043"	"0.00904314"	"1"	"1"	"2"	"Q91Y47"	"Q91Y47 [557-567]"	"Q91Y47 2xBiotin [K563; K567]"	"1"	"1681.72050"	"32.867"	"0.890"	"0.925138005747468"	"0.906515362333117"	"39.92"	"69.57"	"9.5"	"282.6"	"7.9"	"51.80"	"25.66"	"65.87"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002298"	"0.01587"	"1.51"	"36.23"
"47107"	"False"	"High"	"[R].MRDGACK.[L]"	"1xBiotin [K7]; 1xCarbamidomethyl [C6]"	"0.158668"	"0.00904314"	"1"	"2"	"1"	"Q8C6B2-1"	"Q8C6B2-1 [51-57]"	"Q8C6B2-1 1xBiotin [K57]"	"1"	"1063.44817"	"38.488"	"0.882"	"0.925138005747468"	"0.906515362333117"	"35.76"	"46.11"	"7.2"	"286.9"	"5.9"	"27.86"	"25.84"	"38.04"	""	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002273"	"0.01566"	"1.32"	"46.62"
"38479"	"False"	"High"	"[K].LSVTKPVLQSATR.[S]"	"1xBiotin [K5]"	"0.16043"	"0.00904314"	"1"	"1"	"2"	"F6VAN0"	"F6VAN0 [273-285]"	"F6VAN0 1xBiotin [K277]"	"0"	"1625.90434"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.002298"	"0.01591"	"1.58"	""
"21386"	"False"	"High"	"[K].GLFKGGDMSK.[N]"	"1xBiotin [K4]; 1xOxidation [M8]"	"0.157794"	"0.00904314"	"1"	"1"	"2"	"P14576-1"	"P14576-1 [439-448]"	"P14576-1 1xBiotin [K442]"	"1"	"1281.59660"	"31.347"	"0.884"	"0.589118055222845"	"0.906515362333117"	"68.89"	"44.91"	"10.3"	"281.2"	"8.6"	"23.96"	"84.20"	"49.63"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002273"	"0.01555"	"2.27"	"37.67"
"64389"	"False"	"High"	"[R].TKQTAR.[K]"	"1xBiotin [K2]"	"0.16043"	"0.00904314"	"1"	"3"	"2"	"P84244"	"P84244 [4-9]"	"P84244 1xBiotin [K5]"	"1"	"930.48256"	"0.448"	"0.811"	"0.925138005747468"	"0.906515362333117"	"57.79"	"73.33"	"143.3"	"56.4"	"100.3"	"29.88"	"41.47"	"60.23"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002298"	"0.01594"	"1.96"	"16.94"
"38887"	"False"	"High"	"[K].ITSWFLSK.[G]"	""	"0.16043"	"0.00904314"	"1"	"6"	"1"	"Q9ES52-1"	"Q9ES52-1 [425-432]"	""	"0"	"981.54039"	"0.509"	"1.498"	"0.925138005747468"	"0.971511797192901"	"63.08"	"70.36"	"98.9"	"55.5"	"145.6"	"56.06"	"39.90"	"35.36"	"MandatoryModificationMissing"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002298"	"0.01595"	"1.90"	"46.24"
"40607"	"False"	"High"	"[-].MAGLLTLLGPAGR.[V]"	"1xMet-loss [N-Term]"	"0.159547"	"0.00904314"	"1"	"1"	"1"	"Q9D8B6"	"Q9D8B6 [1-13]"	"Q9D8B6 1xMet-loss [N-Term]"	"0"	"1138.69427"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002298"	"0.01582"	"1.37"	""
"28757"	"False"	"High"	"[R].KPAVTKGR.[S]"	"1xBiotin [K6]"	"0.157794"	"0.00904314"	"1"	"1"	"1"	"Q91V04"	"Q91V04 [337-344]"	"Q91V04 1xBiotin [K342]"	"1"	"1082.61391"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"0.002273"	"0.01556"	"2.28"	""
"70661"	"False"	"High"	"[R].WQFTLPMMSTLYR.[L]"	"1xOxidation [M]"	"0.161317"	"0.00960234"	"1"	"1"	"3"	"Q99PV0"	"Q99PV0 [228-240]"	""	"0"	"1689.81275"	"1.544"	"1.226"	"0.925138005747468"	"0.906515362333117"	"61.73"	"45.26"	"82.9"	"124.4"	"92.7"	"35.02"	"205.03"	"31.41"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Peak Found"	"High"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"High"	"0.002298"	"0.01601"	"1.90"	"60.15"
"33534"	"False"	"High"	"[K].LKAQER.[A]"	"1xBiotin [K2]"	"0.162208"	"0.00960234"	"1"	"2"	"2"	"Q8BFW3-1"	"Q8BFW3-1 [154-159]"	"Q8BFW3-1 1xBiotin [K155]"	"1"	"970.51386"	"0.127"	"0.957"	"0.00764559733814101"	"0.906515362333117"	"38.91"	"57.97"	"157.9"	"19.9"	"122.1"	"25.07"	"33.32"	"62.01"	""	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002355"	"0.01619"	"1.30"	"21.60"
"28031"	"False"	"High"	"[K].KLPGIIAR.[I]"	"1xBiotin [K1]"	"0.161317"	"0.00960234"	"1"	"1"	"1"	"Q91VF2"	"Q91VF2 [39-46]"	"Q91VF2 1xBiotin [K39]"	"1"	"1093.65505"	"38.892"	"0.626"	"0.925138005747468"	"0.906515362333117"	"74.55"	"101.19"	"6.4"	"290.0"	"3.6"	"57.13"	"26.81"	"33.57"	""	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.00233"	"0.01609"	"1.61"	"56.42"
"70811"	"False"	"High"	"[K].WTNLLYK.[A]"	""	"0.161317"	"0.00960234"	"1"	"1"	"1"	"P70279"	"P70279 [264-270]"	""	"0"	"937.51418"	"122.994"	"2.483"	"0.455173944416713"	"0.943485193068069"	"85.54"	"63.53"	"2.4"	"292.6"	"5.0"	"35.39"	"60.26"	"48.68"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002298"	"0.01608"	"1.69"	"40.52"
"34396"	"False"	"High"	"[K].LIESKENLKTELK.[K]"	"2xBiotin [K9; K13]"	"0.161317"	"0.00960234"	"1"	"1"	"1"	"Q61334"	"Q61334 [179-191]"	"Q61334 2xBiotin [K187; K191]"	"2"	"1997.04460"	"184.526"	"1.660"	"0.425904733810833"	"0.974830968163667"	"147.46"	"56.99"	"1.5"	"296.1"	"2.5"	"39.88"	"94.44"	"134.28"	""	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002355"	"0.01614"	"2.44"	"33.63"
"29277"	"False"	"High"	"[K].KQNMILSDEAVK.[Y]"	"1xBiotin [K1]; 1xOxidation [M4]"	"0.163103"	"0.00960234"	"1"	"2"	"1"	"Q8BI84-1"	"Q8BI84-1 [1280-1291]"	"Q8BI84-1 1xBiotin [K1280]"	"1"	"1617.79749"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"High"	"0.002355"	"0.01641"	"1.81"	""
"25375"	"False"	"High"	"[K].HWMLHFPR.[V]"	"1xOxidation [M3]"	"0.161317"	"0.00960234"	"1"	"1"	"1"	"Q91VX9"	"Q91VX9 [638-645]"	""	"0"	"1139.55673"	"49.763"	"0.883"	"0.471781850843532"	"0.906515362333117"	"60.19"	"46.79"	"5.7"	"289.2"	"5.1"	"16.56"	"80.28"	"57.49"	"MandatoryModificationMissing"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"High"	"Peak Found"	"Not Found"	"Not Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002298"	"0.01603"	"1.70"	"37.90"
"30558"	"False"	"High"	"[K].KYEAQPLDLDACSQDEGAVISK.[I]"	"1xBiotin [K1]; 1xCarbamidomethyl [C12]"	"0.161317"	"0.00960234"	"1"	"2"	"1"	"Q6Y685-2"	"Q6Y685-2 [62-83]"	"Q6Y685-2 1xBiotin [K62]"	"1"	"2663.23274"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"0.002355"	"0.01614"	"3.04"	""
"69213"	"False"	"High"	"[K].VSKEIFNK.[A]"	"1xBiotin [K3]"	"0.162208"	"0.00960234"	"1"	"1"	"1"	"Q9CRA8"	"Q9CRA8 [66-73]"	"Q9CRA8 1xBiotin [K68]"	"1"	"1190.62381"	"0.437"	"0.700"	"0.925138005747468"	"0.906515362333117"	"33.52"	"28.95"	"135.9"	"64.5"	"99.6"	"15.32"	"31.12"	"31.47"	""	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Peak Found"	"Not Found"	"Peak Found"	"Peak Found"	"High"	"High"	"0.002355"	"0.01628"	"1.49"	"39.75"
"236"	"False"	"High"	"[K].AALYAAPYKSDFLK.[A]"	"1xBiotin [K9]"	"0.164907"	"0.00988516"	"1"	"1"	"4"	"Q9JL62"	"Q9JL62 [150-163]"	"Q9JL62 1xBiotin [K158]"	"1"	"1783.90875"	""	""	""	""	""	""	""	""	""	""	""	""	"NoQuanValues"	"Not Found"	"Not Found"	"High"	"High"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"Not Found"	"High"	"Not Found"	"Not Found"	"High"	"High"	"0.002385"	"0.01669"	"2.71"	""
"4646"	"False"	"High"	"[R].AWNPFR.[S]"	""	"0.164003"	"0.00988516"	"1"	"1"	"5"	"P35550"	"P35550 [142-147]"	""	"0"	"790.39948"	"127.530"	"3.270"	"0.925138005747468"	"0.906515362333117"	"62.02"	"76.53"	"2.3"	"292.2"	"5.5"	"47.79"	"47.24"	"73.37"	"MandatoryModificationMissing"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"High"	"High"	"0.002355"	"0.01646"	"1.81"	"40.45"
"16571"	"False"	"High"	"[R].EVNGILMSK.[M]"	"1xBiotin [K9]; 1xOxidation [M7]"	"0.164907"	"0.00988516"	"1"	"1"	"3"	"Q80VR3"	"Q80VR3 [22-30]"	"Q80VR3 1xBiotin [K30]"	"0"	"1232.60136"	"110.682"	"0.773"	"0.929016530787821"	"0.906515362333117"	"104.03"	"84.11"	"2.3"	"295.6"	"2.1"	"65.77"	"86.57"	"59.91"	""	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"High"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"Peak Found"	"High"	"0.002385"	"0.01667"	"2.51"	"20.07"