MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000589-3,6,9 -- main-final
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220609\20220609110748149053^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121108tm_007_P_Org3.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220609\20220609110748149053^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\121108tm_007_P_Org3.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6)15N(4) (R),Label:2H(4) (K),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Label:13C(6)15N(4) (R),Label:2H(4) (K)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6)15N(4) (R),Label:2H(4) (K),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[1]-site	R
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:481, Label:2H(4),]
MTD	variable_mod[2]-site	K
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	5-UNIMOD:21	0.04	51.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	57-UNIMOD:21,67-UNIMOD:267,129-UNIMOD:21	0.31	51.0	8	4	2
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	333-UNIMOD:21,354-UNIMOD:267	0.06	51.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	813-UNIMOD:21,815-UNIMOD:21,817-UNIMOD:21,819-UNIMOD:21	0.03	49.0	1	1	1
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	171-UNIMOD:21	0.03	48.0	2	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	116-UNIMOD:21,118-UNIMOD:21,257-UNIMOD:267,267-UNIMOD:21,280-UNIMOD:481,126-UNIMOD:267,44-UNIMOD:267,50-UNIMOD:35,52-UNIMOD:21,53-UNIMOD:21,64-UNIMOD:481	0.15	48.0	11	3	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	1517-UNIMOD:21,1519-UNIMOD:21,1527-UNIMOD:481,1521-UNIMOD:21,1528-UNIMOD:481	0.01	48.0	4	3	2
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	73-UNIMOD:21,75-UNIMOD:481,93-UNIMOD:481,69-UNIMOD:21	0.14	48.0	2	1	0
PRT	sp|Q86VR2-2|RETR3_HUMAN	Isoform 2 of Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	238-UNIMOD:21,245-UNIMOD:21,269-UNIMOD:267	0.12	48.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	48.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	48.0	3	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	48.0	null	259-UNIMOD:21	0.08	48.0	3	1	0
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.14	47.0	4	1	0
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	60-UNIMOD:21,67-UNIMOD:481	0.04	47.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	846-UNIMOD:21,847-UNIMOD:21,861-UNIMOD:267	0.03	47.0	1	1	1
PRT	sp|Q6ZRP7|QSOX2_HUMAN	Sulfhydryl oxidase 2 OS=Homo sapiens OX=9606 GN=QSOX2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	578-UNIMOD:21	0.04	46.0	2	2	2
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	539-UNIMOD:21,158-UNIMOD:21,160-UNIMOD:21	0.03	46.0	2	2	2
PRT	sp|P98175-2|RBM10_HUMAN	Isoform 2 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	735-UNIMOD:21,737-UNIMOD:21,743-UNIMOD:267	0.02	46.0	2	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	125-UNIMOD:21,126-UNIMOD:21,119-UNIMOD:481,131-UNIMOD:481,139-UNIMOD:481,101-UNIMOD:4	0.18	46.0	3	3	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	651-UNIMOD:21,653-UNIMOD:21,427-UNIMOD:21,432-UNIMOD:21,436-UNIMOD:21,627-UNIMOD:21,632-UNIMOD:21	0.07	46.0	6	3	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	189-UNIMOD:481,193-UNIMOD:481,104-UNIMOD:4,125-UNIMOD:21	0.27	46.0	3	2	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46.0	null	66-UNIMOD:21,67-UNIMOD:21,71-UNIMOD:267,86-UNIMOD:267	0.04	46.0	1	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	142-UNIMOD:481,145-UNIMOD:21,153-UNIMOD:21,175-UNIMOD:35,176-UNIMOD:481	0.05	46.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	46.0	null		0.09	46.0	6	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	42-UNIMOD:4,44-UNIMOD:21,46-UNIMOD:21,43-UNIMOD:21	0.05	45.0	2	1	0
PRT	sp|Q99549|MPP8_HUMAN	M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	51-UNIMOD:21	0.02	45.0	2	1	0
PRT	sp|Q96EZ8-4|MCRS1_HUMAN	Isoform 4 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	91-UNIMOD:21	0.07	45.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	247-UNIMOD:21	0.09	45.0	3	1	0
PRT	sp|Q15149-4|PLEC_HUMAN	Isoform 4 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	4485-UNIMOD:21,4490-UNIMOD:267,4249-UNIMOD:21,4264-UNIMOD:267,4247-UNIMOD:21,21-UNIMOD:21,31-UNIMOD:267	0.01	45.0	4	3	2
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	102-UNIMOD:21,105-UNIMOD:21,109-UNIMOD:35,99-UNIMOD:481	0.18	45.0	35	3	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	576-UNIMOD:21,586-UNIMOD:267	0.03	45.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	17-UNIMOD:21,14-UNIMOD:267,15-UNIMOD:21,37-UNIMOD:267	0.14	45.0	2	2	2
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	90-UNIMOD:21,18-UNIMOD:21,31-UNIMOD:4	0.05	45.0	2	2	2
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	45.0	null	260-UNIMOD:21,257-UNIMOD:267,281-UNIMOD:481	0.06	45.0	2	1	0
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	108-UNIMOD:4,116-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	259-UNIMOD:21,261-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1365-UNIMOD:21,1372-UNIMOD:481,1379-UNIMOD:481	0.02	44.0	6	1	0
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1119-UNIMOD:21	0.02	44.0	2	1	0
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	715-UNIMOD:21,717-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1464-UNIMOD:21	0.02	44.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	214-UNIMOD:21,207-UNIMOD:481,224-UNIMOD:481,164-UNIMOD:21,133-UNIMOD:35,135-UNIMOD:21,137-UNIMOD:21,145-UNIMOD:481,160-UNIMOD:481,172-UNIMOD:481,113-UNIMOD:21	0.06	44.0	10	6	3
PRT	sp|Q9H0G5|NSRP1_HUMAN	Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=NSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	33-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	44.0	null	132-UNIMOD:21,133-UNIMOD:21,138-UNIMOD:481,146-UNIMOD:481,126-UNIMOD:481	0.09	44.0	2	2	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	null	2-UNIMOD:1,17-UNIMOD:481,18-UNIMOD:21,21-UNIMOD:481,22-UNIMOD:481,11-UNIMOD:21	0.10	44.0	4	2	0
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	null	743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4	0.04	44.0	1	1	1
PRT	sp|Q92766-5|RREB1_HUMAN	Isoform 5 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1174-UNIMOD:21,1175-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	66-UNIMOD:21,67-UNIMOD:21,74-UNIMOD:21,158-UNIMOD:21	0.18	43.0	10	2	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	234-UNIMOD:481,247-UNIMOD:21,254-UNIMOD:481	0.08	43.0	7	1	0
PRT	sp|Q16637-4|SMN_HUMAN	Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	28-UNIMOD:21,31-UNIMOD:21,25-UNIMOD:21,41-UNIMOD:481	0.08	43.0	3	2	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|O14745-2|NHRF1_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	134-UNIMOD:21,149-UNIMOD:481	0.09	43.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	307-UNIMOD:21,309-UNIMOD:21,431-UNIMOD:21,435-UNIMOD:21,436-UNIMOD:21,422-UNIMOD:481,429-UNIMOD:481,442-UNIMOD:481	0.05	43.0	3	3	3
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	121-UNIMOD:21	0.08	43.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	271-UNIMOD:21	0.04	43.0	1	1	0
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	359-UNIMOD:4,365-UNIMOD:21,368-UNIMOD:21,373-UNIMOD:481	0.04	43.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	75-UNIMOD:481,78-UNIMOD:21,80-UNIMOD:21,93-UNIMOD:267	0.06	43.0	3	1	0
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	459-UNIMOD:21,461-UNIMOD:21,469-UNIMOD:4,77-UNIMOD:21	0.04	43.0	3	3	3
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,17-UNIMOD:481,18-UNIMOD:21,21-UNIMOD:481	0.10	43.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1358-UNIMOD:21,1283-UNIMOD:21,1252-UNIMOD:267,1257-UNIMOD:21,1268-UNIMOD:481	0.04	42.0	3	3	3
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	335-UNIMOD:21,336-UNIMOD:21,353-UNIMOD:481	0.03	42.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	5752-UNIMOD:21,5765-UNIMOD:481,5763-UNIMOD:21,212-UNIMOD:21,216-UNIMOD:21,225-UNIMOD:267,134-UNIMOD:481,135-UNIMOD:21,149-UNIMOD:267	0.01	42.0	4	3	2
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	672-UNIMOD:21,673-UNIMOD:21,684-UNIMOD:267	0.03	42.0	12	1	0
PRT	sp|Q9BVJ6-3|UT14A_HUMAN	Isoform 3 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	29-UNIMOD:21,31-UNIMOD:21	0.03	42.0	1	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	393-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	437-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	870-UNIMOD:481,872-UNIMOD:21,874-UNIMOD:21,885-UNIMOD:481	0.02	42.0	6	1	0
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	466-UNIMOD:21,474-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	69-UNIMOD:21,71-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	423-UNIMOD:21,425-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	230-UNIMOD:21,231-UNIMOD:21,247-UNIMOD:267	0.04	42.0	5	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:21,63-UNIMOD:21,73-UNIMOD:481,56-UNIMOD:481	0.10	42.0	3	2	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	641-UNIMOD:21,651-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1,11-UNIMOD:21,26-UNIMOD:267,27-UNIMOD:481	0.10	42.0	2	1	0
PRT	sp|Q9NY61|AATF_HUMAN	Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	311-UNIMOD:481,316-UNIMOD:21,320-UNIMOD:21,321-UNIMOD:21,330-UNIMOD:481,331-UNIMOD:481	0.05	42.0	2	2	2
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	null	29-UNIMOD:21,31-UNIMOD:21,41-UNIMOD:267,42-UNIMOD:481	0.02	42.0	1	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	2	1	0
PRT	sp|Q9Y5B0|CTDP1_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	869-UNIMOD:21,872-UNIMOD:21,876-UNIMOD:481	0.02	41.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	91-UNIMOD:481,102-UNIMOD:21,113-UNIMOD:267	0.12	41.0	2	1	0
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	412-UNIMOD:21,414-UNIMOD:21,400-UNIMOD:481	0.05	41.0	7	2	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	497-UNIMOD:481,502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21,517-UNIMOD:481	0.05	41.0	4	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	89-UNIMOD:481,92-UNIMOD:481,102-UNIMOD:21,103-UNIMOD:21,99-UNIMOD:21	0.19	41.0	10	1	0
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	277-UNIMOD:21,282-UNIMOD:21,296-UNIMOD:4,342-UNIMOD:21,343-UNIMOD:21,351-UNIMOD:4	0.08	41.0	2	2	2
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	138-UNIMOD:21,123-UNIMOD:21,120-UNIMOD:481,145-UNIMOD:481	0.11	41.0	6	1	0
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	4737-UNIMOD:35,4752-UNIMOD:21,4754-UNIMOD:21	0.00	41.0	1	1	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1526-UNIMOD:21,1528-UNIMOD:4	0.01	41.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	46-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	206-UNIMOD:481,214-UNIMOD:21,218-UNIMOD:481,19-UNIMOD:21,202-UNIMOD:21,204-UNIMOD:21,28-UNIMOD:267,35-UNIMOD:481	0.19	41.0	11	4	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2161-UNIMOD:21,2165-UNIMOD:21,2169-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	null	358-UNIMOD:21	0.06	41.0	1	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	312-UNIMOD:21,314-UNIMOD:21,302-UNIMOD:481,307-UNIMOD:21,323-UNIMOD:481	0.04	41.0	5	1	0
PRT	sp|Q4LE39-4|ARI4B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	471-UNIMOD:21,474-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	528-UNIMOD:267,537-UNIMOD:21,546-UNIMOD:481	0.03	40.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	315-UNIMOD:21,320-UNIMOD:21,314-UNIMOD:481,319-UNIMOD:481,333-UNIMOD:481	0.02	40.0	2	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1247-UNIMOD:21,1259-UNIMOD:481,1096-UNIMOD:481,1106-UNIMOD:21,1110-UNIMOD:481,1114-UNIMOD:481,1240-UNIMOD:481	0.03	40.0	3	3	3
PRT	sp|Q9BVV8|F174C_HUMAN	Protein FAM174C OS=Homo sapiens OX=9606 GN=FAM174C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	115-UNIMOD:35,117-UNIMOD:21,120-UNIMOD:21	0.22	40.0	1	1	1
PRT	sp|Q9BXK5-4|B2L13_HUMAN	Isoform 3 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	208-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	460-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	242-UNIMOD:21,245-UNIMOD:21,249-UNIMOD:35	0.08	40.0	4	1	0
PRT	sp|Q8N108-19|MIER1_HUMAN	Isoform 9 of Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	97-UNIMOD:21,103-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	170-UNIMOD:481,174-UNIMOD:21,185-UNIMOD:267,314-UNIMOD:21,176-UNIMOD:21	0.16	40.0	4	2	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,19-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,15-UNIMOD:21,18-UNIMOD:481	0.07	40.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,2-UNIMOD:21,20-UNIMOD:481	0.05	40.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	66-UNIMOD:21,76-UNIMOD:21,79-UNIMOD:481	0.02	40.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	494-UNIMOD:21,498-UNIMOD:481	0.04	39.0	2	1	0
PRT	sp|Q9NQ55-2|SSF1_HUMAN	Isoform 2 of Suppressor of SWI4 1 homolog OS=Homo sapiens OX=9606 GN=PPAN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	359-UNIMOD:21,369-UNIMOD:267	0.04	39.0	3	2	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	128-UNIMOD:481	0.06	39.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	229-UNIMOD:21,237-UNIMOD:4	0.10	39.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	468-UNIMOD:21,470-UNIMOD:21,477-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	395-UNIMOD:21,407-UNIMOD:267,181-UNIMOD:21,383-UNIMOD:21	0.08	39.0	4	3	2
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	120-UNIMOD:21,122-UNIMOD:21,134-UNIMOD:21,129-UNIMOD:21,135-UNIMOD:21	0.04	39.0	4	1	0
PRT	sp|Q96NB3|ZN830_HUMAN	Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	351-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	103-UNIMOD:481,108-UNIMOD:21,109-UNIMOD:21,119-UNIMOD:481,121-UNIMOD:267,223-UNIMOD:481,228-UNIMOD:21,245-UNIMOD:481	0.05	39.0	6	3	1
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	315-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|O75379|VAMP4_HUMAN	Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	30-UNIMOD:21,39-UNIMOD:267	0.12	39.0	2	1	0
PRT	sp|Q8IU60-2|DCP2_HUMAN	Isoform 2 of m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=DCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	246-UNIMOD:21,247-UNIMOD:21,249-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	123-UNIMOD:21,124-UNIMOD:21	0.14	39.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	438-UNIMOD:481,446-UNIMOD:21,450-UNIMOD:481,453-UNIMOD:21,458-UNIMOD:481	0.04	39.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	621-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	642-UNIMOD:21,645-UNIMOD:481,654-UNIMOD:481,676-UNIMOD:21,679-UNIMOD:481,687-UNIMOD:481,695-UNIMOD:481	0.06	39.0	7	2	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	106-UNIMOD:21,96-UNIMOD:481,116-UNIMOD:481	0.17	39.0	3	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	null	255-UNIMOD:481,263-UNIMOD:21,269-UNIMOD:481,270-UNIMOD:481	0.03	39.0	2	2	2
PRT	sp|O15439-4|MRP4_HUMAN	Isoform 4 of Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	571-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	93-UNIMOD:21,95-UNIMOD:21,97-UNIMOD:4,98-UNIMOD:4,91-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	698-UNIMOD:21,695-UNIMOD:481	0.02	38.0	3	1	0
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	660-UNIMOD:21,661-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	255-UNIMOD:21,263-UNIMOD:481,265-UNIMOD:481,249-UNIMOD:481	0.03	38.0	4	3	2
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2484-UNIMOD:21,2409-UNIMOD:21,2479-UNIMOD:21	0.02	38.0	3	2	1
PRT	sp|P55201-4|BRPF1_HUMAN	Isoform 4 of Peregrin OS=Homo sapiens OX=9606 GN=BRPF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	460-UNIMOD:21,462-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.18	38.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	48-UNIMOD:21,60-UNIMOD:481	0.06	38.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	362-UNIMOD:21,368-UNIMOD:21,377-UNIMOD:267,384-UNIMOD:21,391-UNIMOD:481	0.06	38.0	1	1	1
PRT	sp|O60293-2|ZC3H1_HUMAN	Isoform 2 of Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	805-UNIMOD:21,809-UNIMOD:21,1303-UNIMOD:21,1304-UNIMOD:21	0.02	38.0	2	2	2
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	234-UNIMOD:21,237-UNIMOD:4,238-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null	151-UNIMOD:21,152-UNIMOD:21,154-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,15-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,6-UNIMOD:21,8-UNIMOD:21,17-UNIMOD:4	0.08	38.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	138-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	19-UNIMOD:21,22-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	323-UNIMOD:21,328-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	19-UNIMOD:21,22-UNIMOD:481,23-UNIMOD:21,30-UNIMOD:481	0.06	37.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	93-UNIMOD:35,98-UNIMOD:21,110-UNIMOD:481	0.04	37.0	1	1	1
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	284-UNIMOD:35,290-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	416-UNIMOD:4,421-UNIMOD:21,423-UNIMOD:21	0.04	37.0	4	2	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	45-UNIMOD:21,65-UNIMOD:481	0.10	37.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	424-UNIMOD:481,426-UNIMOD:21,430-UNIMOD:481	0.03	37.0	2	1	0
PRT	sp|Q96ER3|SAAL1_HUMAN	Protein SAAL1 OS=Homo sapiens OX=9606 GN=SAAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	54-UNIMOD:21,74-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q56P03|EAPP_HUMAN	E2F-associated phosphoprotein OS=Homo sapiens OX=9606 GN=EAPP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	109-UNIMOD:21,111-UNIMOD:21,116-UNIMOD:267,122-UNIMOD:481	0.08	37.0	2	1	0
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	1-UNIMOD:1,15-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	394-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:21	0.07	36.0	1	1	0
PRT	sp|Q5M775-5|CYTSB_HUMAN	Isoform 5 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	274-UNIMOD:4,280-UNIMOD:21,283-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	606-UNIMOD:21,616-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	156-UNIMOD:21,157-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:21,25-UNIMOD:481	0.08	36.0	2	1	0
PRT	sp|P51946|CCNH_HUMAN	Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	315-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1289-UNIMOD:481,1301-UNIMOD:21,1304-UNIMOD:481	0.01	36.0	3	2	1
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	103-UNIMOD:21,106-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	208-UNIMOD:21,211-UNIMOD:21,202-UNIMOD:481,217-UNIMOD:481	0.09	36.0	3	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2100-UNIMOD:21,2102-UNIMOD:21,2104-UNIMOD:21,295-UNIMOD:21,300-UNIMOD:21,1000-UNIMOD:481,1003-UNIMOD:21,1013-UNIMOD:481,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:481,1320-UNIMOD:21,1326-UNIMOD:21,1329-UNIMOD:21,1318-UNIMOD:21,351-UNIMOD:21,353-UNIMOD:21	0.04	36.0	6	5	4
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1267-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	805-UNIMOD:21,809-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q66PJ3-7|AR6P4_HUMAN	Isoform 7 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	137-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|Q5VT52-5|RPRD2_HUMAN	Isoform 5 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	567-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	148-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1479-UNIMOD:21,1481-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O95049-5|ZO3_HUMAN	Isoform 6 of Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	869-UNIMOD:21,870-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	121-UNIMOD:21,124-UNIMOD:21,131-UNIMOD:481	0.03	36.0	1	1	1
PRT	sp|Q14669-4|TRIPC_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1047-UNIMOD:21,1052-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null	144-UNIMOD:481,162-UNIMOD:21,169-UNIMOD:481	0.10	36.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null	139-UNIMOD:21,142-UNIMOD:481,154-UNIMOD:481	0.07	36.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	16-UNIMOD:21,27-UNIMOD:481,31-UNIMOD:481	0.03	35.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	886-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	564-UNIMOD:481,569-UNIMOD:21,570-UNIMOD:21,578-UNIMOD:481	0.03	35.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	81-UNIMOD:481,86-UNIMOD:21,88-UNIMOD:21,100-UNIMOD:481,101-UNIMOD:481	0.07	35.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	27-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q12873-2|CHD3_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1593-UNIMOD:35,1601-UNIMOD:21,1605-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	121-UNIMOD:21,129-UNIMOD:481,131-UNIMOD:481	0.02	35.0	2	1	0
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	991-UNIMOD:21,994-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	330-UNIMOD:21,335-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	100-UNIMOD:21,107-UNIMOD:21,114-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1121-UNIMOD:21,1123-UNIMOD:21	0.02	35.0	2	2	2
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1037-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	213-UNIMOD:21,217-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	270-UNIMOD:21,272-UNIMOD:21,282-UNIMOD:21,260-UNIMOD:267	0.11	35.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	498-UNIMOD:481,500-UNIMOD:21,513-UNIMOD:4,514-UNIMOD:481	0.01	35.0	1	1	1
PRT	sp|Q9ULH0-5|KDIS_HUMAN	Isoform 5 of Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	293-UNIMOD:21,300-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	445-UNIMOD:21,453-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	null	306-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	188-UNIMOD:4,193-UNIMOD:21,196-UNIMOD:21,197-UNIMOD:21,198-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	160-UNIMOD:21,162-UNIMOD:21,168-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	153-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	41-UNIMOD:481,43-UNIMOD:21,63-UNIMOD:481	0.06	34.0	1	1	1
PRT	sp|Q5T200-2|ZC3HD_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	262-UNIMOD:267,263-UNIMOD:21,265-UNIMOD:21,278-UNIMOD:481	0.01	34.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	856-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	218-UNIMOD:21,225-UNIMOD:481,229-UNIMOD:267	0.06	34.0	2	2	2
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	925-UNIMOD:21,913-UNIMOD:481,933-UNIMOD:481	0.02	34.0	2	1	0
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	337-UNIMOD:35,353-UNIMOD:21,361-UNIMOD:21,364-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	601-UNIMOD:21,603-UNIMOD:21	0.04	34.0	2	2	2
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	243-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:481	0.02	34.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	42-UNIMOD:21,48-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	482-UNIMOD:21,484-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	98-UNIMOD:481,101-UNIMOD:21,104-UNIMOD:21,108-UNIMOD:35	0.16	34.0	1	1	0
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	157-UNIMOD:21,159-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	361-UNIMOD:21,373-UNIMOD:481	0.04	34.0	1	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	596-UNIMOD:481,608-UNIMOD:4,612-UNIMOD:4,621-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|P42892|ECE1_HUMAN	Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	435-UNIMOD:4,437-UNIMOD:21,439-UNIMOD:21,460-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	60-UNIMOD:4,62-UNIMOD:21,64-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	82-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	257-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q71RC2-2|LARP4_HUMAN	Isoform 2 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	484-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	354-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	136-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q86WB0-3|NIPA_HUMAN	Isoform 3 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	62-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|O95297-4|MPZL1_HUMAN	Isoform 4 of Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:4,86-UNIMOD:21	0.11	33.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1907-UNIMOD:21,1915-UNIMOD:267	0.00	33.0	1	1	1
PRT	sp|Q5HYJ3-3|FA76B_HUMAN	Isoform 3 of Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	193-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	598-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	240-UNIMOD:21,243-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	101-UNIMOD:21,109-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q96A57|TM230_HUMAN	Transmembrane protein 230 OS=Homo sapiens OX=9606 GN=TMEM230 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	24-UNIMOD:21	0.13	33.0	1	1	1
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	169-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q2KHR3-2|QSER1_HUMAN	Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	991-UNIMOD:21,992-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1541-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	550-UNIMOD:21,554-UNIMOD:21,561-UNIMOD:267,565-UNIMOD:481	0.02	33.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	223-UNIMOD:21,227-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9H4G0-3|E41L1_HUMAN	Isoform 3 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	539-UNIMOD:21,541-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	784-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9NUN5-3|LMBD1_HUMAN	Isoform 3 of Lysosomal cobalamin transport escort protein LMBD1 OS=Homo sapiens OX=9606 GN=LMBRD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	455-UNIMOD:21,458-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	80-UNIMOD:21,82-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1269-UNIMOD:21,1275-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9ULG6-3|CCPG1_HUMAN	Isoform 3 of Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	186-UNIMOD:21,188-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	433-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q14147|DHX34_HUMAN	Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	749-UNIMOD:21,750-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	619-UNIMOD:21	0.04	33.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AADSDDGAVSAPAASDGGVSK	1	sp|Q96GM8|TOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	4-UNIMOD:21	ms_run[2]:scan=3101	36.538	2	1926.7844	1926.7844	M	S	2	23
PSM	GDQPAASGDSDDDEPPPLPR	2	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	10-UNIMOD:21	ms_run[2]:scan=4213	45.363	2	2114.843	2114.8430	R	L	48	68
PSM	SSGSPYGGGYGSGGGSGGYGSR	3	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=3431	38.974	2	1999.7573	1999.7573	R	R	333	355
PSM	SRSRSPTPPSSAGLGSNSAPPIPDSR	4	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4860	51.352	3	2897.1549	2897.1549	R	L	813	839
PSM	AFVEDSEDEDGAGEGGSSLLQK	5	sp|Q8N9T8|KRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21	ms_run[2]:scan=5252	55.451	2	2318.9428	2318.9428	R	R	166	188
PSM	IVEPEVVGESDSEVEGDAWR	6	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6121	65.467	2	2360.9451	2360.9451	K	M	107	127
PSM	KVVEAVNSDSDSEFGIPK	7	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5342	56.361	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	8	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21,8-UNIMOD:481,26-UNIMOD:481	ms_run[2]:scan=3752	41.294	3	2804.2841	2804.2841	K	K	68	94
PSM	SPSSDLDTDAEGDDFELLDQSELSQLDPASSR	9	sp|Q86VR2-2|RETR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7581	86.292	3	3598.4397	3598.4397	R	S	238	270
PSM	SSGSPYGGGYGSGGGSGGYGSR	10	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=3436	39.016	2	1989.749	1989.7490	R	R	333	355
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	11	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=7218	80.54403666666667	3	3442.4132	3442.4022	K	L	104	135
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	12	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	48.0	21-UNIMOD:21	ms_run[1]:scan=5573	58.932280000000006	3	2574.9862	2573.9982	R	G	239	267
PSM	DNLTLWTSDTQGDEAEAGEGGEN	13	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=6058	64.667	3	2407.9888	2407.9888	R	-	148	171
PSM	NVPQEESLEDSDVDADFK	14	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	11-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=5377	56.768	2	2119.8773	2119.8773	R	A	50	68
PSM	RSLAALDALNTDDENDEEEYEAWK	15	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:267,11-UNIMOD:21,24-UNIMOD:481	ms_run[2]:scan=6204	66.575	3	2890.2359	2890.2359	K	V	257	281
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	16	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	15-UNIMOD:21,16-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=3775	41.459	3	3057.1749	3057.1749	K	I	832	862
PSM	DNLLDTYSADQGDSSEGGTLAR	17	sp|Q6ZRP7|QSOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:21	ms_run[2]:scan=5742	60.969	2	2363.9755	2363.9755	R	G	565	587
PSM	GDQPAASGDSDDDEPPPLPR	18	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21	ms_run[2]:scan=4257	45.73	2	2114.843	2114.8430	R	L	48	68
PSM	GLFSDEEDSEDLFSSQSASK	19	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=6709	72.837	2	2256.8947	2256.8947	K	L	536	556
PSM	GLVAAYSGESDSEEEQER	20	sp|P98175-2|RBM10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4774	50.506	2	2114.7719	2114.7719	R	G	726	744
PSM	GNAEGSSDEEGKLVIDEPAK	21	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4622	49.115	2	2203.8923	2203.8923	K	E	120	140
PSM	GQESSSDQEQVDVESIDFSK	22	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=5945	63.218	2	2372.8934	2372.8934	K	E	648	668
PSM	IVEPEVVGESDSEVEGDAWR	23	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6150	65.811	2	2360.9451	2360.9451	K	M	107	127
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	24	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=4641	49.267	3	4117.4483	4117.4483	K	K	158	194
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	25	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=5468	57.72054333333333	3	2751.1622	2749.1532	K	S	61	87
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	26	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:481,4-UNIMOD:21,12-UNIMOD:21,34-UNIMOD:35,35-UNIMOD:481	ms_run[1]:scan=4360	46.69992	3	4302.414561	4302.413499	K	A	142	177
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	27	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46.0	21-UNIMOD:21	ms_run[1]:scan=5587	59.08345166666667	2	2574.9852	2573.9982	R	G	239	267
PSM	DNLTLWTSDQQDDDGGEGNN	28	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46.0		ms_run[1]:scan=5939	63.17274666666667	2	2192.8747	2192.8725	R	-	228	248
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	29	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:4,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4856	51.308	2	2498.8782	2498.8782	R	R	42	68
PSM	DNLTLWTSDTQGDEAEAGEGGEN	30	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=6085	65.036	3	2407.9888	2407.9888	R	-	148	171
PSM	GAEAFGDSEEDGEDVFEVEK	31	sp|Q99549|MPP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21	ms_run[2]:scan=6019	64.094	2	2237.8525	2237.8525	R	I	44	64
PSM	GDQVLNFSDAEDLIDDSK	32	sp|Q96EZ8-4|MCRS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21	ms_run[2]:scan=7172	79.751	2	2059.8623	2059.8623	K	L	84	102
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	33	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	21-UNIMOD:21	ms_run[2]:scan=5494	58.037	2	2573.9986	2573.9986	R	G	227	255
PSM	GYYSPYSVSGSGSTAGSR	34	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	13-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4487	47.871	2	1871.7603	1871.7603	K	T	4473	4491
PSM	IVEPEVVGESDSEVEGDAWR	35	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=6114	65.4	2	2370.9534	2370.9534	K	M	107	127
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	36	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21,12-UNIMOD:21,34-UNIMOD:35	ms_run[2]:scan=4365	46.742	3	4294.3633	4294.3633	K	A	142	177
PSM	KEESEESDDDMGFGLFD	37	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7036	77.698	2	2124.6796	2124.6796	K	-	99	116
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	38	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=4697	49.761	3	3116.2144	3116.2144	K	N	561	587
PSM	RSASPDDDLGSSNWEAADLGNEERK	39	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21	ms_run[2]:scan=5031	52.933	3	2798.1781	2798.1781	K	Q	14	39
PSM	RSLAALDALNTDDENDEEEYEAWK	40	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:21	ms_run[2]:scan=6205	66.581	3	2876.2026	2876.2026	K	V	257	281
PSM	SSSNDSVDEETAESDTSPVLEK	41	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=4512	48.125	2	2404.9643	2404.9643	K	E	85	107
PSM	EREESEDELEEANGNNPIDIEVDQNK	42	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	45.0	5-UNIMOD:21	ms_run[1]:scan=5459	57.629305	3	3094.2920	3094.2883	R	E	256	282
PSM	ATGGLCLLGAYADSDDDDNDVSEK	43	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=6255	67.069	2	2580.0211	2580.0211	K	L	103	127
PSM	ENYSDSEEEDDDDVASSR	44	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3433	38.992	2	2220.6893	2220.6893	R	Q	256	274
PSM	GAGDGSDEEVDGKADGAEAKPAE	45	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=2564	32.723	2	2253.8911	2253.8911	K	-	1360	1383
PSM	IEDSEPHIPLIDDTDAEDDAPTK	46	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=5985	63.669	3	2615.1164	2615.1164	R	R	1116	1139
PSM	KDSNELSDSAGEEDSADLK	47	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3726	41.109	2	2168.8036	2168.8036	K	R	709	728
PSM	LAEDEGDSEPEAVGQSR	48	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=3243	37.552	2	1867.7473	1867.7473	R	G	1457	1474
PSM	NKPGPNIESGNEDDDASFK	49	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=3721	41.071	2	2112.8637	2112.8637	K	I	206	225
PSM	NKPGPNIESGNEDDDASFK	50	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:481,9-UNIMOD:21,19-UNIMOD:481	ms_run[2]:scan=3722	41.078	2	2120.9139	2120.9139	K	I	206	225
PSM	PSVFGNDSDDDDETSVSESLQR	51	sp|Q9H0G5|NSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=5709	60.535	2	2477.9708	2477.9708	K	E	26	48
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	52	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=6529	70.28106166666667	3	3442.4092	3442.4027	K	L	104	135
PSM	GNAEGSSDEEGKLVIDEPAK	53	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	6-UNIMOD:21,7-UNIMOD:21,12-UNIMOD:481,20-UNIMOD:481	ms_run[1]:scan=4613	49.02515833333333	2	2211.9447	2211.9420	K	E	127	147
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	54	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	21-UNIMOD:21	ms_run[1]:scan=5608	59.28899666666667	3	2574.9862	2573.9982	R	G	239	267
PSM	SETAPAETATPAPVEKSPAK	55	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,16-UNIMOD:481,17-UNIMOD:21,20-UNIMOD:481	ms_run[1]:scan=3397	38.703915	2	2111.0286	2111.0270	M	K	2	22
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	56	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=4474	47.778146666666665	3	3173.2463	3173.2429	R	-	738	768
PSM	ANSGGVDLDSSGEFASIEK	57	sp|Q92766-5|RREB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5924	62.981	2	2041.7919	2041.7919	R	M	1165	1184
PSM	GAGDGSDEEVDGKADGAEAKPAE	58	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,13-UNIMOD:481,20-UNIMOD:481	ms_run[2]:scan=2556	32.667	2	2261.9413	2261.9413	K	-	1360	1383
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	59	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5353	56.468	3	2729.1371	2729.1371	K	S	61	87
PSM	KEESEESDDDMGFGLFD	60	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7119	78.927	2	2124.6796	2124.6796	K	-	99	116
PSM	KVEEEQEADEEDVSEEEAESK	61	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:481,14-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=3184	37.145	2	2525.0305	2525.0305	K	E	234	255
PSM	KVEEEQEADEEDVSEEEAESK	62	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=3179	37.112	2	2516.9803	2516.9803	K	E	234	255
PSM	RGTGQSDDSDIWDDTALIK	63	sp|Q16637-4|SMN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6411	69.062	2	2251.9036	2251.9036	R	A	23	42
PSM	RSEACPCQPDSGSPLPAEEEK	64	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=3197	37.23	3	2422.9771	2422.9771	R	R	411	432
PSM	SASSDTSEELNSQDSPPK	65	sp|O14745-2|NHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=3240	37.53	2	1961.8041	1961.8041	R	Q	132	150
PSM	SSLGQSASETEEDTVSVSKK	66	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3899	42.468	3	2227.9134	2227.9134	R	E	302	322
PSM	SSSVGSSSSYPISPAVSR	67	sp|Q15149-4|PLEC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4407	47.156	2	1843.8229	1843.8229	R	T	4247	4265
PSM	SSSVGSSSSYPISPAVSR	68	sp|Q15149-4|PLEC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4447	47.492	2	1843.8229	1843.8229	R	T	4247	4265
PSM	TAHNSEADLEESFNEHELEPSSPK	69	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	22-UNIMOD:21	ms_run[2]:scan=5175	54.566	3	2776.1501	2776.1501	K	S	100	124
PSM	TPEELDDSDFETEDFDVR	70	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=6220	66.698	2	2237.8525	2237.8525	R	S	264	282
PSM	TSAAACAVTDLSDDSDFDEK	71	sp|Q9NQZ2|SAS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:4,12-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:481	ms_run[2]:scan=5362	56.567	2	2280.832	2280.8320	K	A	354	374
PSM	VADAKGDSESEEDEDLEVPVPSR	72	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:481,8-UNIMOD:21,10-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=5076	53.398	2	2646.08	2646.0800	R	F	71	94
PSM	YFGFDDLSESEDDEDDDCQVER	73	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6926	75.942	2	2843.9307	2843.9307	K	K	452	474
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	74	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=7239	80.91223166666667	3	3442.4142	3442.4022	K	L	104	135
PSM	KEESEESDDDMGFGLFD	75	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=6799	74.04709166666666	2	2128.7034	2128.7042	K	-	99	116
PSM	SETAPAETATPAPVEKSPAK	76	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,16-UNIMOD:481,17-UNIMOD:21,20-UNIMOD:481	ms_run[1]:scan=3440	39.047905	2	2111.0286	2111.0270	M	K	2	22
PSM	SETAPAAPAAPAPAEKTPVK	77	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,16-UNIMOD:481,17-UNIMOD:21,20-UNIMOD:481	ms_run[1]:scan=3547	39.780386666666665	2	2033.0341	2033.0317	M	K	2	22
PSM	AESPESSAIESTQSTPQK	78	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=3460	39.184	2	1955.8361	1955.8361	R	G	1356	1374
PSM	AFVEDSEDEDGAGEGGSSLLQK	79	sp|Q8N9T8|KRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=5249	55.431	3	2318.9428	2318.9428	R	R	166	188
PSM	ALDISLSSGEEDEGDEEDSTAGTTK	80	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,8-UNIMOD:21,25-UNIMOD:481	ms_run[2]:scan=5595	59.148	2	2719.046	2719.0460	K	Q	329	354
PSM	ASLGSLEGEAEAEASSPK	81	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=6098	65.231	2	1815.8077	1815.8077	K	G	5748	5766
PSM	DLFDLNSSEEDDTEGFSER	82	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7299	81.737	2	2363.8356	2363.8356	K	G	666	685
PSM	DNLTLWTSDTQGDEAEAGEGGEN	83	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6060	64.685	2	2407.9888	2407.9888	R	-	148	171
PSM	DYLLSESEDEGDNDGERK	84	sp|Q9BVJ6-3|UT14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4662	49.443	2	2229.7988	2229.7988	K	H	25	43
PSM	GDQPAASGDSDDDEPPPLPR	85	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=4259	45.744	2	2124.8513	2124.8513	R	L	48	68
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	86	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	21-UNIMOD:21	ms_run[2]:scan=5522	58.364	3	2573.9986	2573.9986	R	G	227	255
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	87	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,7-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=5445	57.512	3	2809.1035	2809.1035	K	S	61	87
PSM	GQKSPGALETPSAAGSQGNTASQGK	88	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=2734	33.932	3	2408.0969	2408.0969	K	E	390	415
PSM	HIVSNDSSDSDDESHEPK	89	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=1752	26.826	2	2076.791	2076.7910	K	G	428	446
PSM	IVEPEVVGESDSEVEGDAWR	90	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=6145	65.755	2	2370.9534	2370.9534	K	M	107	127
PSM	KETESEAEDNLDDLEK	91	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:481,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=5044	53.051	2	2031.805	2031.8050	K	H	870	886
PSM	KETESEAEDNLDDLEK	92	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=5055	53.154	2	2023.7548	2023.7548	K	H	870	886
PSM	NWEDEDFYDSDDDTFLDR	93	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=6889	75.393	2	2385.8462	2385.8462	K	T	457	475
PSM	RIIYDSDSESEETLQVK	94	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5094	53.601	2	2170.9072	2170.9072	K	N	64	81
PSM	RKAEDSDSEPEPEDNVR	95	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2213	30.169	2	2131.8097	2131.8097	K	L	418	435
PSM	SSSPAPADIAQTVQEDLR	96	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=6486	69.845	2	1963.8888	1963.8888	K	T	230	248
PSM	VADAKGDSESEEDEDLEVPVPSR	97	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5080	53.447	2	2632.0466	2632.0466	R	F	71	94
PSM	KEESEESDDDMGFGLFD	98	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7246	81.00856833333333	2	2124.6823	2124.6791	K	-	99	116
PSM	KEESEESDDDMGFGLFD	99	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7269	81.35743833333333	2	2124.6823	2124.6791	K	-	99	116
PSM	SLDSDESEDEEDDYQQK	100	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	4-UNIMOD:21,7-UNIMOD:21,17-UNIMOD:481	ms_run[1]:scan=3748	41.267445	2	2194.7309	2194.7285	K	R	57	74
PSM	TPEELDDSDFETEDFDVR	101	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	8-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=6245	66.990245	2	2247.8630	2247.8603	R	S	634	652
PSM	TPEELDDSDFETEDFDVR	102	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=6213	66.64539333333333	2	2247.863536	2247.860819	R	S	634	652
PSM	AAAAAAAGDSDSWDADAFSVEDPVRK	103	sp|O75822|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,10-UNIMOD:21,25-UNIMOD:267,26-UNIMOD:481	ms_run[1]:scan=6418	69.12953	3	2728.1843	2728.1826	M	V	2	28
PSM	YLVDGTKPNAGSEEISSEDDELVEEKK	104	sp|Q9NY61|AATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	7-UNIMOD:481,12-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:21,26-UNIMOD:481,27-UNIMOD:481	ms_run[1]:scan=5260	55.515065	3	3232.3804	3232.3775	R	Q	305	332
PSM	DYLLSESEDEGDNDGERK	105	sp|Q9BVJ6|UT14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	5-UNIMOD:21,7-UNIMOD:21,17-UNIMOD:267,18-UNIMOD:481	ms_run[1]:scan=4654	49.38107333333333	2	2243.8324	2243.8317	K	H	25	43
PSM	ASLGSLEGEAEAEASSPK	106	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=6206	66.588	2	1895.7741	1895.7741	K	G	5748	5766
PSM	DLFDLNSSEEDDTEGFSER	107	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7249	81.034	2	2373.8439	2373.8439	K	G	666	685
PSM	DLFDLNSSEEDDTEGFSER	108	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7351	82.624	2	2373.8439	2373.8439	K	G	666	685
PSM	DLFDLNSSEEDDTEGFSER	109	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7268	81.352	2	2363.8356	2363.8356	K	G	666	685
PSM	DNLTLWTSENQGDEGDAGEGEN	110	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5905	62.791	3	2349.9469	2349.9469	R	-	223	245
PSM	EVDDILGEGSDDSDSEK	111	sp|Q9Y5B0|CTDP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=5277	55.704	2	1972.7013	1972.7013	K	R	860	877
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	112	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:481,17-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=5702	60.482	3	3407.3791	3407.3791	K	F	86	114
PSM	FVEWLQNAEEESESEGEEN	113	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=7067	78.153	2	2413.8512	2413.8512	K	-	401	420
PSM	GDQPAASGDSDDDEPPPLPR	114	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=4387	46.943	2	2114.843	2114.8430	R	L	48	68
PSM	GTGQSDDSDIWDDTALIK	115	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=6579	70.965	2	2019.8612	2019.8612	R	A	24	42
PSM	HIKEEPLSEEEPCTSTAIASPEK	116	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:481,8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:481	ms_run[2]:scan=4304	46.178	3	2749.2046	2749.2046	K	K	495	518
PSM	HIKEEPLSEEEPCTSTAIASPEK	117	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:481,8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:481	ms_run[2]:scan=4339	46.519	3	2749.2046	2749.2046	K	K	495	518
PSM	IEDSEPHIPLIDDTDAEDDAPTK	118	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=5951	63.302	3	2615.1164	2615.1164	R	R	1116	1139
PSM	KEESEESDDDMGFGLFD	119	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7188	80.024	2	2124.6796	2124.6796	K	-	99	116
PSM	KETESEAEDNLDDLEK	120	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:481,5-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=4636	49.229	2	1951.8387	1951.8387	K	H	870	886
PSM	KFVEWLQNAEEESESEGEEN	121	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:481,13-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6609	71.423	2	2545.9713	2545.9713	K	-	400	420
PSM	KLEKEEEEGISQESSEEEQ	122	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:481,4-UNIMOD:481,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3087	36.448	2	2403.9695	2403.9695	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	123	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:481,4-UNIMOD:481,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3134	36.799	2	2403.9695	2403.9695	K	-	89	108
PSM	KLSSERPSSDGEGVVENGITTCNGK	124	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,8-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=4227	45.477	3	2780.1725	2780.1725	K	E	275	300
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	125	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21	ms_run[2]:scan=5560	58.779	2	2988.1557	2988.1557	K	E	120	146
PSM	KPGPPLSPEIRSPAGSPELR	126	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4927	51.977	3	2324.0368	2324.0368	R	K	421	441
PSM	MHDGELEEQEEDDEKSDSEGGDLDK	127	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,16-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3486	39.361	3	3011.0424	3011.0424	K	H	4737	4762
PSM	RQLQEDQENNLQDNQTSNSSPCR	128	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=2777	34.243	3	2840.1781	2840.1781	K	S	1507	1530
PSM	SGLSDLAESLTNDNETNS	129	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6616	71.519	2	1865.8127	1865.8127	K	-	640	658
PSM	SQSLPNSLDYTQTSDPGR	130	sp|Q96TC7|RMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=4912	51.808	2	2044.8739	2044.8739	R	H	44	62
PSM	SSSPAPADIAQTVQEDLR	131	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=6526	70.257	2	1973.8971	1973.8971	K	T	230	248
PSM	TPSPKEEDEEPESPPEK	132	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:481,13-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=2424	31.735	2	2011.8751	2011.8751	K	K	202	219
PSM	TSSKESSPIPSPTSDRK	133	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=2405	31.607	2	2042.8	2042.8000	R	A	2159	2176
PSM	VVDYSQFQESDDADEDYGR	134	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=5106	53.764	2	2316.8696	2316.8696	K	D	10	29
PSM	VVDYSQFQESDDADEDYGRDSGPPTK	135	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=4804	50.797	3	2999.1982	2999.1982	K	K	10	36
PSM	VVEAVNSDSDSEFGIPK	136	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=5736	60.903	2	1955.8104	1955.8104	K	K	1511	1528
PSM	KETESEAEDNLDDLEK	137	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	5-UNIMOD:21	ms_run[1]:scan=4642	49.274065	2	1943.7890	1943.7880	K	H	870	886
PSM	KEESEESDDDMGFGLFD	138	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7412	83.56219833333333	2	2124.6823	2124.6791	K	-	99	116
PSM	KEESEESDDDMGFGLFD	139	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7359	82.71712833333333	2	2124.6823	2124.6791	K	-	99	116
PSM	KFVEWLQNAEEESESEGEEN	140	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=6615	71.51119	2	2541.9461	2541.9457	K	-	400	420
PSM	KLEKEEEEGISQESSEEEQ	141	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3302	38.011975	2	2483.9374	2483.9353	K	-	89	108
PSM	SSGSPYGGGYGSGGGSGGYGSR	142	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=3481	39.32785833333333	2	1989.7516	1989.7485	R	R	355	377
PSM	AAAAAAAGDSDSWDADAFSVEDPVRK	143	sp|O75822|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=6428	69.23740833333333	3	2714.1529	2714.1492	M	V	2	28
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	144	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=4833	51.103496666666665	3	2970.1255	2970.1211	K	R	299	324
PSM	DIEVLSEDTDYEEDEVTK	145	sp|Q4LE39-4|ARI4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5862	62.285	2	2287.8546	2287.8546	K	K	466	484
PSM	DLFDLNSSEEDDTEGFSER	146	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7293	81.688	3	2373.8439	2373.8439	K	G	666	685
PSM	DLFDLNSSEEDDTEGFSER	147	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7297	81.721	2	2373.8439	2373.8439	K	G	666	685
PSM	DLFDLNSSEEDDTEGFSER	148	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7320	82.11	2	2373.8439	2373.8439	K	G	666	685
PSM	DNLTLWTSDQQDDDGGEGNN	149	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5943	63.201	3	2192.873	2192.8730	R	-	228	248
PSM	DNQESSDAELSSSEYIK	150	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4981	52.525	2	2060.7501	2060.7501	K	T	622	639
PSM	EKTPSPKEEDEEPESPPEK	151	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=2638	33.236	2	2420.8951	2420.8951	K	K	200	219
PSM	ERIQQFDDGGSDEEDIWEEK	152	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,11-UNIMOD:21,20-UNIMOD:481	ms_run[2]:scan=5674	60.118	3	2518.035	2518.0350	K	H	527	547
PSM	FVEWLQNAEEESESEGEEN	153	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=7043	77.815	2	2413.8512	2413.8512	K	-	401	420
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	154	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:21	ms_run[2]:scan=5490	58.004	3	2573.9986	2573.9986	R	G	227	255
PSM	GTGQSDDSDIWDDTALIK	155	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=6954	76.376	2	2095.8024	2095.8024	R	A	24	42
PSM	HIKEEPLSEEEPCTSTAIASPEK	156	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4205	45.301	3	2661.1881	2661.1881	K	K	495	518
PSM	KEESEESDDDMGFGLFD	157	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7713	88.494	2	2108.6847	2108.6847	K	-	99	116
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	158	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:21	ms_run[2]:scan=5572	58.928	3	2988.1557	2988.1557	K	E	120	146
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	159	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=5790	61.528	3	3068.1221	3068.1221	K	E	120	146
PSM	KSPVGKSPPSTGSTYGSSQK	160	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2194	30.042	3	2138.9286	2138.9286	K	E	314	334
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	161	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=3751	41.287	3	2796.2339	2796.2339	K	K	68	94
PSM	NENTEGSPQEDGVELEGLK	162	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,19-UNIMOD:481	ms_run[2]:scan=5168	54.509	2	2127.9147	2127.9147	K	Q	1241	1260
PSM	NWEDEDFYDSDDDTFLDR	163	sp|Q9BWU0|NADAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=6884	75.311	2	2375.838	2375.8380	K	T	457	475
PSM	RYGLLANTEDPTEMASLDSDEETVFESR	164	sp|Q9BVV8|F174C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:35,16-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=6622	71.603	3	3350.3575	3350.3575	R	N	102	130
PSM	SSPATSLFVELDEEEVK	165	sp|Q9BXK5-4|B2L13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=6928	75.958	2	1958.8762	1958.8762	K	A	208	225
PSM	SSSPAPADIAQTVQEDLR	166	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=6517	70.186	2	1963.8888	1963.8888	K	T	230	248
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	167	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=2693	33.642	3	2611.0858	2611.0858	K	L	453	478
PSM	VEAKEESEESDEDMGFGLFD	168	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=6900	75.594	2	2437.8434	2437.8434	K	-	236	256
PSM	VEEESTGDPFGFDSDDESLPVSSK	169	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=6249	67.025	2	2652.064	2652.0640	K	N	64	88
PSM	VVEAVNSDSDSEFGIPK	170	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5741	60.962	2	1951.7853	1951.7853	K	K	1511	1528
PSM	YFDTNSEVEEESEEDEDYIPSEDWKK	171	sp|Q8N108-19|MIER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6072	64.878	3	3371.248	3371.2480	K	E	92	118
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	172	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	14-UNIMOD:481,18-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=2737	33.95516	3	3350.3868	3350.3881	R	R	157	186
PSM	KEESEESDDDMGFGLFD	173	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7440	84.044035	2	2124.6823	2124.6791	K	-	99	116
PSM	KEESEESDDDMGFGLFD	174	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7590	86.42910833333333	2	2128.7063	2128.7042	K	-	99	116
PSM	KEESEESDDDMGFGLFD	175	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7562	85.95036999999999	2	2128.7063	2128.7042	K	-	99	116
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	176	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=5247	55.41665333333333	3	2508.0795	2508.0760	M	R	2	32
PSM	KLEKEEEEGISQESSEEEQ	177	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3382	38.57908	2	2483.9374	2483.9353	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	178	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3487	39.367421666666665	2	2483.9374	2483.9353	K	-	89	108
PSM	DNLTLWTSDQQDDDGGEGNN	179	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0		ms_run[1]:scan=5975	63.543530000000004	3	2192.8745	2192.8725	R	-	228	248
PSM	SDEFSLADALPEHSPAK	180	sp|Q8NDC0|MISSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:481	ms_run[1]:scan=6341	68.30098666666667	2	1938.8577	1938.8545	M	T	2	19
PSM	SGEDEQQEQTIAEDLVVTK	181	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,1-UNIMOD:21,19-UNIMOD:481	ms_run[1]:scan=6576	70.92736500000001	2	2244.0008	2243.9979	M	Y	2	21
PSM	VLGSEGEEEDEALSPAK	182	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	4-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:481	ms_run[1]:scan=4619	49.09007166666667	2	1922.7757	1922.7732	R	G	63	80
PSM	AGLESGAEPGDGDSDTTK	183	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=2821	34.596	2	1789.7193	1789.7193	K	K	481	499
PSM	ARVGGSDEEASGIPSR	184	sp|Q9NQ55-2|SSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=2826	34.63	2	1666.7312	1666.7312	K	T	354	370
PSM	DATNVGDEGGFAPNILENK	185	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:481	ms_run[2]:scan=5772	61.275	2	1963.9425	1963.9425	K	E	110	129
PSM	DLFDLNSSEEDDTEGFSER	186	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7271	81.373	2	2373.8439	2373.8439	K	G	666	685
PSM	DLFDLNSSEEDDTEGFSER	187	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7247	81.017	2	2363.8356	2363.8356	K	G	666	685
PSM	DNLTLWTSDQQDDDGGEGNN	188	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5912	62.849	3	2192.873	2192.8730	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	189	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=6476	69.736	3	2533.9428	2533.9428	R	-	223	246
PSM	DSAIPVESDTDDEGAPR	190	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,10-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=4250	45.672	2	1942.711	1942.7110	R	I	461	478
PSM	FNDSEGDDTEETEDYR	191	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=3883	42.349	2	2010.6879	2010.6879	K	Q	392	408
PSM	GAGDGSDEEVDGKADGAEAKPAE	192	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,13-UNIMOD:481,20-UNIMOD:481	ms_run[2]:scan=2668	33.467	3	2261.9413	2261.9413	K	-	1360	1383
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	193	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5437	57.461	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	194	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=5501	58.145	3	2809.1035	2809.1035	K	S	61	87
PSM	GRLTPSPDIIVLSDNEASSPR	195	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,6-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=6156	65.895	3	2463.0485	2463.0485	R	S	117	138
PSM	GRLTPSPDIIVLSDNEASSPR	196	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=6184	66.342	3	2543.0148	2543.0148	R	S	117	138
PSM	KEEENADSDDEGELQDLLSQDWR	197	sp|Q96NB3|ZN830_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=6939	76.144	3	2800.1349	2800.1349	K	V	344	367
PSM	KEESEESDDDMGFGLFD	198	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7210	80.411	2	2124.6796	2124.6796	K	-	99	116
PSM	KGNAEGSSDEEGKLVIDEPAK	199	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:481,7-UNIMOD:21,8-UNIMOD:21,13-UNIMOD:481,21-UNIMOD:481	ms_run[2]:scan=4077	44.202	2	2344.0626	2344.0626	K	E	119	140
PSM	KLEKEEEEGISQESSEEEQ	200	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3094	36.493	2	2395.9193	2395.9193	K	-	89	108
PSM	KLSVPTSDEEDEVPAPKPR	201	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:481,6-UNIMOD:21,7-UNIMOD:21,17-UNIMOD:481,19-UNIMOD:267	ms_run[2]:scan=4321	46.33	3	2271.0552	2271.0552	K	G	103	122
PSM	KVEEEQEADEEDVSEEEAESK	202	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:481,14-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=3169	37.04	3	2525.0305	2525.0305	K	E	234	255
PSM	KVEEEQEADEEDVSEEEAESK	203	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=3172	37.062	3	2516.9803	2516.9803	K	E	234	255
PSM	KVEEEQEADEEDVSEEEAESK	204	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=3225	37.431	3	2516.9803	2516.9803	K	E	234	255
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	205	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	32-UNIMOD:481,36-UNIMOD:481	ms_run[2]:scan=4644	49.287	3	4125.4985	4125.4985	K	K	158	194
PSM	NDQEPPPEALDFSDDEK	206	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=5266	55.579	2	2024.7888	2024.7888	K	E	303	320
PSM	NLLEDDSDEEEDFFLR	207	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7190	80.04	2	2074.8284	2074.8284	R	G	24	40
PSM	RFGDSSDSDNGFSSTGSTPAKPTVEK	208	sp|Q8IU60-2|DCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4374	46.814	3	2913.1144	2913.1144	R	L	242	268
PSM	RGTSPRPPEGGLGYSQLGDDDLK	209	sp|Q9UQ88-8|CD11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=5128	53.982	3	2574.1153	2574.1153	K	E	121	144
PSM	SCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGK	210	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,26-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=3239	37.523	4	3492.3073	3492.3073	K	L	100	132
PSM	TKPTQAAGPSSPQKPPTPEETK	211	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:481,10-UNIMOD:21,14-UNIMOD:481,17-UNIMOD:21,22-UNIMOD:481	ms_run[2]:scan=2274	30.671	3	2448.1728	2448.1728	K	A	437	459
PSM	TQPDGTSVPGEPASPISQR	212	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=3960	43.081	2	2002.8997	2002.8997	R	L	608	627
PSM	VEAKEESEESDEDMGFGLFD	213	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7151	79.427	2	2437.8434	2437.8434	K	-	236	256
PSM	VFDDESDEKEDEEYADEK	214	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,9-UNIMOD:481,18-UNIMOD:481	ms_run[2]:scan=4059	44.069	3	2278.8766	2278.8766	K	G	637	655
PSM	VVDYSQFQESDDADEDYGR	215	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=5113	53.828	2	2326.8779	2326.8779	K	D	10	29
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	216	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	28-UNIMOD:21	ms_run[2]:scan=6101	65.251	3	4103.5812	4103.5812	K	R	79	117
PSM	AGLESGAEPGDGDSDTTK	217	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	14-UNIMOD:21	ms_run[1]:scan=2859	34.863659999999996	2	1785.6961	1785.6937	K	K	481	499
PSM	KEESEESDDDMGFGLFD	218	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7295	81.70594	2	2124.6823	2124.6791	K	-	99	116
PSM	EESEESDDDMGFGLFD	219	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=7607	86.74403666666667	2	1997.5902	1996.5842	K	-	100	116
PSM	KSLDSDESEDEEDDYQQK	220	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:481,5-UNIMOD:21,8-UNIMOD:21,18-UNIMOD:481	ms_run[1]:scan=3345	38.31058	2	2326.8519	2326.8486	K	R	56	74
PSM	KLEKEEEEGISQESSEEEQ	221	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3252	37.61585833333333	2	2483.9374	2483.9353	K	-	89	108
PSM	ESEDKPEIEDVGSDEEEEK	222	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	5-UNIMOD:481,13-UNIMOD:21,19-UNIMOD:481	ms_run[1]:scan=3778	41.479195000000004	2	2279.9310	2279.9288	K	K	251	270
PSM	EREESEDELEEANGNNPIDIEVDQNK	223	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	2-UNIMOD:267,5-UNIMOD:21,26-UNIMOD:481	ms_run[1]:scan=5524	58.38171666666666	3	3109.3082	3108.3212	R	E	256	282
PSM	AADPPAENSSAPEAEQGGAE	224	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=2780	34.263	2	1976.7637	1976.7637	K	-	305	325
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	225	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=4217	45.395	3	3927.6702	3927.6702	R	Q	14	52
PSM	DNEESEQPPVPGTPTLR	226	sp|O15439-4|MRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=4497	47.972	2	1944.8466	1944.8466	K	N	559	576
PSM	DNLTLWTSENQGDEGDAGEGEN	227	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5930	63.064	2	2349.9469	2349.9469	R	-	223	245
PSM	DNQESSDAELSSSEYIK	228	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4768	50.457	2	1980.7837	1980.7837	K	T	622	639
PSM	ERDSELSDTDSGCCLGQSESDK	229	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=3671	40.716	3	2633.9136	2633.9136	K	S	85	107
PSM	FVEWLQNAEEESESEGEEN	230	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=7089	78.505	2	2413.8512	2413.8512	K	-	401	420
PSM	GGSISVQVNSIKFDSE	231	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=5777	61.318	2	1745.7873	1745.7873	R	-	684	700
PSM	GLVAAYSGESDSEEEQER	232	sp|P98175-2|RBM10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,12-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4772	50.489	2	2124.7801	2124.7801	R	G	726	744
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	233	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5476	57.852	3	2729.1371	2729.1371	K	S	61	87
PSM	GRLTPSPDIIVLSDNEASSPR	234	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=6155	65.889	3	2543.0148	2543.0148	R	S	117	138
PSM	GVDFESSEDDDDDPFMNTSSLR	235	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6872	75.163	2	2636.9139	2636.9139	K	R	655	677
PSM	IEDVGSDEEDDSGKDK	236	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:481,16-UNIMOD:481	ms_run[2]:scan=2247	30.463	2	1824.739	1824.7390	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	237	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=2252	30.502	2	1816.6888	1816.6888	K	K	250	266
PSM	IVEPEVVGESDSEVEGDAWR	238	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=6151	65.819	3	2370.9534	2370.9534	K	M	107	127
PSM	KEESEESDDDMGFGLFD	239	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=6940	76.152	2	2028.7184	2028.7184	K	-	99	116
PSM	KEESEESDDDMGFGLFD	240	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7011	77.229	2	2124.6796	2124.6796	K	-	99	116
PSM	KEESEESDDDMGFGLFD	241	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7357	82.699	2	2108.6847	2108.6847	K	-	99	116
PSM	KLEKEEEEGISQESSEEEQ	242	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:481,4-UNIMOD:481,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3210	37.321	2	2403.9695	2403.9695	K	-	89	108
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	243	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:481,4-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:481	ms_run[2]:scan=5797	61.6	3	3076.1723	3076.1723	K	E	120	146
PSM	KSLDSDESEDEEDDYQQK	244	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3349	38.334	2	2318.7989	2318.7989	K	R	56	74
PSM	KVEEEQEADEEDVSEEEAESK	245	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:481,14-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=3218	37.379	3	2525.0305	2525.0305	K	E	234	255
PSM	KVEEEQEADEEDVSEEEAESK	246	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=3315	38.106	3	2516.9803	2516.9803	K	E	234	255
PSM	LVSFHDDSDEDLLHI	247	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=6487	69.853	2	1833.7822	1833.7822	K	-	2477	2492
PSM	NLLEDDSDEEEDFFLR	248	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=7186	80.009	2	2064.8201	2064.8201	R	G	24	40
PSM	PKIEDVGSDEEDDSGK	249	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:481,8-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=2936	35.403	2	1806.7648	1806.7648	K	D	248	264
PSM	RLPALSHSEGEEDEDEEEDEGK	250	sp|P55201-4|BRPF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3923	42.682	3	2658.9848	2658.9848	R	G	455	477
PSM	RPDYAPMESSDEEDEEFQFIK	251	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,7-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=6231	66.824	3	2751.0514	2751.0514	K	K	44	65
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	252	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4826	51.013	3	3223.2305	3223.2305	K	-	122	148
PSM	SSSPAPADIAQTVQEDLR	253	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=6492	69.892	2	1973.8971	1973.8971	K	T	230	248
PSM	TIGGGDDSFNTFFSETGAGK	254	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,20-UNIMOD:481	ms_run[2]:scan=6559	70.682	2	2090.8772	2090.8772	K	H	41	61
PSM	TPSPKEEDEEPESPPEK	255	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=2403	31.591	2	2003.8249	2003.8249	K	K	202	219
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	256	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:267,23-UNIMOD:21,30-UNIMOD:481	ms_run[2]:scan=6031	64.232	3	3479.5154	3479.5154	K	A	362	392
PSM	TSSSSPANSDVEIDGIGR	257	sp|O60293-2|ZC3H1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5020	52.846	2	1950.7609	1950.7609	K	I	801	819
PSM	TVDSQGPTPVCTPTFLER	258	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5759	61.163	3	2163.8949	2163.8949	K	R	227	245
PSM	VEAKEESEESDEDMGFGLFD	259	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7306	81.866	2	2421.8485	2421.8485	K	-	236	256
PSM	VVDYSQFQESDDADEDYGRDSGPPTK	260	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=4840	51.163	3	2999.1982	2999.1982	K	K	10	36
PSM	VVDYSQFQESDDADEDYGRDSGPPTK	261	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,19-UNIMOD:267,26-UNIMOD:481	ms_run[2]:scan=4809	50.839	3	3013.2316	3013.2316	K	K	10	36
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	262	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	28-UNIMOD:21	ms_run[2]:scan=6149	65.803	3	4103.5812	4103.5812	K	R	79	117
PSM	KEESEESDDDMGFGLFD	263	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7387	83.19290333333333	2	2124.6823	2124.6791	K	-	99	116
PSM	SETAPAETATPAPVEKSPAKK	264	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,16-UNIMOD:481,17-UNIMOD:21,20-UNIMOD:481,21-UNIMOD:481	ms_run[1]:scan=2929	35.351095	2	2243.1501	2243.1471	M	K	2	23
PSM	VKGGDDHDDTSDSDSDGLTLK	265	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	10-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=3957	43.064675	3	2415.8414	2415.8388	K	E	142	163
PSM	SLQYGAEETPLAGSYGAADSFPK	266	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=6696	72.60654833333332	3	2480.0823	2480.0779	M	D	2	25
PSM	ADGDSGSERGGGGGPCGFQPASR	267	sp|Q96QR8|PURB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,5-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=4189	45.178776666666664	3	2379.8621	2379.8572	M	G	2	25
PSM	AADPPAENSSAPEAEQGGAE	268	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=2856	34.841	2	1976.7637	1976.7637	K	-	305	325
PSM	ALVVPEPEPDSDSNQER	269	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=4665	49.467	2	1960.8415	1960.8415	K	K	126	143
PSM	EAQQKVPDEEENEESDNEKETEK	270	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:481,15-UNIMOD:21,19-UNIMOD:481,23-UNIMOD:481	ms_run[2]:scan=2228	30.271	3	2825.2153	2825.2153	K	S	1092	1115
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	271	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=5703	60.488	3	3393.3457	3393.3457	K	F	86	114
PSM	FSISPDEDSSSYSSNSDFNYSYPTK	272	sp|Q96QD8|S38A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=6294	67.713	3	2983.0998	2983.0998	R	Q	9	34
PSM	FVEWLQNAEEESESEGEEN	273	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=7126	79.033	2	2413.8512	2413.8512	K	-	401	420
PSM	GAGDGSDEEVDGKADGAEAKPAE	274	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,13-UNIMOD:481,20-UNIMOD:481	ms_run[2]:scan=2386	31.466	3	2261.9413	2261.9413	K	-	1360	1383
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	275	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5383	56.842	3	2729.1371	2729.1371	K	S	61	87
PSM	GRLTPSPDIIVLSDNEASSPR	276	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5894	62.671	3	2463.0485	2463.0485	R	S	117	138
PSM	IVRGDQPAASGDSDDDEPPPLPR	277	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=4062	44.092	3	2483.0966	2483.0966	K	L	45	68
PSM	KAEQGSEEEGEGEEEEEEGGESK	278	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:481,6-UNIMOD:21,23-UNIMOD:481	ms_run[2]:scan=2191	30.026	3	2568.9952	2568.9952	K	A	223	246
PSM	KEESEESDDDMGFGLFD	279	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=6352	68.425	2	2044.7133	2044.7133	K	-	99	116
PSM	KEESEESDDDMGFGLFD	280	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7644	87.349	2	2108.6847	2108.6847	K	-	99	116
PSM	KETESEAEDNLDDLEK	281	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=5046	53.064	3	2023.7548	2023.7548	K	H	870	886
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	282	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=5541	58.567	3	2988.1557	2988.1557	K	E	120	146
PSM	LARVDSEGDFSENDDAAGDFR	283	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5250	55.437	3	2444.9159	2444.9159	K	S	318	339
PSM	LGAGGGSPEKSPSAQELK	284	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,10-UNIMOD:481,11-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=3220	37.392	2	1879.857	1879.8570	R	E	13	31
PSM	LPSGSGAASPTGSAVDIR	285	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4616	49.048	2	1811.7731	1811.7731	R	A	208	226
PSM	LSVPTSDEEDEVPAPKPR	286	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=4700	49.797	2	2124.9018	2124.9018	K	G	104	122
PSM	MPQDGSDDEDEEWPTLEK	287	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,6-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=5504	58.168	2	2219.8392	2219.8392	R	A	93	111
PSM	NWTEDMEGGISSPVK	288	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4516	48.155	2	1744.7015	1744.7015	R	K	279	294
PSM	RIACEEEFSDSEEEGEGGRK	289	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3478	39.311	3	2472.9142	2472.9142	K	N	413	433
PSM	RSASPDDDLGSSNWEAADLGNEER	290	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,2-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=5393	56.977	3	2690.0996	2690.0996	K	K	14	38
PSM	SAEDLTDGSYDDVLNAEQLQK	291	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=6162	65.979	3	2394.0414	2394.0414	K	L	45	66
PSM	SQEPIPDDQKVSDDDK	292	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:481,12-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=2907	35.193	2	1902.8336	1902.8336	K	E	415	431
PSM	SSSDDEEQLTELDEEMENEICR	293	sp|Q96ER3|SAAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=7081	78.388	3	2737.0256	2737.0256	K	V	54	76
PSM	SSTPLPTISSSAENTR	294	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=4246	45.64	2	1726.7775	1726.7775	R	Q	158	174
PSM	VFDDESDEKEDEEYADEK	295	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=4061	44.087	3	2270.8264	2270.8264	K	G	637	655
PSM	YFGFDDLSESEDDEDDDCQVERK	296	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6311	67.932	3	2972.0257	2972.0257	K	T	452	475
PSM	YYDDIYFDSDSEDEDRAVQVTK	297	sp|Q56P03|EAPP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:267,22-UNIMOD:481	ms_run[2]:scan=5988	63.71	3	2846.1062	2846.1062	R	K	101	123
PSM	KETESEAEDNLDDLEK	298	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:481,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:481	ms_run[1]:scan=5035	52.964973333333326	3	2031.8057	2031.8045	K	H	870	886
PSM	KEESEESDDDMGFGLFD	299	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=6766	73.69099666666666	2	2128.7034	2128.7042	K	-	99	116
PSM	KEESEESDDDMGFGLFD	300	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=7367	82.85350666666666	2	2112.7092	2112.7093	K	-	99	116
PSM	KEESEESDDDMGFGLFD	301	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7545	85.72567	2	2125.6842	2124.6792	K	-	99	116
PSM	KEESEESDDDMGFGLFD	302	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7334	82.34465333333333	2	2124.6823	2124.6791	K	-	99	116
PSM	DNLTLWTSDQQDDDGGEGNN	303	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0		ms_run[1]:scan=5971	63.510985	2	2192.8747	2192.8725	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	304	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0		ms_run[1]:scan=5909	62.822655000000005	2	2192.8747	2192.8725	R	-	228	248
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	305	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:481,9-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21,25-UNIMOD:481	ms_run[1]:scan=5214	55.07159333333333	3	3058.141381	3058.138210	K	R	299	324
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	306	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=6361	68.539075	3	2749.2339	2749.2301	-	Y	1	25
PSM	ALSSDSILSPAPDAR	307	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5261	55.521	2	1578.7291	1578.7291	R	A	392	407
PSM	ATNESEDEIPQLVPIGK	308	sp|O76021-2|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=6111	65.38	2	1918.8925	1918.8925	K	K	137	154
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	309	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,2-UNIMOD:21,3-UNIMOD:21	ms_run[2]:scan=4848	51.226	3	2498.8782	2498.8782	R	R	42	68
PSM	CSTAGSSPNSVSELSLASLTEK	310	sp|Q5M775-5|CYTSB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6533	70.317	3	2383.9856	2383.9856	K	I	274	296
PSM	DLFDLNSSEEDDTEGFSER	311	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7375	82.959	2	2373.8439	2373.8439	K	G	666	685
PSM	DSENLASPSEYPENGER	312	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=4206	45.307	2	1982.777	1982.7770	R	F	600	617
PSM	DSHSSEEDEASSQTDLSQTISKK	313	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4118	44.614	3	2668.0426	2668.0426	R	T	153	176
PSM	FNDSEGDDTEETEDYR	314	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=3880	42.329	2	2000.6797	2000.6797	K	Q	392	408
PSM	GAGDGSDEEVDGKADGAEAKPAE	315	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=2555	32.661	3	2253.8911	2253.8911	K	-	1360	1383
PSM	GDVTAEEAAGASPAK	316	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21,15-UNIMOD:481	ms_run[2]:scan=2433	31.796	2	1456.6385	1456.6385	R	A	11	26
PSM	HEEEEWTDDDLVESL	317	sp|P51946|CCNH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=6754	73.486	2	1924.7252	1924.7252	K	-	309	324
PSM	KLGAGEGGEASVSPEK	318	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:481,13-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=2363	31.3	2	1602.7742	1602.7742	K	T	1289	1305
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	319	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:481,19-UNIMOD:21,26-UNIMOD:481	ms_run[2]:scan=5484	57.913	3	2996.2059	2996.2059	K	E	120	146
PSM	KPGPPLSPEIRSPAGSPELR	320	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4892	51.634	3	2324.0368	2324.0368	R	K	421	441
PSM	KWDGSEEDEDNSKK	321	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=1708	26.51	2	1745.6782	1745.6782	K	I	160	174
PSM	LLEDSEESSEETVSR	322	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4152	44.868	2	1868.6966	1868.6966	R	A	99	114
PSM	LLKPGEEPSEYTDEEDTK	323	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=3898	42.461	2	2158.9195	2158.9195	R	D	200	218
PSM	NHSGSRTPPVALNSSR	324	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3026	36.033	2	1918.7489	1918.7489	R	M	2098	2114
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	325	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=2935	35.395	3	3416.3216	3416.3216	R	R	157	186
PSM	PSQVNGAPGSPTEPAGQK	326	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=2375	31.385	2	1800.8044	1800.8044	K	Q	1258	1276
PSM	QEAIPDLEDSPPVSDSEEQQESAR	327	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=5474	57.835	3	2815.111	2815.1110	R	A	796	820
PSM	SAGEEEDGPVLTDEQK	328	sp|Q66PJ3-7|AR6P4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=3776	41.464	2	1782.7197	1782.7197	R	S	137	153
PSM	SFNYSPNSSTSEVSSTSASK	329	sp|Q5VT52-5|RPRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=4219	45.408	2	2145.874	2145.8740	K	A	563	583
PSM	STVTGERQSGDGQESTEPVENK	330	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=2185	29.982	3	2414.0235	2414.0235	K	V	140	162
PSM	SYQNSPSSDDGIRPLPEYSTEK	331	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5144	54.172	3	2629.0622	2629.0622	K	H	1475	1497
PSM	VFDDESDEKEDEEYADEK	332	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,9-UNIMOD:481,18-UNIMOD:481	ms_run[2]:scan=4072	44.166	2	2278.8766	2278.8766	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	333	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=4064	44.108	2	2270.8264	2270.8264	K	G	637	655
PSM	VGGSDEEASGIPSR	334	sp|Q9NQ55-2|SSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=3129	36.761	2	1439.593	1439.5930	R	T	356	370
PSM	VGGSDEEASGIPSR	335	sp|Q9NQ55-2|SSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=3153	36.931	2	1449.6012	1449.6012	R	T	356	370
PSM	VHDAESSDEDGYDWGPATDL	336	sp|O95049-5|ZO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6699	72.644	2	2337.7988	2337.7988	R	-	864	884
PSM	VQEHEDSGDSEVENEAK	337	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,10-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=2618	33.096	2	2064.75	2064.7500	R	G	115	132
PSM	VREDDEDSDDDGSDEEIDESLAAQFLNSGNVR	338	sp|Q14669-4|TRIPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=7278	81.47	3	3700.4211	3700.4211	R	H	1040	1072
PSM	VVDYSQFQESDDADEDYGR	339	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=5119	53.901	3	2326.8779	2326.8779	K	D	10	29
PSM	YLVDGTKPNAGSEEISSEDDELVEEK	340	sp|Q9NY61|AATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=5672	60.104	3	3092.2077	3092.2077	R	K	305	331
PSM	VEMYSGSDDDDDFNK	341	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	3-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:481	ms_run[1]:scan=3896	42.44303	2	1916.6092	1915.6042	K	L	131	146
PSM	IVEPEVVGESDSEVEGDAWR	342	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=6126	65.53358166666666	3	2360.9478	2360.9446	K	M	107	127
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	343	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:481,19-UNIMOD:21,26-UNIMOD:481	ms_run[1]:scan=5599	59.18433666666667	3	2996.2068	2996.2054	K	E	144	170
PSM	KEESEESDDDMGFGLFD	344	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7468	84.50940333333334	2	2125.6842	2124.6792	K	-	99	116
PSM	KLEKEEEEGISQESSEEEQ	345	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3428	38.95071	2	2483.9374	2483.9353	K	-	89	108
PSM	NGSLDSPGKQDTEEDEEEDEK	346	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	6-UNIMOD:21,9-UNIMOD:481,21-UNIMOD:481	ms_run[1]:scan=2694	33.64984833333333	3	2438.9852	2437.9732	K	D	134	155
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	347	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=4880	51.52793333333333	3	2970.1255	2970.1211	K	R	299	324
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	348	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:481,14-UNIMOD:21,16-UNIMOD:21,25-UNIMOD:481	ms_run[2]:scan=4853	51.267	3	2978.1719	2978.1719	K	R	299	324
PSM	APVQPQQSPAAAPGGTDEKPSGK	349	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21,19-UNIMOD:481,23-UNIMOD:481	ms_run[2]:scan=2260	30.563	3	2305.1191	2305.1191	K	E	9	32
PSM	DNLLDTYSADQGDSSEGGTLARGEEEEK	350	sp|Q6ZRP7|QSOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=5461	57.646	3	3065.2623	3065.2623	R	R	565	593
PSM	EGEEPTVYSDEEEPKDESAR	351	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=3479	39.316	2	2374.9326	2374.9326	K	K	121	141
PSM	ERDSELSDTDSGCCLGQSESDK	352	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=3566	39.909	3	2553.9473	2553.9473	K	S	85	107
PSM	EYIPGQPPLSQSSDSSPTR	353	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=4772	50.489	2	2124.9365	2124.9365	K	N	871	890
PSM	FSKEEPVSSGPEEAVGK	354	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:481,8-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=3951	43.022	3	1943.8406	1943.8406	K	S	562	579
PSM	FTDKDQQPSGSEGEDDDAEAALKK	355	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:481,9-UNIMOD:21,11-UNIMOD:21,23-UNIMOD:481,24-UNIMOD:481	ms_run[2]:scan=3720	41.066	3	2752.1543	2752.1543	K	E	78	102
PSM	GAEAFGDSEEDGEDVFEVEK	356	sp|Q99549|MPP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=6023	64.145	3	2237.8525	2237.8525	R	I	44	64
PSM	GDVTAEEAAGASPAK	357	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=2449	31.911	2	1452.6134	1452.6134	R	A	11	26
PSM	GEAAAERPGEAAVASSPSK	358	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=2202	30.094	3	1863.8364	1863.8364	K	A	12	31
PSM	GFEEEHKDSDDDSSDDEQEK	359	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,13-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=2273	30.663	3	2579.7776	2579.7776	K	K	423	443
PSM	GGSISVQVNSIKFDSE	360	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:481,15-UNIMOD:21	ms_run[2]:scan=5774	61.293	2	1749.8124	1749.8124	R	-	684	700
PSM	GGSISVQVNSIKFDSE	361	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=5804	61.669	2	1745.7873	1745.7873	R	-	684	700
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	362	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=4923	51.943	3	2649.1708	2649.1708	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	363	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5510	58.237	3	2729.1371	2729.1371	K	S	61	87
PSM	HIKEEPLSEEEPCTSTAIASPEK	364	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:481,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:481	ms_run[2]:scan=4194	45.218	3	2669.2383	2669.2383	K	K	495	518
PSM	KLSVPTSDEEDEVPAPKPR	365	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4296	46.094	3	2252.9967	2252.9967	K	G	103	122
PSM	KLSVPTSDEEDEVPAPKPR	366	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4332	46.442	3	2252.9967	2252.9967	K	G	103	122
PSM	KPGPPLSPEIRSPAGSPELR	367	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4841	51.168	3	2324.0368	2324.0368	R	K	421	441
PSM	KSPVGKSPPSTGSTYGSSQK	368	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:481,2-UNIMOD:21,6-UNIMOD:481,7-UNIMOD:21,20-UNIMOD:481	ms_run[2]:scan=2188	30.004	3	2151.004	2151.0040	K	E	314	334
PSM	KWDGSEEDEDNSK	369	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:481,5-UNIMOD:21,13-UNIMOD:481	ms_run[2]:scan=1997	28.657	2	1625.6334	1625.6334	K	K	160	173
PSM	KWDGSEEDEDNSK	370	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=1998	28.665	2	1617.5832	1617.5832	K	K	160	173
PSM	LGAGEGGEASVSPEK	371	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=2756	34.093	2	1466.629	1466.6290	K	T	1290	1305
PSM	METEADAPSPAPSLGERLEPR	372	sp|Q12873-2|CHD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5048	53.079	3	2428.0019	2428.0019	K	K	1593	1614
PSM	NEEPSEEEIDAPKPK	373	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,13-UNIMOD:481,15-UNIMOD:481	ms_run[2]:scan=3057	36.243	2	1798.8114	1798.8114	K	K	117	132
PSM	NESEDNKFSDDSDDDFVQPR	374	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4824	50.996	3	2517.8847	2517.8847	R	K	983	1003
PSM	RIACEEEFSDSEEEGEGGRK	375	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3473	39.275	2	2472.9142	2472.9142	K	N	413	433
PSM	RKHSPSPPPPTPTESR	376	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=1608	25.786	2	1929.8499	1929.8499	K	K	325	341
PSM	RPDYAPMESSDEEDEEFQFIK	377	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6216	66.668	3	2737.018	2737.0180	K	K	44	65
PSM	RPPSPDVIVLSDNEQPSSPR	378	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=5218	55.1	3	2429.0067	2429.0067	R	V	97	117
PSM	SLLSHEFQDETDTEEETLYSSK	379	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=6079	64.938	3	2747.0776	2747.0776	K	H	1111	1133
PSM	SPSSDLDTDAEGDDFELLDQSELSQLDPASSR	380	sp|Q86VR2-2|RETR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,32-UNIMOD:267	ms_run[2]:scan=7349	82.605	3	3528.4816	3528.4816	R	S	238	270
PSM	SSSPAPADIAQTVQEDLR	381	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=6522	70.225	3	1963.8888	1963.8888	K	T	230	248
PSM	TEIKEEEDQPSTSATQSSPAPGQSK	382	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=2592	32.914	3	2711.1811	2711.1811	K	K	1021	1046
PSM	TLNAETPKSSPLPAK	383	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3156	36.951	2	1712.7787	1712.7787	R	G	208	223
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	384	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21,14-UNIMOD:21,24-UNIMOD:21	ms_run[2]:scan=5391	56.958	3	3766.3718	3766.3718	R	-	259	291
PSM	TSEIEPKNSPEDLGLSLTGDSCK	385	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:481,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:481	ms_run[2]:scan=5457	57.612	3	2564.1805	2564.1805	K	L	492	515
PSM	VEMYSGSDDDDDFNK	386	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3894	42.429	2	1911.5795	1911.5795	K	L	131	146
PSM	VVDYSQFQESDDADEDYGR	387	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=5112	53.823	3	2316.8696	2316.8696	K	D	10	29
PSM	YQKLPSDEDESGTEESDNTPLLK	388	sp|Q9ULH0-5|KDIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=4980	52.519	3	2754.1198	2754.1198	R	D	288	311
PSM	EKTPSPKEEDEEPESPPEK	389	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	3-UNIMOD:21,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=2630	33.181885	3	2420.8971	2420.8946	K	K	200	219
PSM	KGNAEGSSDEEGKLVIDEPAK	390	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:481,7-UNIMOD:21,8-UNIMOD:21,13-UNIMOD:481,21-UNIMOD:481	ms_run[1]:scan=4058	44.06391333333334	3	2344.064416	2344.062605	K	E	126	147
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	391	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:481,19-UNIMOD:21,26-UNIMOD:481	ms_run[1]:scan=5543	58.580605000000006	3	2996.2068	2996.2054	K	E	144	170
PSM	LFEESDDKEDEDADGKEVEDADEK	392	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	5-UNIMOD:21,8-UNIMOD:481,16-UNIMOD:481,24-UNIMOD:481	ms_run[1]:scan=4137	44.75770166666667	3	2848.1738	2848.1719	K	L	672	696
PSM	KFVEWLQNAEEESESEGEEN	393	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=6662	72.16471666666666	2	2543.9472	2541.9452	K	-	400	420
PSM	SQTTTERDSDTDVEEEELPVENR	394	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=4583	48.770134999999996	3	2838.114919	2838.111768	R	E	445	468
PSM	KLEKEEEEGISQESSEEEQ	395	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:481,4-UNIMOD:481,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3291	37.93419	3	2483.9362	2483.9353	K	-	89	108
PSM	ALSSLHGDDQDSEDEVLTIPEVK	396	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=5881	62.52296166666667	3	2576.1608	2576.1526	K	V	2398	2421
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	397	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=4795	50.673183333333334	3	2970.1255	2970.1211	K	R	299	324
PSM	YYDDIYFDSDSEDEDRAVQVTK	398	sp|Q56P03|EAPP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=5983	63.65558166666666	3	2832.0761	2832.0723	R	K	101	123
PSM	EGNTTEDDFPSSPGNGNK	399	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=3375	38.532626666666665	2	1945.7422	1944.7372	R	S	295	313
PSM	KGFEEEHKDSDDDSSDDEQEK	400	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:481,8-UNIMOD:481,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21,21-UNIMOD:481	ms_run[1]:scan=1994	28.635695000000002	3	2719.9493	2719.9473	K	K	422	443
PSM	AGNSDSEEDDANGRVELILEPK	401	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=6011	63.993	3	2517.0309	2517.0309	K	D	155	177
PSM	APVQPQQSPAAAPGGTDEKPSGK	402	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=2264	30.595	3	2297.0689	2297.0689	K	E	9	32
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	403	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=6001	63.863	3	3459.4297	3459.4297	K	L	104	135
PSM	CPEILSDESSSDEDEKK	404	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,6-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4121	44.637	3	2286.6967	2286.6967	K	N	188	205
PSM	DLFDLNSSEEDDTEGFSER	405	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7315	82.039	3	2373.8439	2373.8439	K	G	666	685
PSM	DSSDSADGRATPSENLVPSSAR	406	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=3987	43.308	3	2297.9761	2297.9761	R	V	184	206
PSM	EDILENEDEQNSPPKK	407	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=3517	39.567	2	1963.8412	1963.8412	K	G	1272	1288
PSM	EPTPSIASDISLPIATQELR	408	sp|A0FGR8-5|ESYT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=7140	79.25	3	2377.0257	2377.0257	K	Q	158	178
PSM	EVEDKESEGEEEDEDEDLSK	409	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=3037	36.109	2	2418.8959	2418.8959	K	Y	147	167
PSM	GKLSAEENPDDSEVPSSSGINSTK	410	sp|Q9Y5Q9-2|TF3C3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:481,4-UNIMOD:21,24-UNIMOD:481	ms_run[2]:scan=3836	41.97	3	2535.1465	2535.1465	K	S	40	64
PSM	GPRTPSPPPPIPEDIALGK	411	sp|Q5T200-2|ZC3HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:267,4-UNIMOD:21,6-UNIMOD:21,19-UNIMOD:481	ms_run[2]:scan=5750	61.065	3	2112.0235	2112.0235	K	K	260	279
PSM	IACEEEFSDSEEEGEGGRK	412	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3661	40.649	3	2316.8131	2316.8131	R	N	414	433
PSM	IKNENTEGSPQEDGVELEGLK	413	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:481,9-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=4726	50.01	3	2373.1188	2373.1188	K	Q	1239	1260
PSM	ITVNGDSSAEAEELANEI	414	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=6542	70.44	2	1940.8252	1940.8252	K	-	849	867
PSM	IYHLPDAESDEDEDFKEQTR	415	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21,16-UNIMOD:481,20-UNIMOD:267	ms_run[2]:scan=4935	52.058	3	2530.0714	2530.0714	K	L	210	230
PSM	KAEQGSEEEGEGEEEEEEGGESK	416	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=2179	29.939	3	2560.945	2560.9450	K	A	223	246
PSM	KEESEESDDDMGFGLFD	417	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=6321	68.078	2	2044.7133	2044.7133	K	-	99	116
PSM	KEESEESDDDMGFGLFD	418	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7619	86.941	2	2108.6847	2108.6847	K	-	99	116
PSM	KEESEESDDDMGFGLFD	419	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7666	87.739	2	2108.6847	2108.6847	K	-	99	116
PSM	KFPDRLAEDEGDSEPEAVGQSR	420	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=4311	46.233	3	2511.0915	2511.0915	K	G	1452	1474
PSM	KGGEFDEFVNDDTDDDLPISK	421	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=6040	64.377	3	2435.0054	2435.0054	K	K	913	934
PSM	KGGEFDEFVNDDTDDDLPISK	422	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:481,13-UNIMOD:21,21-UNIMOD:481	ms_run[2]:scan=6043	64.418	3	2443.0556	2443.0556	K	K	913	934
PSM	KLGAGEGGEASVSPEK	423	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=2350	31.208	2	1594.724	1594.7240	K	T	1289	1305
PSM	KPISDNSFSSDEEQSTGPIK	424	sp|O60293-2|ZC3H1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=4615	49.042	3	2324.9451	2324.9451	R	Y	1295	1315
PSM	LKSEDGVEGDLGETQSR	425	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:481,3-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=3744	41.236	2	1912.8593	1912.8593	R	T	133	150
PSM	LLKPGEEPSEYTDEEDTK	426	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=3881	42.334	3	2158.9195	2158.9195	R	D	200	218
PSM	LLKPGEEPSEYTDEEDTK	427	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:481,12-UNIMOD:21,18-UNIMOD:481	ms_run[2]:scan=3900	42.474	2	2166.9697	2166.9697	R	D	200	218
PSM	LVSFHDDSDEDLLHI	428	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=6917	75.8	2	1913.7486	1913.7486	K	-	2477	2492
PSM	MAGQEIPEEGREVEEFSEDDDEDDSDDSEAEK	429	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,17-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:21	ms_run[2]:scan=5303	55.979	3	3886.301	3886.3010	R	Q	337	369
PSM	NEEPSEEEIDAPKPK	430	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=3053	36.215	2	1790.7612	1790.7612	K	K	117	132
PSM	RGHTASESDEQQWPEEK	431	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,6-UNIMOD:21,17-UNIMOD:481	ms_run[2]:scan=2741	33.984	3	2106.8821	2106.8821	K	R	1252	1269
PSM	RIACEEEFSDSEEEGEGGRK	432	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3538	39.716	3	2472.9142	2472.9142	K	N	413	433
PSM	SKSQEEPKDTFEHDPSESIDEFNK	433	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=4713	49.905	4	2902.2182	2902.2182	K	S	179	203
PSM	SQEPIPDDQKVSDDDK	434	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=2889	35.073	2	1894.7833	1894.7833	K	E	415	431
PSM	SSPATSLFVELDEEEVK	435	sp|Q9BXK5-4|B2L13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=6902	75.611	2	1958.8762	1958.8762	K	A	208	225
PSM	SSTPLPTISSSAENTR	436	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=4204	45.295	2	1726.7775	1726.7775	R	Q	158	174
PSM	TDGSISGDRQPVTVADYISR	437	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=5732	60.837	3	2295.9774	2295.9774	R	A	598	618
PSM	THTTALAGRSPSPASGR	438	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=1974	28.478	2	1825.7873	1825.7873	K	R	286	303
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	439	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:267,14-UNIMOD:21	ms_run[2]:scan=5193	54.809	3	3616.4474	3616.4474	R	-	259	291
PSM	VDSTTCLFPVEEK	440	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:481	ms_run[2]:scan=5684	60.264	2	1607.7092	1607.7092	R	A	241	254
PSM	VEMYSGSDDDDDFNKLPK	441	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5505	58.176	3	2233.8164	2233.8164	K	K	131	149
PSM	VKAQTPPGPSLSGSKSPCPQEK	442	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:481,5-UNIMOD:21,15-UNIMOD:481,16-UNIMOD:21,18-UNIMOD:4,22-UNIMOD:481	ms_run[2]:scan=2955	35.536	3	2451.166	2451.1660	K	S	999	1021
PSM	YSVLNNDDYFADVSPLRATSPSK	443	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=6466	69.604	3	2718.1616	2718.1616	R	S	29	52
PSM	YYSDSDDELTVEQR	444	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=5012	52.778	2	1878.6598	1878.6598	K	R	480	494
PSM	NKPGPNIESGNEDDDASFK	445	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:481,9-UNIMOD:21,19-UNIMOD:481	ms_run[1]:scan=3709	40.99668333333333	3	2120.9145	2120.9134	K	I	206	225
PSM	KKPSTDEQTSSAEEDVPTCGYLNVLSNSR	446	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	10-UNIMOD:21,11-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=5823	61.91697833333333	3	3371.4299	3371.4261	K	W	333	362
PSM	KEESEESDDDMGFGLFD	447	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7503	85.09370666666666	2	2128.706774	2128.704717	K	-	98	115
PSM	EESEESDDDMGFGLFD	448	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=7576	86.20783333333334	2	1901.6292	1900.6232	K	-	100	116
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	449	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	18-UNIMOD:481,28-UNIMOD:21,38-UNIMOD:481	ms_run[1]:scan=6120	65.46030166666667	3	4111.6335	4111.6309	K	R	79	117
PSM	IAAPELHKGDSDSEEDEPTK	450	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=3448	39.103993333333335	3	2326.9262	2326.9238	K	K	147	167
PSM	ATNESEDEIPQLVPIGK	451	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	5-UNIMOD:21,17-UNIMOD:481	ms_run[1]:scan=6103	65.2648	2	1922.9191	1922.9171	K	K	357	374
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	452	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:481,14-UNIMOD:4,18-UNIMOD:4,27-UNIMOD:267	ms_run[1]:scan=4891	51.628056666666666	3	3058.1847	3058.1848	K	L	595	622
PSM	FCVSDTENNLGFALGPMFVKATFAEDSK	453	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=6316	67.99706	3	3336.3482	3334.3402	K	S	434	462
PSM	ALEAASLSQHPPSLCISDSEEEEEERK	454	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4,17-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=5359	56.547	3	3200.3258	3200.3258	R	K	46	73
PSM	AQAVSEEEEEEEGK	455	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=2679	33.541	2	1642.6247	1642.6247	K	S	78	92
PSM	ASSLGEIDESSELR	456	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=4966	52.391	2	1571.6716	1571.6716	R	V	255	269
PSM	DEKKEESEESDDDMGFGLFD	457	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=6509	70.068	3	2496.8441	2496.8441	K	-	96	116
PSM	DGLNQTTIPVSPPSTTKPSR	458	sp|Q71RC2-2|LARP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=4663	49.45	3	2175.0573	2175.0573	K	E	474	494
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	459	sp|Q9UKS6|PACN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:21	ms_run[2]:scan=3994	43.361	3	3117.2837	3117.2837	R	A	333	362
PSM	DKSPVREPIDNLTPEER	460	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=4260	45.752	2	2073.9732	2073.9732	K	D	134	151
PSM	DNLTLWTSDTQGDEAEAGEGGEN	461	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6084	65.028	2	2407.9888	2407.9888	R	-	148	171
PSM	DTSATSQSVNGSPQAEQPSLESTSK	462	sp|Q86WB0-3|NIPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=3681	40.781	3	2615.1236	2615.1236	K	E	51	76
PSM	DYTGCSTSESLSPVK	463	sp|O95297-4|MPZL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4036	43.862	2	1709.6855	1709.6855	R	Q	75	90
PSM	EGEEPTVYSDEEEPK	464	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=3735	41.173	2	1816.6928	1816.6928	K	D	121	136
PSM	ELSNSPLRENSFGSPLEFR	465	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=6556	70.659	3	2417.9695	2417.9695	K	N	1316	1335
PSM	ELSNSPLRENSFGSPLEFR	466	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=6672	72.296	3	2417.9695	2417.9695	K	N	1316	1335
PSM	GAGDGSDEEVDGKADGAEAKPAE	467	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,13-UNIMOD:481,20-UNIMOD:481	ms_run[2]:scan=2542	32.573	3	2261.9413	2261.9413	K	-	1360	1383
PSM	GNRTDGSISGDRQPVTVADYISR	468	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5291	55.879	3	2623.1429	2623.1429	R	A	595	618
PSM	GRAEGEWEDQEALDYFSDKESGK	469	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=5633	59.628	3	2725.1181	2725.1181	K	Q	367	390
PSM	GSGTASDDEFENLR	470	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=4802	50.78	2	1586.6125	1586.6125	R	I	1902	1916
PSM	HIVSNDSSDSDDESHEPK	471	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=1743	26.763	3	2076.791	2076.7910	K	G	428	446
PSM	IEDVGSDEEDDSGK	472	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,14-UNIMOD:481	ms_run[2]:scan=2601	32.974	2	1577.592	1577.5920	K	D	250	264
PSM	ISNLSPEEEQGLWK	473	sp|Q5HYJ3-3|FA76B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=5662	60.024	2	1708.7709	1708.7709	K	Q	189	203
PSM	IVEPEVVGESDSEVEGDAWR	474	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=6122	65.475	3	2370.9534	2370.9534	K	M	107	127
PSM	IVRGDQPAASGDSDDDEPPPLPR	475	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=4119	44.62	3	2483.0966	2483.0966	K	L	45	68
PSM	IYHLPDAESDEDEDFK	476	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21,16-UNIMOD:481	ms_run[2]:scan=5299	55.936	3	2005.8132	2005.8132	K	E	210	226
PSM	KEESEESDDDMGFGLFD	477	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=6963	76.494	2	2028.7184	2028.7184	K	-	99	116
PSM	KQSFDDNDSEELEDKDSK	478	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=2903	35.167	3	2207.8743	2207.8743	K	S	105	123
PSM	KYVISDEEEEDDD	479	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=4128	44.69	2	1664.5978	1664.5978	K	-	594	607
PSM	LFEESDDKEDEDADGKEVEDADEK	480	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=4132	44.717	4	2836.0971	2836.0971	K	L	672	696
PSM	LLPYPTLASPASD	481	sp|P0C1Z6-2|TFPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6693	72.581	2	1503.6299	1503.6299	K	-	232	245
PSM	LNRSNSELEDEILCLEK	482	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=6364	68.562	3	2140.9712	2140.9712	K	E	96	113
PSM	LSSTDDGYIDLQFK	483	sp|Q96A57|TM230_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=6209	66.614	2	1680.7284	1680.7284	R	K	22	36
PSM	NHLSPQQGGATPQVPSPCCR	484	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=3832	41.941	3	2269.9722	2269.9722	K	F	166	186
PSM	NLEHLSSFSSDEDDPGYSQDAYK	485	sp|Q2KHR3-2|QSER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5645	59.78	3	2763.0262	2763.0262	K	S	983	1006
PSM	NLSFNELYPSGTLK	486	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=6379	68.705	2	1661.7702	1661.7702	R	L	1539	1553
PSM	NTFTAWSDEESDYEIDDRDVNK	487	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,11-UNIMOD:21,18-UNIMOD:267,22-UNIMOD:481	ms_run[2]:scan=5957	63.387	3	2822.0811	2822.0811	K	I	544	566
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	488	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4904	51.731	3	3044.4006	3044.4006	K	H	346	374
PSM	SLKESEQESEEEILAQKK	489	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3924	42.689	3	2263.9862	2263.9862	K	E	219	237
PSM	SLLSHEFQDETDTEEETLYSSKH	490	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5729	60.794	3	2884.1365	2884.1365	K	-	1111	1134
PSM	SLPELDRDKSDSDTEGLLFSR	491	sp|Q9H4G0-3|E41L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6127	65.542	3	2539.0881	2539.0881	R	D	530	551
PSM	STGVSFWTQDSDENEQEQQSDTEEGSNKK	492	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:21	ms_run[2]:scan=5120	53.907	3	3369.343	3369.3430	R	E	765	794
PSM	SVIEGVDEDSDISDDEPSVYSA	493	sp|Q9NUN5-3|LMBD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=6429	69.245	2	2486.9139	2486.9139	K	-	446	468
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	494	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=5327	56.203	3	2925.2471	2925.2471	R	R	67	93
PSM	TGSGSPFAGNSPAREGEQDAASLK	495	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5028	52.912	3	2493.021	2493.0210	K	D	1265	1289
PSM	TSSEDNLYLAVLR	496	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,13-UNIMOD:267	ms_run[2]:scan=6645	71.915	2	1569.7315	1569.7315	R	A	19	32
PSM	TVSASESEDRLVAEQETEPSK	497	sp|Q9ULG6-3|CCPG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4432	47.379	3	2451.0091	2451.0091	K	E	184	205
PSM	VADAKGDSESEEDEDLEVPVPSR	498	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5092	53.58	3	2632.0466	2632.0466	R	F	71	94
PSM	VEAKEESEESDEDMGFGLFD	499	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7125	79.025	2	2437.8434	2437.8434	K	-	236	256
PSM	VTRDYDEEEQGYDSEK	500	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=2774	34.22	2	2041.779	2041.7790	K	E	420	436
PSM	VVEAVNSDSDSEFGIPKK	501	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:21,17-UNIMOD:481,18-UNIMOD:481	ms_run[2]:scan=5280	55.728	3	2167.8968	2167.8968	K	T	1511	1529
PSM	KEESEESDDDMGFGLFD	502	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=6744	73.34864666666667	2	2128.7034	2128.7042	K	-	99	116
PSM	KEESEESDDDMGFGLFD	503	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7521	85.35662333333333	2	2124.6823	2124.6791	K	-	99	116
PSM	KEESEESDDDMGFGLFD	504	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:481,4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=7389	83.20804666666666	2	2112.7092	2112.7093	K	-	99	116
PSM	LFEESDDKEDEDADGKEVEDADEK	505	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=4129	44.696255	3	2836.099435	2836.097150	K	L	672	696
PSM	ESEDKPEIEDVGSDEEEEKK	506	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	5-UNIMOD:481,13-UNIMOD:21,19-UNIMOD:481,20-UNIMOD:481	ms_run[1]:scan=3341	38.284938333333336	3	2412.0499	2412.0489	K	D	251	271
PSM	SETAPAETATPAPVEKSPAKK	507	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,10-UNIMOD:21,16-UNIMOD:481,17-UNIMOD:21,20-UNIMOD:481,21-UNIMOD:481	ms_run[1]:scan=2868	34.926413333333336	3	2323.1153	2323.1134	M	K	2	23
PSM	DLFDLNSSEEDDTEGFSER	508	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	7-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:267	ms_run[1]:scan=7451	84.19209166666667	2	2374.8322	2373.8432	K	G	666	685
PSM	LQEEQDGGSSDEDRAGPAPPGASDGVDIQDVK	509	sp|Q14147|DHX34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=5053	53.13542333333333	3	3398.3856	3398.3819	R	F	741	773
PSM	IKWDEQTSNTKGDDDEESDEEAVK	510	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	18-UNIMOD:21	ms_run[1]:scan=3817	41.811526666666666	3	2847.1630	2847.1602	R	K	602	626