MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F02.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F02.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9HCJ3-2|RAVR2_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 2 OS=Homo sapiens OX=9606 GN=RAVER2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	2-UNIMOD:1	0.04	54.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	2-UNIMOD:1	0.05	54.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	2-UNIMOD:1	0.05	54.0	4	1	0
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1	0.18	51.0	1	1	1
PRT	sp|Q9Y2K2-7|SIK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	2-UNIMOD:1	0.02	48.0	1	1	1
PRT	sp|Q7Z7E8|UB2Q1_HUMAN	Ubiquitin-conjugating enzyme E2 Q1 OS=Homo sapiens OX=9606 GN=UBE2Q1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35,40-UNIMOD:4	0.10	45.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	45.0	4	1	0
PRT	sp|P80297|MT1X_HUMAN	Metallothionein-1X OS=Homo sapiens OX=9606 GN=MT1X PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	44.0	2	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	44.0	8	2	0
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.09	43.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,19-UNIMOD:35	0.07	42.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,25-UNIMOD:35	0.08	42.0	3	2	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,49-UNIMOD:35	0.10	42.0	1	1	1
PRT	sp|Q9HD26-3|GOPC_HUMAN	Isoform 3 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,7-UNIMOD:4,20-UNIMOD:4,30-UNIMOD:35	0.10	41.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.11	41.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.15	40.0	4	2	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.04	39.0	1	1	1
PRT	sp|Q96G46-3|DUS3L_HUMAN	Isoform 3 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.06	39.0	2	1	0
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.15	39.0	1	1	1
PRT	sp|P02795|MT2_HUMAN	Metallothionein-2 OS=Homo sapiens OX=9606 GN=MT2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	39.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.09	39.0	25	3	2
PRT	sp|Q15283-2|RASA2_HUMAN	Isoform 2 of Ras GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RASA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.04	38.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.02	38.0	1	1	1
PRT	sp|Q2VPK5-5|CTU2_HUMAN	Isoform 3 of Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,2-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,14-UNIMOD:35,1-UNIMOD:35	0.03	38.0	4	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.09	38.0	2	2	2
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,9-UNIMOD:4,11-UNIMOD:35,15-UNIMOD:4	0.08	37.0	1	1	1
PRT	sp|Q9UBL3|ASH2L_HUMAN	Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,32-UNIMOD:35	0.05	37.0	2	1	0
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,18-UNIMOD:35,19-UNIMOD:35	0.09	37.0	3	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4	0.05	37.0	23	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:4,16-UNIMOD:35	0.05	37.0	11	1	0
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.06	37.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	37.0	2	1	0
PRT	sp|Q6NUQ1|RINT1_HUMAN	RAD50-interacting protein 1 OS=Homo sapiens OX=9606 GN=RINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4,16-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q8TAE6|PP14C_HUMAN	Protein phosphatase 1 regulatory subunit 14C OS=Homo sapiens OX=9606 GN=PPP1R14C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.12	37.0	1	1	1
PRT	sp|Q6P1K2-3|PMF1_HUMAN	Isoform 3 of Polyamine-modulated factor 1 OS=Homo sapiens OX=9606 GN=PMF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,13-UNIMOD:4	0.09	36.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,10-UNIMOD:35	0.02	36.0	2	1	0
PRT	sp|O60427|FADS1_HUMAN	Acyl-CoA (8-3)-desaturase OS=Homo sapiens OX=9606 GN=FADS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|Q8IVW6-3|ARI3B_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null	3-UNIMOD:1,12-UNIMOD:4,19-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q12962|TAF10_HUMAN	Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,3-UNIMOD:4	0.19	36.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.03	36.0	1	1	1
PRT	sp|Q9NX46|ADPRS_HUMAN	ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,6-UNIMOD:35	0.05	35.0	2	1	0
PRT	sp|Q9UK61-3|TASOR_HUMAN	Isoform 3 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,10-UNIMOD:4,27-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.01	35.0	3	1	0
PRT	sp|P05423|RPC4_HUMAN	DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.06	35.0	3	2	1
PRT	sp|Q96HR3-2|MED30_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 30 OS=Homo sapiens OX=9606 GN=MED30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,11-UNIMOD:35	0.17	35.0	1	1	1
PRT	sp|Q8IWC1|MA7D3_HUMAN	MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	null	3-UNIMOD:1	0.02	35.0	1	1	1
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.04	34.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.04	34.0	1	1	1
PRT	sp|Q7Z7C8|TAF8_HUMAN	Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.05	34.0	1	1	1
PRT	sp|P14859-5|PO2F1_HUMAN	Isoform 5 of POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.03	34.0	1	1	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,18-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q6NXT6-2|TAPT1_HUMAN	Isoform 2 of Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.04	34.0	1	1	0
PRT	sp|Q9GZT9-3|EGLN1_HUMAN	Isoform 3 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.05	34.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.05	34.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.15	34.0	1	1	1
PRT	sp|Q6VN20|RBP10_HUMAN	Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.06	34.0	1	1	1
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.03	33.0	1	1	1
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|Q8IWJ2-3|GCC2_HUMAN	Isoform 2 of GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.42	33.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	33.0	2	1	0
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.07	33.0	5	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.08	33.0	1	1	1
PRT	sp|Q86U42-2|PABP2_HUMAN	Isoform 2 of Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	1	1	1
PRT	sp|Q96E14|RMI2_HUMAN	RecQ-mediated genome instability protein 2 OS=Homo sapiens OX=9606 GN=RMI2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.10	32.0	1	1	1
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	1	1	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,14-UNIMOD:35	0.02	32.0	5	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.02	32.0	1	1	1
PRT	sp|Q8TDX7-2|NEK7_HUMAN	Isoform 2 of Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.17	32.0	1	1	0
PRT	sp|O43399-2|TPD54_HUMAN	Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	32.0	2	1	0
PRT	sp|P10155-2|RO60_HUMAN	Isoform Short of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,8-UNIMOD:35,1-UNIMOD:35	0.07	32.0	4	1	0
PRT	sp|Q6NUT3-2|MFS12_HUMAN	Isoform 2 of Major facilitator superfamily domain-containing protein 12 OS=Homo sapiens OX=9606 GN=MFSD12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.07	32.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.08	32.0	2	1	0
PRT	sp|P0C2W1|FBSP1_HUMAN	F-box/SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FBXO45 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,17-UNIMOD:4	0.13	32.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.02	32.0	1	1	0
PRT	sp|Q9NVE7|PANK4_HUMAN	4'-phosphopantetheine phosphatase OS=Homo sapiens OX=9606 GN=PANK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,4-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.13	31.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,5-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	1	1	1
PRT	sp|Q9UMX0-4|UBQL1_HUMAN	Isoform 4 of Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.19	31.0	1	1	1
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.02	31.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,18-UNIMOD:35	0.11	31.0	4	2	1
PRT	sp|Q5SSJ5-5|HP1B3_HUMAN	Isoform 4 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.10	31.0	1	1	1
PRT	sp|Q9H3F6-2|BACD3_HUMAN	Isoform 2 of BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 OS=Homo sapiens OX=9606 GN=KCTD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.07	31.0	1	1	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	0.09	31.0	1	1	1
PRT	sp|Q96AY4|TTC28_HUMAN	Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P46734|MP2K3_HUMAN	Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.05	31.0	3	1	0
PRT	sp|Q92567-3|F168A_HUMAN	Isoform 3 of Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	31.0	1	1	1
PRT	sp|P56211|ARP19_HUMAN	cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.13	31.0	1	1	1
PRT	sp|Q8TDH9-2|BL1S5_HUMAN	Isoform 2 of Biogenesis of lysosome-related organelles complex 1 subunit 5 OS=Homo sapiens OX=9606 GN=BLOC1S5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,12-UNIMOD:4	0.18	31.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:35	0.08	31.0	1	1	1
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.07	31.0	1	1	1
PRT	sp|P20936|RASA1_HUMAN	Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,34-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	30.0	2	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,13-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,17-UNIMOD:4	0.09	30.0	1	1	1
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	1	1	1
PRT	sp|Q96IZ6|MET2A_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	1	1	1
PRT	sp|Q5TA31|RN187_HUMAN	E3 ubiquitin-protein ligase RNF187 OS=Homo sapiens OX=9606 GN=RNF187 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:4,15-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:4	0.11	30.0	1	1	1
PRT	sp|Q5BKZ1-2|ZN326_HUMAN	Isoform 2 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.19	30.0	1	1	0
PRT	sp|Q9BZ67-2|FRMD8_HUMAN	Isoform 2 of FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.17	30.0	3	1	0
PRT	sp|Q9NX76|CKLF6_HUMAN	CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	30.0	3	1	0
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q9UNI6|DUS12_HUMAN	Dual specificity protein phosphatase 12 OS=Homo sapiens OX=9606 GN=DUSP12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	0.06	30.0	2	1	0
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:35	0.07	30.0	4	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.02	30.0	2	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	30.0	3	2	1
PRT	sp|Q9BZE9|ASPC1_HUMAN	Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1	0.03	30.0	2	1	0
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.04	29.0	2	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.01	29.0	1	1	1
PRT	sp|Q09019|DMWD_HUMAN	Dystrophia myotonica WD repeat-containing protein OS=Homo sapiens OX=9606 GN=DMWD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,16-UNIMOD:35,19-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.11	29.0	1	1	1
PRT	sp|Q9Y5J9|TIM8B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.16	29.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.08	29.0	2	2	2
PRT	sp|Q9NV56|MRGBP_HUMAN	MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.07	29.0	2	2	2
PRT	sp|Q9UHR6|ZNHI2_HUMAN	Zinc finger HIT domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZNHIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|O00422-2|SAP18_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	29.0	3	1	0
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	3	1	0
PRT	sp|P63027|VAMP2_HUMAN	Vesicle-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=VAMP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.25	29.0	2	1	0
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	3-UNIMOD:1	0.03	29.0	1	1	1
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.01	29.0	1	1	1
PRT	sp|Q7L5D6|GET4_HUMAN	Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,7-UNIMOD:35,3-UNIMOD:1	0.04	28.0	4	2	0
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,9-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.09	28.0	2	1	0
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.03	28.0	1	1	1
PRT	sp|Q7L5Y9-5|MAEA_HUMAN	Isoform 5 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,12-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|P51817|PRKX_HUMAN	cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens OX=9606 GN=PRKX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|Q96GX2|A7L3B_HUMAN	Ataxin-7-like protein 3B OS=Homo sapiens OX=9606 GN=ATXN7L3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	28.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.04	28.0	3	1	0
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	28.0	2	2	2
PRT	sp|Q12996-3|CSTF3_HUMAN	Isoform 3 of Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.36	28.0	1	1	1
PRT	sp|P78356-2|PI42B_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,5-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.01	28.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	28.0	1	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.03	28.0	2	1	0
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,5-UNIMOD:35,3-UNIMOD:1	0.17	27.0	4	2	1
PRT	sp|Q9UL63|MKLN1_HUMAN	Muskelin OS=Homo sapiens OX=9606 GN=MKLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,13-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q86WB0-3|NIPA_HUMAN	Isoform 3 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,5-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9Y4E8-4|UBP15_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.09	27.0	1	1	1
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q8N653|LZTR1_HUMAN	Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens OX=9606 GN=LZTR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|Q9Y530|OARD1_HUMAN	ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.08	27.0	1	1	1
PRT	sp|P04733|MT1F_HUMAN	Metallothionein-1F OS=Homo sapiens OX=9606 GN=MT1F PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	27.0	1	1	1
PRT	sp|Q96RG2-4|PASK_HUMAN	Isoform 3 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	27.0	4	1	0
PRT	sp|O75486|SUPT3_HUMAN	Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.06	27.0	3	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.01	27.0	2	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.03	27.0	2	1	0
PRT	sp|Q9BRT3|MIEN1_HUMAN	Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.20	27.0	2	1	0
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,3-UNIMOD:35,7-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|P10155|RO60_HUMAN	60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.03	27.0	1	1	0
PRT	sp|P80294|MT1H_HUMAN	Metallothionein-1H OS=Homo sapiens OX=9606 GN=MT1H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	27.0	1	1	1
PRT	sp|Q9HD20|AT131_HUMAN	Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,13-UNIMOD:4,3-UNIMOD:1	0.01	26.0	2	2	2
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.09	26.0	1	1	1
PRT	sp|Q8WTS1|ABHD5_HUMAN	1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.01	26.0	1	1	1
PRT	sp|Q14CS0|UBX2B_HUMAN	UBX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=UBXN2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	1
PRT	sp|Q9HAB8|PPCS_HUMAN	Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,4-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q9BXR0-2|TGT_HUMAN	Isoform 2 of Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.06	26.0	1	1	1
PRT	sp|Q5T447|HECD3_HUMAN	E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	1	1	1
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.07	26.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|Q9BXF3-2|CECR2_HUMAN	Isoform B of Cat eye syndrome critical region protein 2 OS=Homo sapiens OX=9606 GN=CECR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q8IUH3-2|RBM45_HUMAN	Isoform 2 of RNA-binding protein 45 OS=Homo sapiens OX=9606 GN=RBM45	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	26.0	3	1	0
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	26.0	2	1	0
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	2	1	0
PRT	sp|A1KXE4-2|F168B_HUMAN	Isoform 2 of Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1	0.15	26.0	1	1	0
PRT	sp|Q9BXJ8-2|TACAN_HUMAN	Isoform 2 of Ion channel TACAN OS=Homo sapiens OX=9606 GN=TMEM120A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	3	1	0
PRT	sp|Q6NW29|RWDD4_HUMAN	RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,9-UNIMOD:35	0.07	26.0	1	1	1
PRT	sp|O95391|SLU7_HUMAN	Pre-mRNA-splicing factor SLU7 OS=Homo sapiens OX=9606 GN=SLU7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|P08397-3|HEM3_HUMAN	Isoform 3 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.05	26.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,15-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q8N6T7-2|SIR6_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens OX=9606 GN=SIRT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	2	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	1
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.02	26.0	1	1	1
PRT	sp|P07438|MT1B_HUMAN	Metallothionein-1B OS=Homo sapiens OX=9606 GN=MT1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	26.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|Q9Y3C7|MED31_HUMAN	Mediator of RNA polymerase II transcription subunit 31 OS=Homo sapiens OX=9606 GN=MED31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:35	0.11	25.0	2	1	0
PRT	sp|Q96BP3|PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.06	25.0	1	1	1
PRT	sp|Q02978-2|M2OM_HUMAN	Isoform 2 of Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|O60518|RNBP6_HUMAN	Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	2	2	2
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	3	1	0
PRT	sp|P49589-3|SYCC_HUMAN	Isoform 3 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q96EC8-2|YIPF6_HUMAN	Isoform 2 of Protein YIPF6 OS=Homo sapiens OX=9606 GN=YIPF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|Q53GT1|KLH22_HUMAN	Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,11-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q92830|KAT2A_HUMAN	Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,5-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q8IWV8-2|UBR2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,12-UNIMOD:4	0.07	25.0	2	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|P55957-3|BID_HUMAN	Isoform 3 of BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	0.09	25.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	25.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|Q8N1B3-2|CCNQ_HUMAN	Isoform 2 of Cyclin-Q OS=Homo sapiens OX=9606 GN=CCNQ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.05	25.0	11	1	0
PRT	sp|Q8N2Z9-3|CENPS_HUMAN	Isoform 3 of Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	25.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.00	25.0	5	1	0
PRT	sp|Q9BYE7-3|PCGF6_HUMAN	Isoform 3 of Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	25.0	3	1	0
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|Q9ULR5|PAI2B_HUMAN	Polyadenylate-binding protein-interacting protein 2B OS=Homo sapiens OX=9606 GN=PAIP2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.11	25.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.01	25.0	2	1	0
PRT	sp|P60602-2|ROMO1_HUMAN	Isoform 2 of Reactive oxygen species modulator 1 OS=Homo sapiens OX=9606 GN=ROMO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	15-UNIMOD:4	0.29	25.0	1	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	2	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	2	2	2
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	2	1	0
PRT	sp|P60602|ROMO1_HUMAN	Reactive oxygen species modulator 1 OS=Homo sapiens OX=9606 GN=ROMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	15-UNIMOD:4	0.22	25.0	1	1	0
PRT	sp|Q6NXT6|TAPT1_HUMAN	Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	0
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,19-UNIMOD:4,20-UNIMOD:4	0.13	25.0	1	1	1
PRT	sp|Q9NXW9-2|ALKB4_HUMAN	Isoform 2 of Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4 OS=Homo sapiens OX=9606 GN=ALKBH4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.29	24.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|Q9UMN6-2|KMT2B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q86YN1-2|DOPP1_HUMAN	Isoform 2 of Dolichyldiphosphatase 1 OS=Homo sapiens OX=9606 GN=DOLPP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,7-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q9NWT6|HIF1N_HUMAN	Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q9H920|RN121_HUMAN	RING finger protein 121 OS=Homo sapiens OX=9606 GN=RNF121 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.08	24.0	1	1	1
PRT	sp|P47755-2|CAZA2_HUMAN	Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.07	24.0	1	1	1
PRT	sp|Q4V328-2|GRAP1_HUMAN	Isoform 2 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q99622|C10_HUMAN	Protein C10 OS=Homo sapiens OX=9606 GN=C12orf57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.13	24.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|O14530-2|TXND9_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.06	24.0	2	1	0
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	0.12	24.0	1	1	1
PRT	sp|Q8NEZ5-2|FBX22_HUMAN	Isoform 2 of F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	0.24	24.0	1	1	1
PRT	sp|Q96RS6|NUDC1_HUMAN	NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	0.02	24.0	4	1	0
PRT	sp|Q8NBZ0-2|IN80E_HUMAN	Isoform 2 of INO80 complex subunit E OS=Homo sapiens OX=9606 GN=INO80E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q6PEV8-2|F199X_HUMAN	Isoform 2 of Protein FAM199X OS=Homo sapiens OX=9606 GN=FAM199X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	24.0	5	2	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|Q9UPR3|SMG5_HUMAN	Protein SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,13-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|O43805|SSNA1_HUMAN	Sjoegren syndrome nuclear autoantigen 1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.14	24.0	2	2	2
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,9-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q8NFJ9-3|BBS1_HUMAN	Isoform 2 of Bardet-Biedl syndrome 1 protein OS=Homo sapiens OX=9606 GN=BBS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,12-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O95352-3|ATG7_HUMAN	Isoform 3 of Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q9NRY2-2|SOSSC_HUMAN	Isoform 2 of SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.27	23.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.05	23.0	3	1	0
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	23.0	1	1	0
PRT	sp|Q96JB2-2|COG3_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 3 OS=Homo sapiens OX=9606 GN=COG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	2	1	0
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,4-UNIMOD:35	0.06	23.0	1	1	1
PRT	sp|Q9NRG1-3|PRDC1_HUMAN	Isoform 3 of Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.07	23.0	1	1	1
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,9-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q12955-5|ANK3_HUMAN	Isoform 3 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q9BQS8-3|FYCO1_HUMAN	Isoform 3 of FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q8N128|F177A_HUMAN	Protein FAM177A1 OS=Homo sapiens OX=9606 GN=FAM177A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|Q8IY22|CMIP_HUMAN	C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|Q15438-2|CYH1_HUMAN	Isoform 2 of Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	23.0	2	1	0
PRT	sp|P42771-3|CDN2A_HUMAN	Isoform 3 of Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.19	23.0	1	1	1
PRT	sp|P47224|MSS4_HUMAN	Guanine nucleotide exchange factor MSS4 OS=Homo sapiens OX=9606 GN=RABIF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1	0.13	23.0	1	1	1
PRT	sp|Q9BQC3-2|DPH2_HUMAN	Isoform 2 of 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.06	23.0	1	1	0
PRT	sp|Q9H6R4-3|NOL6_HUMAN	Isoform 3 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P20248|CCNA2_HUMAN	Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	2	1	0
PRT	sp|Q92796-3|DLG3_HUMAN	Isoform 3 of Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,6-UNIMOD:35,2-UNIMOD:1	0.04	23.0	2	2	2
PRT	sp|Q5T7W0-3|ZN618_HUMAN	Isoform 3 of Zinc finger protein 618 OS=Homo sapiens OX=9606 GN=ZNF618	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	23.0	1	1	1
PRT	sp|A4D1U4|DEN11_HUMAN	DENN domain-containing protein 11 OS=Homo sapiens OX=9606 GN=DENND11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P62995|TRA2B_HUMAN	Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|Q99496-2|RING2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	0
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	23.0	1	1	0
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,8-UNIMOD:35,21-UNIMOD:35,25-UNIMOD:4	0.09	23.0	1	1	1
PRT	sp|Q9BQC3|DPH2_HUMAN	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	23.0	1	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q8NBT0-2|POC1A_HUMAN	Isoform 2 of POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,5-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,14-UNIMOD:4	0.04	22.0	3	1	0
PRT	sp|Q3ZCW2|LEGL_HUMAN	Galectin-related protein OS=Homo sapiens OX=9606 GN=LGALSL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.07	22.0	1	1	1
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.09	22.0	2	1	0
PRT	sp|P78347-5|GTF2I_HUMAN	Isoform 5 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,6-UNIMOD:35	0.07	22.0	2	1	0
PRT	sp|Q5VSY0-2|GKAP1_HUMAN	Isoform 2 of G kinase-anchoring protein 1 OS=Homo sapiens OX=9606 GN=GKAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q9P0P0|RN181_HUMAN	E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens OX=9606 GN=RNF181 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:4	0.12	22.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,4-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	22.0	2	1	0
PRT	sp|Q9H609|ZN576_HUMAN	Zinc finger protein 576 OS=Homo sapiens OX=9606 GN=ZNF576 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	22.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q9UJY5-5|GGA1_HUMAN	Isoform 5 of ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.15	22.0	1	1	1
PRT	sp|Q96EY9|ADAT3_HUMAN	Probable inactive tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens OX=9606 GN=ADAT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|Q96Q89-4|KI20B_HUMAN	Isoform 4 of Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	22.0	1	1	0
PRT	sp|Q6E0U4-8|DMKN_HUMAN	Isoform 8 of Dermokine OS=Homo sapiens OX=9606 GN=DMKN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	3	1	0
PRT	sp|Q6PL24|TMED8_HUMAN	Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q5JPI3-2|CC038_HUMAN	Isoform 2 of Uncharacterized protein C3orf38 OS=Homo sapiens OX=9606 GN=C3orf38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.19	22.0	1	1	1
PRT	sp|O14907|TX1B3_HUMAN	Tax1-binding protein 3 OS=Homo sapiens OX=9606 GN=TAX1BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.11	22.0	1	1	1
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	3-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q9UID3|VPS51_HUMAN	Vacuolar protein sorting-associated protein 51 homolog OS=Homo sapiens OX=9606 GN=VPS51 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	2	1	0
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.07	21.0	1	1	1
PRT	sp|Q9UJX6-2|ANC2_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,7-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|Q15542-2|TAF5_HUMAN	Isoform Short of Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|P00167-2|CYB5_HUMAN	Isoform 2 of Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.09	21.0	1	1	1
PRT	sp|Q16637-4|SMN_HUMAN	Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:35	0.08	21.0	1	1	1
PRT	sp|Q08AE8-2|SPIR1_HUMAN	Isoform 2 of Protein spire homolog 1 OS=Homo sapiens OX=9606 GN=SPIRE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q712K3|UB2R2_HUMAN	Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35	0.04	21.0	2	1	0
PRT	sp|O75164|KDM4A_HUMAN	Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q92888-3|ARHG1_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.11	21.0	1	1	1
PRT	sp|O60293-4|ZC3H1_HUMAN	Isoform 4 of Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,7-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.06	21.0	2	1	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.07	21.0	1	1	1
PRT	sp|Q9UBF8-2|PI4KB_HUMAN	Isoform 2 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.12	21.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q9Y421-2|FA32A_HUMAN	Isoform 2 of Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	21.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	2	2	2
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.03	21.0	2	2	2
PRT	sp|Q9NPA3|M1IP1_HUMAN	Mid1-interacting protein 1 OS=Homo sapiens OX=9606 GN=MID1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	0.06	21.0	3	1	0
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	0.01	21.0	2	1	0
PRT	sp|Q13772-2|NCOA4_HUMAN	Isoform Beta of Nuclear receptor coactivator 4 OS=Homo sapiens OX=9606 GN=NCOA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.00	21.0	2	2	2
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|O60825-2|F262_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35,12-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,5-UNIMOD:35	0.10	21.0	1	1	1
PRT	sp|O00401|WASL_HUMAN	Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q8WWK9-4|CKAP2_HUMAN	Isoform 2 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	2	1	0
PRT	sp|Q0VGL1|LTOR4_HUMAN	Ragulator complex protein LAMTOR4 OS=Homo sapiens OX=9606 GN=LAMTOR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.11	21.0	2	2	2
PRT	sp|O15151-3|MDM4_HUMAN	Isoform 3 of Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,10-UNIMOD:4,17-UNIMOD:4	0.13	21.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q99942|RNF5_HUMAN	E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|Q8TEL6-2|TP4AP_HUMAN	Isoform 2 of Short transient receptor potential channel 4-associated protein OS=Homo sapiens OX=9606 GN=TRPC4AP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.00	20.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O14744-5|ANM5_HUMAN	Isoform 5 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q7Z388|D19L4_HUMAN	Probable C-mannosyltransferase DPY19L4 OS=Homo sapiens OX=9606 GN=DPY19L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q02224-3|CENPE_HUMAN	Isoform 3 of Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,10-UNIMOD:4	0.00	20.0	1	1	1
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O95716|RAB3D_HUMAN	Ras-related protein Rab-3D OS=Homo sapiens OX=9606 GN=RAB3D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q9BSM1|PCGF1_HUMAN	Polycomb group RING finger protein 1 OS=Homo sapiens OX=9606 GN=PCGF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,13-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|Q9NW64-2|RBM22_HUMAN	Isoform 2 of Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9GZU7-2|CTDS1_HUMAN	Isoform 2 of Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens OX=9606 GN=CTDSP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	20.0	2	1	0
PRT	sp|Q96FL8-2|S47A1_HUMAN	Isoform 2 of Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|O60346|PHLP1_HUMAN	PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|Q8TDP1|RNH2C_HUMAN	Ribonuclease H2 subunit C OS=Homo sapiens OX=9606 GN=RNASEH2C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	20.0	1	1	1
PRT	sp|Q5TB30-2|DEP1A_HUMAN	Isoform 2 of DEP domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DEPDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|O75143-3|ATG13_HUMAN	Isoform 3 of Autophagy-related protein 13 OS=Homo sapiens OX=9606 GN=ATG13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q8WVX3|CD003_HUMAN	Uncharacterized protein C4orf3 OS=Homo sapiens OX=9606 GN=C4orf3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.17	20.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	2	1	0
PRT	sp|P58004|SESN2_HUMAN	Sestrin-2 OS=Homo sapiens OX=9606 GN=SESN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q7L1T6|NB5R4_HUMAN	Cytochrome b5 reductase 4 OS=Homo sapiens OX=9606 GN=CYB5R4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q9UPQ3-3|AGAP1_HUMAN	Isoform 3 of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.06	20.0	3	2	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q96P16|RPR1A_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	2	2	2
PRT	sp|Q9UBB6|NCDN_HUMAN	Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,3-UNIMOD:4,4-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q15836|VAMP3_HUMAN	Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.12	20.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	20.0	3	2	0
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.04	20.0	4	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q99496|RING2_HUMAN	E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	0
PRT	sp|Q9H9R9|DBND1_HUMAN	Dysbindin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DBNDD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	20.0	1	1	1
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.09	19.0	1	1	1
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q9Y312|AAR2_HUMAN	Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	19.0	2	2	2
PRT	sp|Q9NQZ6-2|ZC4H2_HUMAN	Isoform 2 of Zinc finger C4H2 domain-containing protein OS=Homo sapiens OX=9606 GN=ZC4H2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,8-UNIMOD:35,9-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	19.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|Q9H8V3-2|ECT2_HUMAN	Isoform 2 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|P51795|CLCN5_HUMAN	H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens OX=9606 GN=CLCN5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,3-UNIMOD:35,8-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|P59768|GBG2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Homo sapiens OX=9606 GN=GNG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.17	19.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q14CB8-5|RHG19_HUMAN	Isoform 5 of Rho GTPase-activating protein 19 OS=Homo sapiens OX=9606 GN=ARHGAP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	0
PRT	sp|Q9HCG7-2|GBA2_HUMAN	Isoform 2 of Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:35,21-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q13418-2|ILK_HUMAN	Isoform 2 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P60059|SC61G_HUMAN	Protein transport protein Sec61 subunit gamma OS=Homo sapiens OX=9606 GN=SEC61G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.18	19.0	2	1	0
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q8IUH4|ZDH13_HUMAN	Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|O95551-3|TYDP2_HUMAN	Isoform 3 of Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	0.04	19.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|P49069|CAMLG_HUMAN	Calcium signal-modulating cyclophilin ligand OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q8N8R7|AL14E_HUMAN	ARL14 effector protein OS=Homo sapiens OX=9606 GN=ARL14EP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q9H446|RWDD1_HUMAN	RWD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RWDD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q96D09|GASP2_HUMAN	G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q6P4A7-2|SFXN4_HUMAN	Isoform 2 of Sideroflexin-4 OS=Homo sapiens OX=9606 GN=SFXN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|O95777|LSM8_HUMAN	U6 snRNA-associated Sm-like protein LSm8 OS=Homo sapiens OX=9606 GN=LSM8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.10	19.0	1	1	1
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,4-UNIMOD:35,5-UNIMOD:35	0.08	19.0	3	1	0
PRT	sp|Q6P1S2|CC033_HUMAN	Protein C3orf33 OS=Homo sapiens OX=9606 GN=C3orf33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.05	19.0	2	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	19.0	1	1	0
PRT	sp|Q8TDX7|NEK7_HUMAN	Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,8-UNIMOD:35	0.07	19.0	1	1	0
PRT	sp|Q9NQ92|COPRS_HUMAN	Coordinator of PRMT5 and differentiation stimulator OS=Homo sapiens OX=9606 GN=COPRS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	19.0	1	1	1
PRT	sp|Q14CB8|RHG19_HUMAN	Rho GTPase-activating protein 19 OS=Homo sapiens OX=9606 GN=ARHGAP19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	0
PRT	sp|Q9NUI1|DECR2_HUMAN	Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q9Y3B8-3|ORN_HUMAN	Isoform 3 of Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|O14641|DVL2_HUMAN	Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q9UPP1-5|PHF8_HUMAN	Isoform 5 of Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	18.0	1	1	1
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.02	18.0	2	1	0
PRT	sp|Q96DT6|ATG4C_HUMAN	Cysteine protease ATG4C OS=Homo sapiens OX=9606 GN=ATG4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q6IEG0-2|SNR48_HUMAN	Isoform 2 of U11/U12 small nuclear ribonucleoprotein 48 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP48	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	18.0	1	1	1
PRT	sp|Q9UIM3|FKBPL_HUMAN	FK506-binding protein-like OS=Homo sapiens OX=9606 GN=FKBPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	18.0	2	1	0
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	3-UNIMOD:35	0.10	18.0	3	1	0
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q9GZN1-2|ARP6_HUMAN	Isoform 2 of Actin-related protein 6 OS=Homo sapiens OX=9606 GN=ACTR6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.07	18.0	1	1	1
PRT	sp|Q96BD8|SKA1_HUMAN	Spindle and kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=SKA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,10-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|Q96SL8|FIZ1_HUMAN	Flt3-interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=FIZ1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|O60610|DIAP1_HUMAN	Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.01	18.0	1	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q8N1B4|VPS52_HUMAN	Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens OX=9606 GN=VPS52 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q6PJ69|TRI65_HUMAN	Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q5SRE7-2|PHYD1_HUMAN	Isoform 2 of Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHYHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,3-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	17.0	3	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.11	17.0	1	1	1
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|P36543-3|VATE1_HUMAN	Isoform 3 of V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.05	17.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|Q7Z3C6-3|ATG9A_HUMAN	Isoform 3 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	2	1	0
PRT	sp|Q16611-2|BAK_HUMAN	Isoform 2 of Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.07	17.0	1	1	1
PRT	sp|Q96SU4-7|OSBL9_HUMAN	Isoform 7 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.06	17.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:4,8-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:35,8-UNIMOD:35	0.01	17.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q8NG31-3|KNL1_HUMAN	Isoform 3 of Kinetochore scaffold 1 OS=Homo sapiens OX=9606 GN=KNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|O60337-5|MARH6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MARCHF6 OS=Homo sapiens OX=9606 GN=MARCHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q7Z4G1|COMD6_HUMAN	COMM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=COMMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	17.0	1	1	1
PRT	sp|P0DPB5|RPC22_HUMAN	Protein POLR1D, isoform 2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	17.0	2	1	0
PRT	sp|O43310|CTIF_HUMAN	CBP80/20-dependent translation initiation factor OS=Homo sapiens OX=9606 GN=CTIF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|O43760|SNG2_HUMAN	Synaptogyrin-2 OS=Homo sapiens OX=9606 GN=SYNGR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	17.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q7L804|RFIP2_HUMAN	Rab11 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=RAB11FIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	2	2	2
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:35,5-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q92738|US6NL_HUMAN	USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q15007-2|FL2D_HUMAN	Isoform 2 of Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	17.0	1	1	1
PRT	sp|Q8TF71|MOT10_HUMAN	Monocarboxylate transporter 10 OS=Homo sapiens OX=9606 GN=SLC16A10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|O60262|GBG7_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Homo sapiens OX=9606 GN=GNG7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.15	17.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:4	0.10	17.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,9-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q5JPI9|EFMT2_HUMAN	EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.05	17.0	1	1	1
PRT	sp|Q86U70|LDB1_HUMAN	LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P21283|VATC1_HUMAN	V-type proton ATPase subunit C 1 OS=Homo sapiens OX=9606 GN=ATP6V1C1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	17.0	1	1	0
PRT	sp|Q03181|PPARD_HUMAN	Peroxisome proliferator-activated receptor delta OS=Homo sapiens OX=9606 GN=PPARD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q12986|NFX1_HUMAN	Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	3-UNIMOD:1,3-UNIMOD:35	0.02	17.0	2	1	0
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	3-UNIMOD:1,10-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q6QNY1|BL1S2_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.08	16.0	1	1	1
PRT	sp|Q86U28-2|ISCA2_HUMAN	Isoform 2 of Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.23	16.0	1	1	1
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.10	16.0	1	1	1
PRT	sp|Q9Y5Z9-2|UBIA1_HUMAN	Isoform 2 of UbiA prenyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBIAD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.05	16.0	1	1	1
PRT	sp|Q9BW30|TPPP3_HUMAN	Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,7-UNIMOD:35	0.08	16.0	1	1	1
PRT	sp|P62495|ERF1_HUMAN	Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	0.05	16.0	2	1	0
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.09	16.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|Q8N5X7|IF4E3_HUMAN	Eukaryotic translation initiation factor 4E type 3 OS=Homo sapiens OX=9606 GN=EIF4E3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.06	16.0	1	1	1
PRT	sp|P52655|TF2AA_HUMAN	Transcription initiation factor IIA subunit 1 OS=Homo sapiens OX=9606 GN=GTF2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q99541|PLIN2_HUMAN	Perilipin-2 OS=Homo sapiens OX=9606 GN=PLIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q9NTJ5|SAC1_HUMAN	Phosphatidylinositol-3-phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q8N3R9-2|MPP5_HUMAN	Isoform 2 of MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,5-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.02	16.0	3	2	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q96F63|CCD97_HUMAN	Coiled-coil domain-containing protein 97 OS=Homo sapiens OX=9606 GN=CCDC97 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q8WVP7-2|LMBR1_HUMAN	Isoform 2 of Limb region 1 protein homolog OS=Homo sapiens OX=9606 GN=LMBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q00994-2|BEX3_HUMAN	Isoform 2 of Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.12	16.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q9Y371|SHLB1_HUMAN	Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	8-UNIMOD:4,17-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9BX40-2|LS14B_HUMAN	Isoform 2 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|P50151|GBG10_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 OS=Homo sapiens OX=9606 GN=GNG10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.16	16.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q9UL45-2|BL1S6_HUMAN	Isoform 2 of Biogenesis of lysosome-related organelles complex 1 subunit 6 OS=Homo sapiens OX=9606 GN=BLOC1S6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.18	16.0	1	1	1
PRT	sp|Q96HN2-2|SAHH3_HUMAN	Isoform 2 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q86Y82|STX12_HUMAN	Syntaxin-12 OS=Homo sapiens OX=9606 GN=STX12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,8-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q8WWK9|CKAP2_HUMAN	Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	0
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	0
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.05	16.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|O75151|PHF2_HUMAN	Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|Q00975|CAC1B_HUMAN	Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1117-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q5VWZ2-2|LYPL1_HUMAN	Isoform 2 of Lysophospholipase-like protein 1 OS=Homo sapiens OX=9606 GN=LYPLAL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.05	15.0	1	1	1
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.12	15.0	1	1	1
PRT	sp|Q12986-3|NFX1_HUMAN	Isoform 3 of Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.01	15.0	1	1	0
PRT	sp|O14545-2|TRAD1_HUMAN	Isoform 2 of TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.06	15.0	1	1	1
PRT	sp|Q9NXV2|KCTD5_HUMAN	BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,6-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.04	15.0	1	1	1
PRT	sp|Q9P015|RM15_HUMAN	39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.03	15.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,10-UNIMOD:35	0.01	15.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.00	15.0	1	1	1
PRT	sp|P35754|GLRX1_HUMAN	Glutaredoxin-1 OS=Homo sapiens OX=9606 GN=GLRX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,8-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|O00443-2|P3C2A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.02	15.0	1	1	1
PRT	sp|O95861-4|BPNT1_HUMAN	Isoform 4 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,9-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|Q9NR56-3|MBNL1_HUMAN	Isoform 3 of Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.04	15.0	1	1	1
PRT	sp|Q9NRG9-2|AAAS_HUMAN	Isoform 2 of Aladin OS=Homo sapiens OX=9606 GN=AAAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,2-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q4ZHG4-2|FNDC1_HUMAN	Isoform 2 of Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UHB6-2|LIMA1_HUMAN	Isoform Alpha of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q13188|STK3_HUMAN	Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q92734-4|TFG_HUMAN	Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	15.0	1	1	1
PRT	sp|Q13401-3|PM2P3_HUMAN	Isoform 3 of Putative postmeiotic segregation increased 2-like protein 3 OS=Homo sapiens OX=9606 GN=PMS2P3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	15.0	1	1	1
PRT	sp|Q9BSY4|CHCH5_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CHCHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	15.0	1	1	1
PRT	sp|Q9BSC4-2|NOL10_HUMAN	Isoform 2 of Nucleolar protein 10 OS=Homo sapiens OX=9606 GN=NOL10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q9NXR7-1|BABA2_HUMAN	Isoform 1 of BRISC and BRCA1-A complex member 2 OS=Homo sapiens OX=9606 GN=BABAM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q9BV86-2|NTM1A_HUMAN	Isoform 2 of N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	15.0	1	1	1
PRT	sp|Q8WVX9|FACR1_HUMAN	Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P35250|RFC2_HUMAN	Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.07	15.0	1	1	1
PRT	sp|O94806|KPCD3_HUMAN	Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.01	15.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q9BU02|THTPA_HUMAN	Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.04	15.0	1	1	1
PRT	sp|Q5SXM2|SNPC4_HUMAN	snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.00	15.0	1	1	1
PRT	sp|Q9H706|GARE1_HUMAN	GRB2-associated and regulator of MAPK protein 1 OS=Homo sapiens OX=9606 GN=GAREM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|Q7Z3C6|ATG9A_HUMAN	Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.01	15.0	1	1	0
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1	0.02	15.0	1	1	1
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.02	15.0	1	1	1
PRT	sp|Q5T6V5|QSPP_HUMAN	Queuosine salvage protein OS=Homo sapiens OX=9606 GN=C9orf64 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q15645|PCH2_HUMAN	Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q96NE9|FRMD6_HUMAN	FERM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FRMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	359-UNIMOD:35	0.03	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AAAAGDGGGEGGAGLGSAAGLGPGPGL	1	sp|Q9HCJ3-2|RAVR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1	ms_run[2]:scan=7370	29.577	2	2105.9978	2105.9978	M	R	2	29
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAF	2	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1	ms_run[2]:scan=6580	27.218	2	2550.0895	2550.0895	M	K	2	32
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	3	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1	ms_run[2]:scan=5825	24.735	3	3089.3751	3089.3751	M	R	2	40
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	4	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1	ms_run[2]:scan=5993	25.338	2	2001.9392	2001.9392	M	R	2	27
PSM	AAAAASGAGGAAGAGTGGAGPAG	5	sp|Q9Y2K2-7|SIK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:1	ms_run[2]:scan=4981	21.591	2	1639.755	1639.7550	M	R	2	25
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	6	sp|Q7Z7E8|UB2Q1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35,40-UNIMOD:4	ms_run[2]:scan=6417	26.71	3	3815.7493	3815.7493	-	R	1	42
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	7	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5837	24.7699776856	2	2498.100835	2498.096623	-	R	1	28
PSM	MDPNCSCSPVGSCACAGSC	8	sp|P80297|MT1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5015	21.733	2	2133.6989	2133.6989	-	K	1	20
PSM	METEQPEETFPNTETNGEFGK	9	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5918	25.057	2	2472.0275	2472.0275	-	R	1	22
PSM	AGGGAGDPGLGAAAAPAPET	10	sp|Q13637|RAB32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=5759	24.47	2	1648.7693	1648.7693	M	R	2	22
PSM	METEQPEETFPNTETNGEFGK	11	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=6337	26.474	2	2456.0326	2456.0326	-	R	1	22
PSM	ADDAGAAGGPGGPGGPGMGN	12	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=4741	20.559	2	1639.6533	1639.6533	M	R	2	22
PSM	SASAPAAEGEGTPTQPASE	13	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=4815	20.887	2	1798.7857	1798.7857	M	K	2	21
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	14	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,48-UNIMOD:35	ms_run[2]:scan=6385	26.602	3	4211.9149	4211.9149	M	R	2	50
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	15	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5961	25.2105224624	2	2498.100835	2498.096623	-	R	1	28
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	16	sp|Q9HD26-3|GOPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4,29-UNIMOD:35	ms_run[2]:scan=6701	27.626	2	2605.0996	2605.0996	M	R	2	32
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	17	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=6044	25.524	3	3089.3751	3089.3751	M	R	2	40
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	18	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=6242	26.156	3	3008.4098	3008.4098	M	K	2	33
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	19	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,24-UNIMOD:35	ms_run[2]:scan=4965	21.523	3	2680.181	2680.1810	M	R	2	29
PSM	SDAAVDTSSEITTKDL	20	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=6135	25.823	2	1693.7894	1693.7894	M	K	2	18
PSM	AASAAAASAAAASAASGSPGPGEGSAGGE	21	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6323	26.426	3	2300.0153	2300.0153	M	K	2	31
PSM	AEGTAEAPLENGGGGDSGAGALE	22	sp|Q96G46-3|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6178	25.958	2	2070.8978	2070.8978	M	R	2	25
PSM	AGAGSAAVSGAGTPVAGPTG	23	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=5488	23.503	2	1596.7744	1596.7744	M	R	2	22
PSM	MDPNCSCAAGDSCTCAGSC	24	sp|P02795|MT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=4487	19.387	2	2137.6574	2137.6574	-	K	1	20
PSM	MELEDGVVYQEEPGGSGAVMSE	25	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=6699	27.616	2	2385.9828	2385.9828	-	R	1	23
PSM	MEQPGAAASGAGGGSEEPGGG	26	sp|O60879-2|DIAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4606	19.947	2	1830.7326	1830.7326	-	R	1	22
PSM	SETAPAAPAAAPPAE	27	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=5077	21.981	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAEKAPV	28	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=5233	22.547	2	1786.9101	1786.9101	M	K	2	21
PSM	AAAAPAAAAASSEAPAASATAEPEAGDQDS	29	sp|Q15283-2|RASA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=5628	24.01	3	2668.1736	2668.1736	M	R	2	32
PSM	AAATGAVAASAASGQAEG	30	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=5537	23.707	2	1501.7009	1501.7009	M	K	2	20
PSM	CQVGEDYGEPAPEEPPPAP	31	sp|Q2VPK5-5|CTU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=6210	26.059	2	2079.8732	2079.8732	M	R	2	21
PSM	MDELAGGGGGGPGMAAPP	32	sp|Q13033-2|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=6733	27.718	2	1598.6705	1598.6705	-	R	1	19
PSM	SETAPAAPAAPAPAEKTPV	33	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=5214	22.483	2	1816.9207	1816.9207	M	K	2	21
PSM	AAAEAANCIMEVSCGQAESSE	34	sp|Q99873-5|ANM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=7040	28.611	2	2241.8824	2241.8824	M	K	2	23
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	35	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,31-UNIMOD:35	ms_run[2]:scan=5737	24.375	3	2680.1671	2680.1671	M	K	2	33
PSM	ADTTPNGPQGAGAVQFMMTN	36	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=6611	27.327	2	2064.8881	2064.8881	M	K	2	22
PSM	ADTTPNGPQGAGAVQFMMTN	37	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=6793	27.893	2	2064.8881	2064.8881	M	K	2	22
PSM	DDDIAALVVDNGSGMC	38	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8408	32.686	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	39	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7578	29.964	2	1748.7597	1748.7597	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	40	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6014	25.407	2	1910.8494	1910.8494	M	K	2	24
PSM	MEAAVGVPDGGDQGGAGP	41	sp|Q01804|OTUD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5692	24.234	2	1641.6941	1641.6941	-	R	1	19
PSM	MLPAGEIGASPAAPCCSESGDE	42	sp|Q6NUQ1|RINT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6414	26.699	2	2262.9079	2262.9079	-	R	1	23
PSM	SVATGSSETAGGASGGGA	43	sp|Q8TAE6|PP14C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=4524	19.563	2	1464.6328	1464.6328	M	R	2	20
PSM	AEASSANLGSGCEE	44	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5062	21.923	2	1422.5569	1422.5569	M	K	2	16
PSM	AESSESFTMASSPAQ	45	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=5493	23.524	2	1586.6406	1586.6406	M	R	2	17
PSM	DDDIAALVVDNGSGMC	46	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7900	30.978	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	47	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8103	31.655	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	48	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8492	33.025	2	1708.692	1708.6920	M	K	2	18
PSM	MAPDPVAAETAAQGPTP	49	sp|O60427|FADS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6168	25.932	2	1680.7665	1680.7665	-	R	1	18
PSM	MDELAGGGGGGPGMAAPP	50	sp|Q13033-2|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=5652	24.089	2	1614.6654	1614.6654	-	R	1	19
PSM	MEPLQQQQQQQQQQQ	51	sp|Q8IVW6-3|ARI3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4763	20.658	2	1954.8803	1954.8803	-	K	1	16
PSM	MEPLQQQQQQQQQQQ	52	sp|Q8IVW6-3|ARI3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5693	24.237	2	1938.8854	1938.8854	-	K	1	16
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	53	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=8386	32.603477334400004	3	3089.3801	3089.3746	M	R	2	40
PSM	EEEDSTALVCDNGSGLC	54	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1,10-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=6456	26.826822036266666	2	1896.7371	1896.7348	C	K	3	20
PSM	SCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAEN	55	sp|Q12962|TAF10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1,2-UNIMOD:4	ms_run[1]:scan=6278	26.290673631466667	3	3587.6393	3587.6317	M	K	2	42
PSM	AETLPGSGDSGPGTASLGPGVAETGT	56	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=6661	27.496092795733333	2	2327.0822	2327.0760	M	R	2	28
PSM	AAAAMAAAAGGGAGAA	57	sp|Q9NX46|ADPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5373	23.104	2	1216.5506	1216.5506	M	R	2	18
PSM	ATAVETEACQPTDASWESGGGGDDEM	58	sp|Q9UK61-3|TASOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,9-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=6335	26.465	3	2728.0388	2728.0389	M	K	2	28
PSM	DDDIAALVVDNGSGMC	59	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7678	30.252	2	1708.692	1708.6920	M	K	2	18
PSM	MDPNCSCSPVGSCACAGSC	60	sp|P80297|MT1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5696	24.245	2	2117.7039	2117.7039	-	K	1	20
PSM	MEAAVGVPDGGDQGGAGP	61	sp|Q01804|OTUD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6676	27.541	2	1625.6991	1625.6992	-	R	1	19
PSM	MEVSPLQPVNENMQVN	62	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=6200	26.02	2	1901.8499	1901.8499	-	K	1	17
PSM	SEGNAAGEPSTPGGPRPLLTGA	63	sp|P05423|RPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=5960	25.205	2	2077.0076	2077.0076	M	R	2	24
PSM	STPPLAASGMAPGPFAGPQAQQAA	64	sp|Q96HR3-2|MED30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=6866	28.123	2	2280.0845	2280.0845	M	R	2	26
PSM	ADGAAAGAGGSPSL	65	sp|Q8IWC1|MA7D3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=5713	24.303841029066668	2	1142.5208	1142.5199	M	R	3	17
PSM	AAAAAAAPSGGGGGGEEE	66	sp|P51608-2|MECP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=4734	20.527	2	1470.6223	1470.6223	M	R	2	20
PSM	AASAAAAELQASGGP	67	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=7105	28.784	2	1312.6259	1312.6259	M	R	2	17
PSM	ADAAATAGAGGSGT	68	sp|Q7Z7C8|TAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=4499	19.443	2	1118.484	1118.4840	M	R	2	16
PSM	ADGGAASQDESSAAAAAAADS	69	sp|P14859-5|PO2F1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=5408	23.219	2	1834.7453	1834.7453	M	R	2	23
PSM	AFAETYPAASSLPNGDCG	70	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=7269	29.268	2	1868.7887	1868.7887	M	R	2	20
PSM	AGVGDAAAPGEGGGGGVDGPQ	71	sp|Q6NXT6-2|TAPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=5355	23.023	2	1736.7602	1736.7602	M	R	2	23
PSM	ANDSGGPGGPSPSE	72	sp|Q9GZT9-3|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=4381	18.891	2	1269.5109	1269.5109	M	R	2	16
PSM	AVAAAAAAAGPAGAGGG	73	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=6129	25.805	2	1251.6208	1251.6208	M	R	2	19
PSM	DDDIAALVVDNGSGMC	74	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=8077	31.56	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	75	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=8143	31.788	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	76	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=8174	31.895	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	77	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8004	31.313	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	78	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8319	32.351	2	1708.692	1708.6920	M	K	2	18
PSM	MDLAAAAEPGAGSQHLEV	79	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6433	26.754	2	1823.836	1823.8360	-	R	1	19
PSM	MEATLEQHLEDTM	80	sp|O43504|LTOR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=6134	25.817	2	1620.6647	1620.6647	-	K	1	14
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	81	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=5933	25.12	3	3089.3751	3089.3751	M	R	2	40
PSM	SETAPAAPAAPAPAE	82	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=4761	20.65	2	1391.6569	1391.6569	M	K	2	17
PSM	AAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELS	83	sp|Q6VN20|RBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=6161	25.913157418666668	3	3075.3713	3075.3648	M	R	2	37
PSM	ADTTPNGPQGAGAVQFMMTN	84	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=5881	24.927	2	2080.883	2080.8830	M	K	2	22
PSM	AGGEAGVTLGQPHLS	85	sp|Q2VIR3-2|IF2GL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5913	25.046	2	1434.7103	1434.7103	M	R	2	17
PSM	DDDIAALVVDNGSGMC	86	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7973	31.218	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	87	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7763	30.541	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	88	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7866	30.881	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	89	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8201	31.991	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	90	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8574	33.363	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	91	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8037	31.422	2	1764.7546	1764.7546	M	K	2	18
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGG	92	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6562	27.157	3	2712.2337	2712.2337	-	R	1	31
PSM	MEDLVQDGVASPATPGTG	93	sp|Q8IWJ2-3|GCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6277	26.289	2	1801.804	1801.8040	-	K	1	19
PSM	MEVSPLQPVNENMQVN	94	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=7129	28.835	2	1885.855	1885.8550	-	K	1	17
PSM	MEVTGDAGVPESGEI	95	sp|O00273-2|DFFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6377	26.579	2	1547.6661	1547.6661	-	R	1	16
PSM	SETAPLAPTIPAPAE	96	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=6956	28.376	2	1505.7613	1505.7613	M	K	2	17
PSM	SSIGTGYDLSASTFSPDG	97	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7484	29.861	2	1802.7847	1802.7847	M	R	2	20
PSM	EEEIAALVIDNGSGMC	98	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=8014	31.341629608266665	2	1764.7543	1764.7541	M	K	2	18
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	99	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=6327	26.436439275199998	3	2664.1751	2664.1717	M	K	2	33
PSM	AAAAAAAAAAGAAGG	100	sp|Q86U42-2|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6802	27.931	2	1083.5309	1083.5309	M	R	2	17
PSM	AAAAAGAGSGPWAAQE	101	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6409	26.678	2	1426.6477	1426.6477	M	K	2	18
PSM	AAAADSFSGGPAGV	102	sp|Q96E14|RMI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6708	27.644	2	1218.5517	1218.5517	M	R	2	16
PSM	AAAEEGCSVGAEAD	103	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=5000	21.673	2	1377.5354	1377.5354	M	R	2	16
PSM	ADEAALALQPGGSPSAAGAD	104	sp|Q96EB6-2|SIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6816	27.967	2	1809.8381	1809.8381	M	R	2	22
PSM	AELVQGQSAPVGM	105	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7168	28.957	2	1327.6442	1327.6442	M	K	2	15
PSM	AESSESFTMASSPAQ	106	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6177	25.956	2	1570.6457	1570.6457	M	R	2	17
PSM	ASSAQSGGSSGGPAVPTVQ	107	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=5394	23.169	2	1685.7857	1685.7857	M	R	2	21
PSM	EEEIAALVIDNGSGMC	108	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7539	29.924	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	109	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8137	31.769	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	110	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7813	30.702	2	1764.7546	1764.7546	M	K	2	18
PSM	MDEQSQGMQGPPVPQFQPQ	111	sp|Q8TDX7-2|NEK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6381	26.593	2	2201.9358	2201.9358	-	K	1	20
PSM	MDSAGQDINLNSPN	112	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5581	23.848	2	1532.6413	1532.6413	-	K	1	15
PSM	MEESVNQMQPLNE	113	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=5978	25.28	2	1605.6651	1605.6651	-	K	1	14
PSM	MEVTGDAGVPESGEI	114	sp|O00273-2|DFFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7277	29.295	2	1531.6712	1531.6712	-	R	1	16
PSM	MGPGPPAAGAAPSP	115	sp|Q6NUT3-2|MFS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5268	22.684	2	1234.5652	1234.5652	-	R	1	15
PSM	SDAAVDTSSEITTKDL	116	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6257	26.219	2	1693.7894	1693.7894	M	K	2	18
PSM	SDEFSLADALPEHSPA	117	sp|Q8NDC0|MISSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7393	29.64	2	1726.7686	1726.7686	M	K	2	18
PSM	SETAPAAPAAAPPAE	118	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4633	20.072	2	1349.6463	1349.6463	M	K	2	17
PSM	SSEAETQQPPAAPPAAPALSAADT	119	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6144	25.857	2	2319.0866	2319.0866	M	K	2	26
PSM	EEEIAALVIDNGSGMC	120	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=8241	32.129538797066665	2	1765.7552	1764.7542	M	K	2	18
PSM	AAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGG	121	sp|P0C2W1|FBSP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=4765	20.66707574693333	3	2598.1148	2598.1108	M	R	2	38
PSM	MDFEDDYTHSAC	122	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=5776	24.549331070133334	2	1547.519009	1547.518075	-	R	1	13
PSM	AECGASGSGSSGDSLD	123	sp|Q9NVE7|PANK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=4816	20.888932837333336	2	1497.5546	1497.5520	M	K	2	18
PSM	AAQGVGPGPGSAAPPGLEAA	124	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6451	26.813	2	1715.8479	1715.8479	M	R	2	22
PSM	AASCVLLHTGQ	125	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=6121	25.772	2	1197.5812	1197.5812	M	K	2	13
PSM	AASEAAVVSSPSL	126	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6687	27.578	2	1229.6139	1229.6139	M	K	2	15
PSM	AELVQGQSAPVGM	127	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=6175	25.951	2	1343.6391	1343.6391	M	K	2	15
PSM	AELVQGQSAPVGM	128	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=7161	28.94	2	1327.6442	1327.6442	M	K	2	15
PSM	AESGESGGPPGSQDSAAGAEGAGAPAAAASAEP	129	sp|Q9UMX0-4|UBQL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5452	23.381	3	2823.2067	2823.2067	M	K	2	35
PSM	AQPGPASQPDVSLQQ	130	sp|Q15276-2|RABE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5725	24.339	2	1563.7529	1563.7529	M	R	2	17
PSM	ASGVAVSDGVIKVFNDM	131	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=7438	29.773	2	1765.8557	1765.8557	M	K	2	19
PSM	ATDTSQGELVHP	132	sp|Q5SSJ5-5|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5358	23.039	2	1295.5994	1295.5994	M	K	2	14
PSM	DDDIAALVVDNGSGMC	133	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7540	29.926	2	1692.6971	1692.6971	M	K	2	18
PSM	MEEMSGESVVSSAVPAAAT	134	sp|Q9H3F6-2|BACD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6137	25.831	2	1925.8234	1925.8234	-	R	1	20
PSM	MEEQPQMQDADEPADSGGEG	135	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=4556	19.716	2	2193.795	2193.7950	-	R	1	21
PSM	MEQSPPPAPEPTQGPTPA	136	sp|Q96AY4|TTC28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5249	22.61	2	1888.8513	1888.8513	-	R	1	19
PSM	MESPASSQPASMPQS	137	sp|P46734|MP2K3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=4271	18.379	2	1607.6443	1607.6443	-	K	1	16
PSM	MNPVYSPVQPGAPYGNP	138	sp|Q92567-3|F168A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6690	27.589	2	1844.8403	1844.8403	-	K	1	18
PSM	SAEVPEAASAEEQ	139	sp|P56211|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5295	22.797	2	1358.5838	1358.5838	M	K	2	15
PSM	SETAPAAPAAAPPAE	140	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5634	24.036	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	141	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5957	25.19	2	1391.6569	1391.6569	M	K	2	17
PSM	SGGGTETPVGCEAAPGGGS	142	sp|Q8TDH9-2|BL1S5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=4980	21.586	2	1688.6948	1688.6948	M	K	2	21
PSM	SYGRPPPDVEGMTSL	143	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=5834	24.762	2	1662.7559	1662.7559	M	K	2	17
PSM	SYTPGVGGDPAQLAQ	144	sp|O15400-2|STX7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6397	26.637	2	1501.7049	1501.7049	M	R	2	17
PSM	EEEIAALVIDNGSGMC	145	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=8131	31.74831212533333	2	1766.7552	1764.7542	M	K	2	18
PSM	MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVC	146	sp|P20936|RASA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,34-UNIMOD:4	ms_run[1]:scan=5997	25.359121541866667	3	3042.272146	3042.264117	-	R	1	35
PSM	AAAAAAGAGPEMV	147	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=5605	23.942	2	1143.523	1143.5230	M	R	2	15
PSM	AADISESSGADC	148	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5066	21.941	2	1223.4612	1223.4612	M	K	2	14
PSM	AAPPGEYFSVGSQVSC	149	sp|Q3MHD2|LSM12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7299	29.38	2	1696.7403	1696.7403	M	R	2	18
PSM	AEAEGVPTTPGPASGSTF	150	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6641	27.418	2	1716.7843	1716.7843	M	R	2	20
PSM	AGSYPEGAPAVLADK	151	sp|Q96IZ6|MET2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6030	25.46	2	1486.7304	1486.7304	M	R	2	17
PSM	ALPAGPAEAACALCQ	152	sp|Q5TA31|RN187_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7381	29.609	2	1540.7014	1540.7014	M	R	2	17
PSM	AQETNQTPGPMLCSTGCGFYGNP	153	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6778	27.853	2	2544.0356	2544.0356	M	R	2	25
PSM	MDELAGGGGGGPGMAAPP	154	sp|Q13033-2|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6237	26.139	2	1598.6705	1598.6705	-	R	1	19
PSM	MDFEDDYTHSAC	155	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=5784	24.576	2	1547.5181	1547.5181	-	R	1	13
PSM	MDGTEGSAGQPGPAE	156	sp|Q9BZ67-2|FRMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4429	19.114	2	1460.5726	1460.5726	-	R	1	16
PSM	MDSAGQDINLNSPN	157	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6307	26.386	2	1516.6464	1516.6464	-	K	1	15
PSM	MEDMNEYSNIEEFAEGS	158	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=7476	29.846	2	2067.7561	2067.7561	-	K	1	18
PSM	MEESVNQMQPLNE	159	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5240	22.574	2	1621.66	1621.6600	-	K	1	14
PSM	MEGGFGSDFGGSGSG	160	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6473	26.889	2	1405.5092	1405.5092	-	K	1	16
PSM	MENGAVYSPTTEEDPGPA	161	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5733	24.361	2	1921.7888	1921.7888	-	R	1	19
PSM	MEPAVGGPGPLIVNN	162	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6851	28.074	2	1521.7497	1521.7497	-	K	1	16
PSM	MLEAPGPSDGCELSNPSAS	163	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6171	25.941	2	1975.8139	1975.8139	-	R	1	20
PSM	SETAPAAPAAAPPAE	164	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5749	24.423	2	1391.6569	1391.6569	M	K	2	17
PSM	SIMSYNGGAVMAM	165	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=5648	24.078	2	1420.5673	1420.5673	M	K	2	15
PSM	SSAAEPPPPPPPESAPS	166	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5116	22.107	2	1655.7679	1655.7679	M	K	2	19
PSM	SETAPAAPAAAPPAE	167	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=7895	30.9643112656	2	1391.6581	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	168	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=8204	31.999797944799997	2	1391.6582	1391.6564	M	K	2	17
PSM	MDGIVPDIAVGTK	169	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6550	27.1203078976	2	1372.692148	1372.690818	-	R	1	14
PSM	AAPAGGGGSAVSVLAPNG	170	sp|Q9BZE9|ASPC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=6495	26.951884044266667	2	1493.7389	1493.7469	M	R	2	20
PSM	AAAAAQGGGGGEP	171	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=4598	19.916	2	1054.468	1054.4680	M	R	2	15
PSM	AAAAAQGGGGGEP	172	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=4686	20.314	2	1054.468	1054.4680	M	R	2	15
PSM	AAAAASASQDELNQLE	173	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6982	28.448	2	1629.7482	1629.7482	M	R	2	18
PSM	AAAAMAAAAGGGAGAA	174	sp|Q9NX46|ADPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6860	28.1	2	1200.5557	1200.5557	M	R	2	18
PSM	AAGGAEGGSGPGAAMGDCAEI	175	sp|Q09019|DMWD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,15-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=5721	24.329	2	1862.7411	1862.7411	M	K	2	23
PSM	AATTGSGVKVP	176	sp|Q13404-8|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5264	22.666	2	1028.5502	1028.5502	M	R	2	13
PSM	AELGEADEAELQ	177	sp|Q9Y5J9|TIM8B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6566	27.173	2	1315.578	1315.5780	M	R	2	14
PSM	ASSDIQVKELE	178	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5849	24.82	2	1259.6245	1259.6245	M	K	2	13
PSM	DDDIAALVVDNGSGMC	179	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7591	29.993	2	1708.692	1708.6920	M	K	2	18
PSM	GEAEVGGGGAAGD	180	sp|Q9NV56|MRGBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=4526	19.57	2	1087.4418	1087.4418	M	K	2	15
PSM	MEPAGPCGFCPAGEVQPA	181	sp|Q9UHR6|ZNHI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6586	27.235	2	1931.7852	1931.7852	-	R	1	19
PSM	MLAAGVGGQGE	182	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5538	23.709	2	1046.4703	1046.4703	-	R	1	12
PSM	MLQQVPENINFPAEEE	183	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7430	29.754	2	1944.8775	1944.8775	-	K	1	17
PSM	MNGDQNSDVYAQE	184	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4927	21.356	2	1527.5784	1527.5784	-	K	1	14
PSM	MQDAENVAVPEAAEE	185	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6571	27.189	2	1643.6985	1643.6985	-	R	1	16
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSN	186	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6012	25.404	3	2523.2241	2523.2241	M	R	2	30
PSM	SETAPAAPAAAPPAE	187	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5174	22.352	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	188	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5494	23.526	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	189	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5654	24.095	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	190	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=8320	32.35471238986666	2	1391.6579	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	191	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=8106	31.66303162053333	2	1391.6582	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	192	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=8005	31.315748431466666	2	1391.6582	1391.6564	M	K	2	17
PSM	DDDIAALVVDNGSGMC	193	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=8342	32.43653051653333	2	1692.6973	1692.6966	M	K	2	18
PSM	ADEEEEVKPILQ	194	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=6066	25.5892205112	2	1440.6996	1440.6979	M	K	3	15
PSM	ASGAGGVGGGGGG	195	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=3975	17.014504270666666	2	901.3882	901.3884	M	K	2	15
PSM	AAAAAMAEQESA	196	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5230	22.537	2	1177.4921	1177.4921	M	R	2	14
PSM	ALDGPEQMELEEGKAGSGL	197	sp|P62195|PRS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=6569	27.183	2	1987.9045	1987.9045	M	R	2	21
PSM	ATVEPETTPTPNPPTTEEE	198	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5480	23.477	2	2080.9324	2080.9324	M	K	2	21
PSM	AVAVGRPSNEEL	199	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5735	24.367	2	1282.6517	1282.6517	M	R	2	14
PSM	AVQESAAQLSMTL	200	sp|Q7L5Y9-5|MAEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=7489	29.868	2	1405.6759	1405.6759	M	K	2	15
PSM	MEAPGLAQAAAAESDS	201	sp|P51817|PRKX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6300	26.357	2	1575.6723	1575.6723	-	R	1	17
PSM	MEEISLANLDTN	202	sp|Q96GX2|A7L3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7418	29.722	2	1406.6235	1406.6235	-	K	1	13
PSM	MEPAVSEPMRDQVA	203	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=4960	21.497	2	1632.7124	1632.7124	-	R	1	15
PSM	METEQPEETFPNTETNGEFG	204	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6711	27.651	2	2343.9325	2343.9325	-	K	1	21
PSM	METGTAPLVAPPR	205	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5530	23.675	2	1396.7021	1396.7021	-	R	1	14
PSM	MQDAENVAVPEAAEE	206	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5782	24.57	2	1659.6934	1659.6934	-	R	1	16
PSM	SETAPAAPAAAPPAE	207	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=4676	20.266	2	1391.6569	1391.6569	M	K	2	17
PSM	SGDGATEQAAEYVPE	208	sp|Q12996-3|CSTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6047	25.531	2	1564.6529	1564.6529	M	K	2	17
PSM	SSNCTSTTAVAVAPLSAS	209	sp|P78356-2|PI42B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=6243	26.16	2	1764.82	1764.8200	M	K	2	20
PSM	SSVAVLTQESFAEH	210	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7058	28.66	2	1545.7311	1545.7311	M	R	2	16
PSM	ETAPAAPAAAPPAE	211	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5128	22.156967957333332	2	1262.6150	1262.6138	S	K	3	17
PSM	EEEIAALVIDNGSGMC	212	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=7681	30.262565763199998	2	1766.7542	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	213	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=7820	30.723369293066664	2	1766.7622	1764.7542	M	K	2	18
PSM	AAAVAVAAASR	214	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=6023	25.4290168848	2	998.5563	998.5504	M	R	2	13
PSM	MNPVYSPGSSGVPYANA	215	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6505	26.972685672266667	2	1767.780009	1767.777401	-	K	1	18
PSM	SGGGPSGGGPGGSG	216	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=3622	15.492362368266667	2	1028.4161	1028.4154	M	R	2	16
PSM	AAAMDVDTPSGTNSGAG	217	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5684	24.204	2	1562.6519	1562.6519	M	K	2	19
PSM	AAGGAVAAAPEC	218	sp|Q9UL63|MKLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5033	21.813	2	1085.4812	1085.4812	M	R	2	14
PSM	AAPCEGQAFAVGVE	219	sp|Q86WB0-3|NIPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=7024	28.58	2	1446.6449	1446.6449	M	K	2	16
PSM	AEGGAADLDTQ	220	sp|Q9Y4E8-4|UBP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5163	22.312	2	1088.4622	1088.4622	M	R	2	13
PSM	AEPASVAAESLAGS	221	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6858	28.097	2	1300.6147	1300.6147	M	R	2	16
PSM	AGLELLSDQGY	222	sp|Q9NPD3|EXOS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7573	29.959	2	1206.5768	1206.5768	M	R	2	13
PSM	AGPGSTGGQIGAAALAGGA	223	sp|Q8N653|LZTR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6673	27.535	2	1524.7532	1524.7532	M	R	2	21
PSM	ASSLNEDPEGS	224	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5121	22.123	2	1146.4677	1146.4677	M	R	2	13
PSM	ATVEPETTPTPNPPTTEEE	225	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5592	23.895	2	2080.9324	2080.9324	M	K	2	21
PSM	MDPNCSCAAGVSCTCAGSC	226	sp|P04733|MT1F_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=4918	21.315	2	2121.6989	2121.6989	-	K	1	20
PSM	MEDGGLTAFEEDQ	227	sp|Q96RG2-4|PASK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7056	28.656	2	1498.577	1498.5770	-	R	1	14
PSM	MEESVNQMQPLNE	228	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6881	28.158	2	1589.6702	1589.6702	-	K	1	14
PSM	MEGGFGSDFGGSGSG	229	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7386	29.623	2	1389.5143	1389.5143	-	K	1	16
PSM	MEGLTLSDAEQ	230	sp|Q96D71-2|REPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6285	26.313	2	1250.5336	1250.5336	-	K	1	12
PSM	MEPAVSEPMRDQVA	231	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5468	23.432	2	1616.7174	1616.7174	-	R	1	15
PSM	MESPASSQPASMPQS	232	sp|P46734|MP2K3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5003	21.681	2	1591.6494	1591.6494	-	K	1	16
PSM	MESQEPTESSQNG	233	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=4740	20.554	2	1464.5675	1464.5675	-	K	1	14
PSM	METGTAPLVAPP	234	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6477	26.899	2	1240.6009	1240.6009	-	R	1	13
PSM	MLAAGVGGQGE	235	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5561	23.776	1	1046.4703	1046.4703	-	R	1	12
PSM	MLEAPGPSDGCELSNPSAS	236	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=7050	28.637	2	1959.819	1959.8190	-	R	1	20
PSM	MNNTAASPMSTATSSSG	237	sp|O75486|SUPT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3987	17.07	2	1687.6665	1687.6665	-	R	1	18
PSM	MQPPPQTVPSGMAGPPPAGNP	238	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5365	23.069	2	2100.9609	2100.9609	-	R	1	22
PSM	MQPPPQTVPSGMAGPPPAGNP	239	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6028	25.45	2	2084.9659	2084.9659	-	R	1	22
PSM	SDNGELEDKPPAPPV	240	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5643	24.067	2	1605.7522	1605.7522	M	R	2	17
PSM	SEGNAAGEPSTPGGP	241	sp|P05423|RPC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=4813	20.88	2	1368.5794	1368.5794	M	R	2	17
PSM	SGEPGQTSVAPPPEEVEPGSGV	242	sp|Q9BRT3|MIEN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6071	25.602	2	2147.9859	2147.9859	M	R	2	24
PSM	SIMSYNGGAVMAM	243	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6561	27.155	2	1404.5724	1404.5724	M	K	2	15
PSM	SMPDAMPLPGVGEEL	244	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,2-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7392	29.636	2	1615.711	1615.7110	M	K	2	17
PSM	SSAAEPPPPPPPESAPS	245	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5221	22.507	2	1655.7679	1655.7679	M	K	2	19
PSM	SSEAETQQPPAAPPAAPALSAADT	246	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6265	26.249	2	2319.0866	2319.0866	M	K	2	26
PSM	MDPNCSCAAGDSCTCAGSC	247	sp|P02795|MT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=4495	19.4257173864	3	2139.662077	2137.657382	-	K	1	20
PSM	MEESVNQMQPLNE	248	sp|P10155|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=5229	22.534267439466664	2	1623.665977	1621.659989	-	K	1	14
PSM	MDPNCSCEAGGSCACAGSC	249	sp|P80294|MT1H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=4901	21.240819805333334	2	2149.6982	2149.6572	-	K	1	20
PSM	AAAAAAGAGPEMV	250	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6494	26.95	2	1127.5281	1127.5281	M	R	2	15
PSM	AAAAAVGNAVPCGA	251	sp|Q9HD20|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6133	25.815	2	1240.587	1240.5870	M	R	2	16
PSM	AAAMVPGRSESWE	252	sp|O43598-2|DNPH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6331	26.45	2	1431.6453	1431.6453	M	R	2	15
PSM	AAEEEEVDSADTGE	253	sp|Q8WTS1|ABHD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5329	22.923	2	1492.5689	1492.5689	M	R	2	16
PSM	AAQVAPAAASSLGNPPPPPPSEL	254	sp|O14497-2|ARI1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7174	28.978	3	2180.1113	2180.1113	M	K	2	25
PSM	AEGGGPEPGEQE	255	sp|Q14CS0|UBX2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=4525	19.566	2	1197.4786	1197.4786	M	R	2	14
PSM	AEMDPVAEFPQPPGAA	256	sp|Q9HAB8|PPCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=7207	29.088	2	1683.745	1683.7450	M	R	2	18
PSM	AGAATQASLESAP	257	sp|Q9BXR0-2|TGT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5824	24.732	2	1214.5779	1214.5779	M	R	2	15
PSM	AGPGPGAVLESP	258	sp|Q5T447|HECD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6610	27.322	2	1092.5451	1092.5451	M	R	2	14
PSM	ASSEQAEQPSQPSSTPGSENVLP	259	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6180	25.962	3	2368.0666	2368.0666	M	R	2	25
PSM	ATAEVLNIGK	260	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6321	26.421	2	1056.5815	1056.5815	M	K	2	12
PSM	MCPEEGGAAGLGEL	261	sp|Q9BXF3-2|CECR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:4	ms_run[2]:scan=7117	28.809	2	1447.5959	1447.5959	-	R	1	15
PSM	MDEAGSSASGGGF	262	sp|Q8IUH3-2|RBM45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5463	23.417	2	1229.4506	1229.4506	-	R	1	14
PSM	MDELAGGGGGGPGMAAPP	263	sp|Q13033-2|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=5768	24.51	2	1614.6654	1614.6654	-	R	1	19
PSM	MEDSEALGFEHMGLDP	264	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6645	27.435	2	1850.7339	1850.7339	-	R	1	17
PSM	MEESVNQMQPLNE	265	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6087	25.649	2	1605.6651	1605.6651	-	K	1	14
PSM	MENGAVYSPTTEEDPGPA	266	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6408	26.675	2	1905.7938	1905.7938	-	R	1	19
PSM	MEPGPDGPAASGPAAI	267	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6124	25.783	2	1494.6661	1494.6661	-	R	1	17
PSM	MEQPGAAASGAGGGSEEPGGG	268	sp|O60879-2|DIAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5255	22.629	2	1814.7377	1814.7377	-	R	1	22
PSM	MESAIAEGGAS	269	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4938	21.405	2	1079.4441	1079.4441	-	R	1	12
PSM	METEQPEETFPNTETNGEFG	270	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7258	29.231	2	2327.9376	2327.9376	-	K	1	21
PSM	MNAGSDPVVIVSAA	271	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6861	28.104	2	1387.6653	1387.6653	-	R	1	15
PSM	MNPVYSPGSSGVPYANA	272	sp|A1KXE4-2|F168B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7189	29.026	2	1751.7825	1751.7825	-	K	1	18
PSM	MQPPPPGPLGDCL	273	sp|Q9BXJ8-2|TACAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7337	29.486	2	1435.6476	1435.6476	-	R	1	14
PSM	SADAAAGAPLP	274	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6078	25.624	2	981.47673	981.4767	M	R	2	13
PSM	SANEDQEMELEAL	275	sp|Q6NW29|RWDD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=7060	28.663	2	1535.6297	1535.6297	M	R	2	15
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	276	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5535	23.701	3	2664.1861	2664.1861	M	R	2	29
PSM	SATVVDAVNAAPLSGS	277	sp|O95391|SLU7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7124	28.823	2	1499.7468	1499.7468	M	K	2	18
PSM	SDQQLDCALDLM	278	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=7440	29.777	2	1465.6065	1465.6065	M	R	2	14
PSM	SETAPLAPTIPAPAE	279	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7130	28.838	2	1505.7613	1505.7613	M	K	2	17
PSM	SGNGNAAATAEENSP	280	sp|P08397-3|HEM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=4654	20.166	2	1430.591	1430.5910	M	K	2	17
PSM	SGPDVETPSAIQIC	281	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=6838	28.032	2	1514.6923	1514.6923	M	R	2	16
PSM	SVNYAAGLSPYAD	282	sp|Q8N6T7-2|SIR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7255	29.225	2	1368.6198	1368.6198	M	K	2	15
PSM	TTEVGSVSEV	283	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5985	25.307	1	1048.4924	1048.4924	M	K	2	12
PSM	DDDIAALVVDNGSGMC	284	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=7733	30.4480958296	2	1710.7052	1708.6912	M	K	2	18
PSM	AAPAGGGGSAVSVLAPNG	285	sp|Q9BZE9|ASPC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=6516	27.010514913599998	2	1493.7389	1493.7469	M	R	2	20
PSM	AADSDDGAVSAPAASDGGVS	286	sp|Q96GM8|TOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=5194	22.420849474133334	2	1762.7412	1760.7332	M	K	2	22
PSM	ATAAETSASEPEAES	287	sp|Q15020|SART3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=4804	20.845305800266665	2	1491.6238	1491.6208	M	K	2	17
PSM	MDPNCSCTTGGSCACAGSC	288	sp|P07438|MT1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=4315	18.593916617066668	2	2153.6572	2151.6722	-	K	1	20
PSM	AAAAPVAADDDE	289	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5025	21.776	2	1156.4884	1156.4884	M	R	2	14
PSM	AAAVAMETDDAGN	290	sp|Q9Y3C7|MED31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5385	23.142	2	1292.5191	1292.5191	M	R	2	15
PSM	AAESGSDFQQ	291	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5013	21.723	2	1080.436	1080.4360	M	R	2	12
PSM	AALGEPVRLE	292	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6440	26.777	2	1095.5924	1095.5924	M	R	2	12
PSM	AATASAGAGGIDG	293	sp|Q02978-2|M2OM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5055	21.897	2	1059.4833	1059.4833	M	K	2	15
PSM	AATASAGVPATVSE	294	sp|O60518|RNBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5552	23.751	2	1272.6198	1272.6198	M	K	2	16
PSM	AAVQAAEVKVDGSEP	295	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5947	25.158	2	1511.7468	1511.7468	M	K	2	17
PSM	ADSELQLVEQ	296	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7077	28.716	2	1172.5561	1172.5561	M	R	2	12
PSM	ADSSGQQAPDY	297	sp|P49589-3|SYCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5045	21.852	2	1179.468	1179.4680	M	R	2	13
PSM	AEAEESPGDPGTASP	298	sp|Q96EC8-2|YIPF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=4979	21.585	2	1455.6001	1455.6001	M	R	2	17
PSM	AEEQEFTQLC	299	sp|Q53GT1|KLH22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=6896	28.198	2	1295.534	1295.5340	M	K	2	12
PSM	AEGTAEAPLENGGGGDSGAGALE	300	sp|Q96G46-3|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6268	26.259	2	2070.8978	2070.8978	M	R	2	25
PSM	AEPSQAPTPAPAAQP	301	sp|Q92830|KAT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5138	22.2	2	1473.71	1473.7100	M	R	2	17
PSM	AGITTIEAVK	302	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6132	25.812	2	1043.5863	1043.5863	M	R	2	12
PSM	ANALASATCE	303	sp|P48059|LIMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=5949	25.163	2	1048.4495	1048.4495	M	R	2	12
PSM	ASDCEPALNQAEG	304	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=5350	23.005	2	1402.5671	1402.5671	M	R	2	15
PSM	ASELEPEVQAID	305	sp|Q8IWV8-2|UBR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7238	29.185	2	1341.63	1341.6300	M	R	2	14
PSM	ASGVQVADEVC	306	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=5915	25.05	2	1175.5129	1175.5129	M	R	2	13
PSM	AVTLDKDAYY	307	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6362	26.538	2	1199.571	1199.5710	M	R	2	12
PSM	MDCEVNNGSSL	308	sp|P55957-3|BID_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=5342	22.971	2	1282.4806	1282.4806	-	R	1	12
PSM	MDDREDLVYQA	309	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6241	26.154	2	1395.5976	1395.5976	-	K	1	12
PSM	MDETSPLVSPE	310	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6017	25.414	2	1261.5384	1261.5384	-	R	1	12
PSM	MEAPEGGGGGPAA	311	sp|Q8N1B3-2|CCNQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4507	19.482	2	1157.4659	1157.4659	-	R	1	14
PSM	MEDSMDMDMSPL	312	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5496	23.535	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	313	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6035	25.48	2	1490.4921	1490.4921	-	R	1	13
PSM	MEEEAETEEQQ	314	sp|Q8N2Z9-3|CENPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4414	19.047	2	1409.514	1409.5140	-	R	1	12
PSM	MEEVVIAGMSG	315	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5955	25.186	2	1195.5101	1195.5101	-	K	1	12
PSM	MEEVVIAGMSG	316	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7433	29.759	2	1179.5152	1179.5152	-	K	1	12
PSM	MEGVAVVTAGSVGAA	317	sp|Q9BYE7-3|PCGF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6529	27.056	2	1375.6653	1375.6653	-	K	1	16
PSM	MEQEPQNGEPAEI	318	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5658	24.108	2	1528.6352	1528.6352	-	K	1	14
PSM	MESGSTAASEEA	319	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4184	17.967	2	1226.4609	1226.4609	-	R	1	13
PSM	MEVSPLQPVNENMQVN	320	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6818	27.972	2	1885.855	1885.8550	-	K	1	17
PSM	MNGSNMANTSPSV	321	sp|Q9ULR5|PAI2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4701	20.383	2	1382.5442	1382.5442	-	K	1	14
PSM	MNNTAASPMSTATSSSG	322	sp|O75486|SUPT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=4065	17.409	2	1687.6665	1687.6665	-	R	1	18
PSM	MQGGEPVSTM	323	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4313	18.583	2	1109.4369	1109.4369	-	K	1	11
PSM	PVAVGPYGQSQPSCFD	324	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=5953	25.18	2	1707.7563	1707.7563	M	R	2	18
PSM	SDAAVDTSSEITT	325	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5540	23.716	2	1337.5834	1337.5834	M	K	2	15
PSM	SGEDEQQEQTIAEDLVVT	326	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6899	28.209	2	2031.912	2031.9120	M	K	2	20
PSM	SGELPPNINIKEP	327	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6313	26.4	2	1448.7511	1448.7511	M	R	2	15
PSM	SGEPGQTSVAPPPEEVEPGSGV	328	sp|Q9BRT3|MIEN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6192	25.995	2	2147.9859	2147.9859	M	R	2	24
PSM	SIMSYNGGAVMAM	329	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=7482	29.858	2	1388.5774	1388.5774	M	K	2	15
PSM	SNIYIQEPPTNG	330	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6287	26.317	2	1373.6463	1373.6463	M	K	2	14
PSM	SETAPAAPAAAPPAE	331	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=8410	32.69342455066667	2	1391.6579	1391.6564	M	K	2	17
PSM	AELVQGQSAPVGM	332	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=7151	28.909541457600003	2	1327.6447	1327.6437	M	K	2	15
PSM	PVAVGPYGQSQPSCFD	333	sp|P60602|ROMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	14-UNIMOD:4	ms_run[1]:scan=5909	25.0345778528	2	1707.7594	1707.7557	M	R	2	18
PSM	AGVGDAAAPGEGGGGGVDGPQ	334	sp|Q6NXT6|TAPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=5332	22.933112685333334	2	1736.7642	1736.7596	M	R	2	23
PSM	AEPQPPSGGLTDEAALSCCSDAD	335	sp|Q04760|LGUL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=6458	26.835380369333333	2	2388.9710	2388.9681	M	P	2	25
PSM	AAAAAETPEVL	336	sp|Q9NXW9-2|ALKB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6923	28.281	2	1083.5448	1083.5448	M	R	2	13
PSM	AAAAAGTATSQ	337	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=4404	19.001	2	960.45124	960.4512	M	R	2	13
PSM	AAAAGGGSCPGPGSA	338	sp|Q9UMN6-2|KMT2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=4623	20.024	2	1228.5142	1228.5143	M	R	2	17
PSM	AAAVAMETDDAGN	339	sp|Q9Y3C7|MED31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6155	25.893	2	1276.5241	1276.5241	M	R	2	15
PSM	AADGQCSLPASW	340	sp|Q86YN1-2|DOPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=7385	29.621	2	1303.5503	1303.5503	M	R	2	14
PSM	AATAAEAVASGSGEP	341	sp|Q9NWT6|HIF1N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6296	26.344	2	1329.6048	1329.6048	M	R	2	17
PSM	AAVVEVEVGGGAAGE	342	sp|Q9H920|RN121_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7339	29.491	2	1355.6569	1355.6569	M	R	2	17
PSM	ADEELEALR	343	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6341	26.487	2	1086.5193	1086.5193	M	R	2	11
PSM	ADLEEQLSDEE	344	sp|P47755-2|CAZA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7179	28.991	2	1318.5412	1318.5412	M	K	2	13
PSM	AQALSEEEFQ	345	sp|Q4V328-2|GRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6836	28.027	2	1192.5248	1192.5248	M	R	2	12
PSM	ASASTQPAALSAEQA	346	sp|Q99622|C10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5504	23.571	2	1443.6842	1443.6842	M	K	2	17
PSM	DDDIAALVVDNGSGMC	347	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=8382	32.587	2	1692.6971	1692.6971	M	K	2	18
PSM	MDGGDDGNLIIK	348	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5753	24.442	2	1304.5918	1304.5918	-	K	1	13
PSM	MEADASVDMFS	349	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6079	25.627	2	1275.4635	1275.4635	-	K	1	12
PSM	MEGCVSNLMVCNLAYSG	350	sp|O75832-2|PSD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=7148	28.896	2	1977.7941	1977.7941	-	K	1	18
PSM	MEPVGCCGEC	351	sp|Q8NEZ5-2|FBX22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5694	24.239	2	1239.4028	1239.4029	-	R	1	11
PSM	MESAIAEGGAS	352	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6164	25.921	2	1063.4492	1063.4492	-	R	1	12
PSM	MEVAANCSL	353	sp|Q96RS6|NUDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=5792	24.606	2	1051.4314	1051.4314	-	R	1	10
PSM	MNGEADCPTDLEMAAP	354	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=6010	25.4	2	1794.6747	1794.6747	-	K	1	17
PSM	MNGPADGEVDY	355	sp|Q8NBZ0-2|IN80E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5686	24.21	2	1224.4605	1224.4605	-	K	1	12
PSM	SAQGDCEFLVQ	356	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6965	28.408	2	1294.55	1294.5500	M	R	2	13
PSM	SDEASAITSYE	357	sp|Q6PEV8-2|F199X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6333	26.457	2	1213.4986	1213.4986	M	K	2	13
PSM	SGALDVLQM	358	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7289	29.337	2	990.4692	990.4692	M	K	2	11
PSM	SIMSYNGGAVMAM	359	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=5705	24.273	2	1420.5673	1420.5673	M	K	2	15
PSM	SQDGASQFQEVI	360	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7279	29.302	2	1349.6099	1349.6099	M	R	2	14
PSM	SQGPPTGESSEPEA	361	sp|Q9UPR3|SMG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=4748	20.594	2	1413.5896	1413.5896	M	K	2	16
PSM	SSPQAPEDGQGCGD	362	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=4311	18.572	2	1445.5365	1445.5365	M	R	2	16
PSM	TQQGAALQNYNNELV	363	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6903	28.22	2	1703.8115	1703.8115	M	K	2	17
PSM	EEEIAALVIDNGSGMC	364	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=7569	29.9530782448	2	1765.7552	1764.7542	M	K	2	18
PSM	DDDIAALVVDNGSGMC	365	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=7948	31.132232929599997	2	1694.6912	1692.6962	M	K	2	18
PSM	AAAAGGPCV	366	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=5296	22.799	2	814.36434	814.3643	M	R	2	11
PSM	AAAMDVDTPSGTNSGAG	367	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=4818	20.893	2	1578.6468	1578.6468	M	K	2	19
PSM	AAASSSDSDACGAESNEANS	368	sp|Q8NFJ9-3|BBS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=4212	18.102	2	1941.713	1941.7130	M	K	2	22
PSM	AAATGDPGLS	369	sp|O95352-3|ATG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5189	22.398	2	900.41888	900.4189	M	K	2	12
PSM	AANSSGQGFQN	370	sp|Q9NRY2-2|SOSSC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4644	20.123	2	1121.4738	1121.4738	M	K	2	13
PSM	AAQGEPQVQF	371	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6727	27.693	2	1115.5247	1115.5247	M	K	2	12
PSM	AASQAVEEM	372	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=4653	20.163	2	992.41208	992.4121	M	R	2	11
PSM	AEAALLLLPEAAAE	373	sp|Q96JB2-2|COG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7634	30.096	2	1422.7606	1422.7606	M	R	2	16
PSM	AELQEVQITEE	374	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7025	28.581	2	1329.63	1329.6300	M	K	2	13
PSM	AENVVEPGPPSA	375	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5783	24.573	2	1207.5721	1207.5721	M	K	2	14
PSM	AGMVDFQDEEQV	376	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6607	27.312	2	1424.5766	1424.5766	M	K	2	14
PSM	AGSSEEAPDYG	377	sp|Q9NRG1-3|PRDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5001	21.676	2	1123.4306	1123.4306	M	R	2	13
PSM	ANQVNGNAVQL	378	sp|O43390-3|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6274	26.281	2	1168.5836	1168.5837	M	K	2	13
PSM	ASAGGEDCESPAPEAD	379	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=4733	20.522	2	1603.5944	1603.5944	M	R	2	18
PSM	ASSASSSPAGTEDSAPAQGGFGSDYS	380	sp|Q12955-5|ANK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5908	25.029	2	2431.9888	2431.9888	M	R	2	28
PSM	ASTNAESQLQ	381	sp|Q9BQS8-3|FYCO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4936	21.4	2	1089.4938	1089.4938	M	R	2	12
PSM	ATSGANGPGSATASASNP	382	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4609	19.959	2	1558.6859	1558.6859	M	R	2	20
PSM	MDDREDLVYQA	383	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5691	24.232	2	1411.5926	1411.5926	-	K	1	12
PSM	MDGIVPDIAVGTK	384	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7424	29.738	2	1356.6959	1356.6959	-	R	1	14
PSM	MDQEPVGGVE	385	sp|Q8N128|F177A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5124	22.136	2	1117.4598	1117.4598	-	R	1	11
PSM	MDSTLTASEI	386	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6454	26.821	2	1124.4907	1124.4907	-	R	1	11
PSM	MDVTSSSGGGGDP	387	sp|Q8IY22|CMIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4393	18.951	2	1223.4612	1223.4612	-	R	1	14
PSM	MEAAAEPGNLAGV	388	sp|Q9Y5Y2|NUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7288	29.333	2	1270.5864	1270.5864	-	R	1	14
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	389	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6406	26.669	3	2482.1017	2482.1017	-	R	1	28
PSM	MEDSMDMDMSPL	390	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6450	26.81	2	1490.4921	1490.4921	-	R	1	13
PSM	MEDSMDMDMSPL	391	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6968	28.415	2	1474.4972	1474.4972	-	R	1	13
PSM	MEEDDSYVPSDLTAEE	392	sp|Q15438-2|CYH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6766	27.802	2	1886.7251	1886.7252	-	R	1	17
PSM	MEETQPPPQP	393	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4828	20.94	2	1210.5176	1210.5176	-	K	1	11
PSM	MENGYTYEDY	394	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6263	26.245	2	1341.4707	1341.4707	-	K	1	11
PSM	MEPAAGSSMEPSADWLATAAA	395	sp|P42771-3|CDN2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7500	29.884	2	2136.898	2136.8980	-	R	1	22
PSM	MEPAEQPSELVSAEG	396	sp|P47224|MSS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6879	28.154	2	1614.7083	1614.7083	-	R	1	16
PSM	MESMFSSPAEAALQ	397	sp|Q9BQC3-2|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6738	27.734	2	1571.6484	1571.6484	-	R	1	15
PSM	MESQEPTESSQNG	398	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3874	16.544	2	1480.5624	1480.5624	-	K	1	14
PSM	MGEAEVGGGGAAGD	399	sp|Q9NV56|MRGBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4593	19.893	2	1234.4772	1234.4772	-	K	1	15
PSM	MGPAPAGEQL	400	sp|Q9H6R4-3|NOL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5727	24.342	2	1027.4644	1027.4644	-	R	1	11
PSM	MGPPGPALPATMNNSSSET	401	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5710	24.292	2	1931.8241	1931.8241	-	R	1	20
PSM	MLGNSAPGPAT	402	sp|P20248|CCNA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5186	22.392	2	1072.4859	1072.4859	-	R	1	12
PSM	MMNSSMSSGSGSL	403	sp|Q92796-3|DLG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4711	20.425	2	1364.4894	1364.4894	-	R	1	14
PSM	MNGDQNSDVYAQE	404	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5550	23.748	2	1511.5835	1511.5835	-	K	1	14
PSM	MNGEADCPTDLEMAAP	405	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=6730	27.705	2	1778.6797	1778.6797	-	K	1	17
PSM	MNNTAASPMSTATSSSG	406	sp|O75486|SUPT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4986	21.617	2	1671.6716	1671.6716	-	R	1	18
PSM	MNQPGGAAAPQADGASAAG	407	sp|Q5T7W0-3|ZN618_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4613	19.976	2	1698.7268	1698.7268	-	R	1	20
PSM	MVEQGDAAPLL	408	sp|A4D1U4|DEN11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7391	29.634	2	1200.5696	1200.5696	-	R	1	12
PSM	SDSGEQNYGE	409	sp|P62995|TRA2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4449	19.206	2	1126.4051	1126.4051	M	R	2	12
PSM	SETAPLAPTIPAPAE	410	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7868	30.887	2	1505.7613	1505.7613	M	K	2	17
PSM	SQAVQTNGTQPLS	411	sp|Q99496-2|RING2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5175	22.354	2	1371.663	1371.6630	M	K	2	15
PSM	SETAPAAPAAAPPAE	412	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7790	30.629546776266668	2	1391.6581	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	413	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=6326	26.433403829066666	2	1391.6618	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	414	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=5387	23.147307063466666	2	1391.6570	1391.6564	M	K	2	17
PSM	AASQAVEEM	415	sp|O15160|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=4646	20.131066800533333	2	992.4116	992.4116	M	R	2	11
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	416	sp|Q96J01|THOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,7-UNIMOD:35,20-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=7394	29.643803484266666	3	2945.3021	2945.2989	M	R	2	33
PSM	MESMFSSPAEAALQ	417	sp|Q9BQC3|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=6709	27.646152235733332	2	1571.650485	1571.648361	-	R	1	15
PSM	AAAAVVEFQ	418	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7397	29.65	2	946.476	946.4760	M	R	2	11
PSM	AAPCAEDPSLE	419	sp|Q8NBT0-2|POC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=5747	24.418	2	1200.4969	1200.4969	M	R	2	13
PSM	AEAALLLLPEAAAE	420	sp|Q96JB2-2|COG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7631	30.086	2	1422.7606	1422.7606	M	R	2	16
PSM	AGNAEPPPAGAACPQD	421	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=4925	21.346	2	1563.6624	1563.6624	M	R	2	18
PSM	AGSVADSDAVV	422	sp|Q3ZCW2|LEGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6011	25.402	2	1031.4771	1031.4771	M	K	2	13
PSM	ALDPADQHL	423	sp|Q7Z7K0|COXM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6052	25.545	1	1020.4876	1020.4876	M	R	2	11
PSM	AQVAMSTLPVEDEESSES	424	sp|P78347-5|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7177	28.987	2	1949.8412	1949.8412	M	R	2	20
PSM	ASAVLSSVPTTAS	425	sp|Q5VSY0-2|GKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6898	28.206	2	1231.6296	1231.6296	M	R	2	15
PSM	ASGVAVSDGVI	426	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6737	27.733	2	1015.5186	1015.5186	M	K	2	13
PSM	ASYFDEHDCEPSDPEQET	427	sp|Q9P0P0|RN181_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=6105	25.718	2	2196.8066	2196.8066	M	R	2	20
PSM	ATDELATKLS	428	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5916	25.051	2	1089.5554	1089.5554	M	R	2	12
PSM	GDMANNSVAYSGV	429	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=5740	24.389	2	1341.5507	1341.5507	M	K	2	15
PSM	MDNLSSEEIQQ	430	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6429	26.745	2	1334.566	1334.5660	-	R	1	12
PSM	MEDPNPEENM	431	sp|Q9H609|ZN576_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4391	18.941	2	1278.438	1278.4380	-	K	1	11
PSM	MEDVNSNVNADQEV	432	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5383	23.138	2	1620.6573	1620.6573	-	R	1	15
PSM	MEEASEGGGND	433	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3579	15.315	2	1152.3877	1152.3877	-	R	1	12
PSM	MEEVVIAGMSG	434	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6060	25.57	2	1195.5101	1195.5101	-	K	1	12
PSM	MEEVVIAGMSG	435	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7586	29.981	2	1163.5202	1163.5202	-	K	1	12
PSM	MEGPLSVFGD	436	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7563	29.948	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	437	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7644	30.133	2	1092.4798	1092.4798	-	R	1	11
PSM	MEPAMEPETLEA	438	sp|Q9UJY5-5|GGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=5826	24.737	2	1420.5738	1420.5738	-	R	1	13
PSM	MEPAPGLVEQP	439	sp|Q96EY9|ADAT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6187	25.98	2	1224.5696	1224.5696	-	K	1	12
PSM	MEPAVSEPMRDQVA	440	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6037	25.49	2	1600.7225	1600.7225	-	R	1	15
PSM	MEQPGQDPTSDDVMDSFLE	441	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=7215	29.113	2	2213.8617	2213.8617	-	K	1	20
PSM	MESNFNQEGVP	442	sp|Q96Q89-4|KI20B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6018	25.416	2	1308.5292	1308.5292	-	R	1	12
PSM	MESQEPTESSQNG	443	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3954	16.913	2	1480.5624	1480.5624	-	K	1	14
PSM	METESGNQE	444	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3515	15.018	2	1081.387	1081.3870	-	K	1	10
PSM	MLAAGVGGQGE	445	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6792	27.891	2	1030.4753	1030.4753	-	R	1	12
PSM	MLEELECGAPGA	446	sp|Q13111-2|CAF1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=7035	28.601	2	1333.553	1333.5530	-	R	1	13
PSM	MLGITSCSDQQA	447	sp|Q6E0U4-8|DMKN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=5920	25.067	2	1367.5697	1367.5697	-	K	1	13
PSM	PFLELDTNLPAN	448	sp|P30046-2|DOPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7276	29.293	2	1342.6769	1342.6769	M	R	2	14
PSM	PYQYPALTPEQ	449	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5891	24.961	2	1305.6241	1305.6241	M	K	2	13
PSM	SAADEVDGLGVA	450	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6677	27.544	2	1144.5248	1144.5248	M	R	2	14
PSM	SAADEVDGLGVA	451	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6824	27.985	2	1144.5248	1144.5248	M	R	2	14
PSM	SDLQAAEGPGSWSPTA	452	sp|Q6PL24|TMED8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7011	28.54	2	1614.7162	1614.7162	M	R	2	18
PSM	SGALDVLQM	453	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7425	29.74	2	990.4692	990.4692	M	K	2	11
PSM	SGLSFSEMEGC	454	sp|Q5JPI3-2|CC038_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6430	26.747	2	1260.4639	1260.4639	M	R	2	13
PSM	SQPPLLPASAET	455	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6632	27.393	2	1251.6347	1251.6347	M	R	2	14
PSM	STDTGVSLPSYEEDQGS	456	sp|Q9Y241|HIG1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6308	26.388	2	1812.7537	1812.7537	M	K	2	19
PSM	SYIPGQPVTAVVQ	457	sp|O14907|TX1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7198	29.055	2	1399.7347	1399.7347	M	R	2	15
PSM	SYNYVVTAQ	458	sp|Q16531-2|DDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6288	26.319	2	1085.5029	1085.5029	M	K	2	11
PSM	TTEVGSVSEV	459	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5988	25.319	2	1048.4924	1048.4924	M	K	2	12
PSM	AAAAAAAAAGAAGG	460	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=6375	26.57463625573333	2	1012.4931	1012.4932	A	R	3	17
PSM	DDDIAALVVDNGSGMC	461	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=7805	30.6737838632	2	1694.6932	1692.6962	M	K	2	18
PSM	AAAAAAGPSPGSGPGDSPEGPEGEAPE	462	sp|Q9UID3|VPS51_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=5553	23.754159294399997	3	2374.0237	2374.0192	M	R	2	29
PSM	MDSNTAPLGPSCPQPPPAPQPQA	463	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=5917	25.0534901848	3	2415.087209	2415.083497	-	R	1	24
PSM	AAAGGGGGGAAAAG	464	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=3808	16.254	2	956.43117	956.4312	M	R	2	16
PSM	AAAVVVAEGDSDS	465	sp|Q9UJX6-2|ANC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6443	26.786	2	1231.5568	1231.5568	M	R	2	15
PSM	AAGVDCGDGVGA	466	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=5220	22.504	2	1089.4397	1089.4397	M	R	2	14
PSM	AAIYGGVEGGGT	467	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6439	26.774	2	1092.5088	1092.5088	M	R	2	14
PSM	AALAEEQTEVAV	468	sp|Q15542-2|TAF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7160	28.938	2	1271.6245	1271.6245	M	K	2	14
PSM	AAPGAPAEYGYI	469	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7449	29.797	2	1220.5714	1220.5714	M	R	2	14
PSM	AAPVDLELK	470	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6363	26.54	2	996.54916	996.5492	M	K	2	11
PSM	AAPVVAPPGVVVS	471	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7090	28.746	2	1203.6863	1203.6863	M	R	2	15
PSM	AAQGEPQVQF	472	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6846	28.064	2	1115.5247	1115.5247	M	K	2	12
PSM	AAVDLEKL	473	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6940	28.319	2	899.4964	899.4964	M	R	2	10
PSM	AEQSDEAV	474	sp|P00167-2|CYB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4692	20.342	1	889.36651	889.3665	M	K	2	10
PSM	AGNAEPPPAGAACPQD	475	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=4832	20.955	2	1563.6624	1563.6624	M	R	2	18
PSM	AMSSGGSGGGVPEQEDSVLF	476	sp|Q16637-4|SMN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=7511	29.898	2	1967.8419	1967.8419	M	R	2	22
PSM	AQAAGPAGGGEP	477	sp|Q08AE8-2|SPIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4742	20.565	2	1023.4621	1023.4621	M	R	2	14
PSM	AQQQMTSSQ	478	sp|Q712K3|UB2R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4176	17.933	2	1049.4448	1049.4448	M	K	2	11
PSM	AQVAMSTLPVEDEESSES	479	sp|P78347-5|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=6230	26.121	2	1965.8361	1965.8361	M	R	2	20
PSM	ASESETLNPSA	480	sp|O75164|KDM4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5287	22.76	2	1146.5041	1146.5041	M	R	2	13
PSM	ASLSTWSSPAEP	481	sp|Q92888-3|ARHG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7353	29.534	2	1273.5826	1273.5826	M	R	2	14
PSM	ASSGAGDPLDS	482	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5416	23.246	2	1017.4251	1017.4251	M	K	2	13
PSM	ATADTPAPASSGLSP	483	sp|O60293-4|ZC3H1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5752	24.437	2	1383.6518	1383.6518	M	K	2	17
PSM	ATTATMATSGSA	484	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5022	21.765	2	1110.4863	1110.4863	M	R	2	14
PSM	ATTATMATSGSA	485	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=4342	18.717	2	1126.4812	1126.4812	M	R	2	14
PSM	AVNVYSTSVTSDNLS	486	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6655	27.476	2	1597.7471	1597.7471	M	R	2	17
PSM	AVSTGVKVP	487	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5607	23.947	2	898.51238	898.5124	M	R	2	11
PSM	DDDIAALVVDNGSGMC	488	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7564	29.949	2	1692.6971	1692.6971	M	K	2	18
PSM	GDTVVEPAPL	489	sp|Q9UBF8-2|PI4KB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6829	28.003	1	1038.5233	1038.5233	M	K	2	12
PSM	GVQVETISPGDG	490	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6089	25.654	2	1199.567	1199.5670	M	R	2	14
PSM	MAPAMQPAEIQFAQ	491	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=6599	27.284	2	1605.7167	1605.7167	-	R	1	15
PSM	MDSTLTASEI	492	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7462	29.819	2	1108.4958	1108.4958	-	R	1	11
PSM	MEAYEQVQ	493	sp|Q9Y421-2|FA32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5289	22.771	2	1054.4277	1054.4277	-	K	1	9
PSM	MEEVVIAGMSG	494	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7242	29.194	2	1179.5152	1179.5152	-	K	1	12
PSM	MENGAVYSPTTEEDPGPA	495	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5809	24.673	2	1921.7888	1921.7888	-	R	1	19
PSM	MEPGPDGPAASGPAAI	496	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6886	28.169	2	1478.6711	1478.6711	-	R	1	17
PSM	MESVSCSAAAV	497	sp|Q15814|TBCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=5374	23.106	2	1168.474	1168.4740	-	R	1	12
PSM	METILEQQ	498	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6076	25.619	2	1048.4747	1048.4747	-	R	1	9
PSM	METILEQQR	499	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5472	23.445	2	1204.5758	1204.5758	-	R	1	10
PSM	MLGTEGGEGFVV	500	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7585	29.979	2	1236.5696	1236.5696	M	K	2	14
PSM	MMQICDTYNQ	501	sp|Q9NPA3|M1IP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=5317	22.878	2	1376.5047	1376.5047	-	K	1	11
PSM	MNAGPGCEPCT	502	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4581	19.834	2	1250.4366	1250.4366	-	K	1	12
PSM	MNGEADCPTDLEMAAP	503	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=6575	27.197	2	1778.6797	1778.6797	-	K	1	17
PSM	MNSSMSSGSGSL	504	sp|Q92796-3|DLG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4665	20.219	2	1217.454	1217.4540	M	R	2	14
PSM	MNTFQDQSGSSSN	505	sp|Q13772-2|NCOA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4802	20.839	2	1459.5522	1459.5522	-	R	1	14
PSM	MTQQGAALQNYNNELV	506	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6853	28.08	2	1850.8469	1850.8469	-	K	1	17
PSM	MTSLAQQLQ	507	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6221	26.092	2	1076.5172	1076.5172	-	R	1	10
PSM	PEFLEDPSVLT	508	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7071	28.697	2	1245.6129	1245.6129	M	K	2	13
PSM	SAADEVDGLGVA	509	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6412	26.691	2	1144.5248	1144.5248	M	R	2	14
PSM	SADAAAGAPLP	510	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6115	25.752	1	981.47673	981.4767	M	R	2	13
PSM	SDTSESGAGLT	511	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4861	21.078	2	1065.4462	1065.4462	M	R	2	13
PSM	SGASSSEQNNNSYET	512	sp|O60825-2|F262_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4354	18.769	2	1615.6234	1615.6234	M	K	2	17
PSM	SGDEMIFDPTMS	513	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6722	27.681	2	1402.5268	1402.5268	M	K	2	14
PSM	SGSMATAEASGSDG	514	sp|O43169|CYB5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=3916	16.739	2	1284.4776	1284.4776	M	K	2	16
PSM	SSVQQQPPPP	515	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4730	20.506	2	1105.5404	1105.5404	M	R	2	12
PSM	STPAVPQDLQLPPSQ	516	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6822	27.982	2	1618.8203	1618.8203	M	R	2	17
PSM	TSALTQGLE	517	sp|Q0VGL1|LTOR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6807	27.942	2	960.47639	960.4764	M	R	2	11
PSM	TSFSTSAQCSTSDSAC	518	sp|O15151-3|MDM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,9-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5332	22.933	2	1737.6458	1737.6458	M	R	2	18
PSM	ASGVAVSDGVI	519	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=6719	27.668353897866666	2	1015.5189	1015.5181	M	K	2	13
PSM	AALVLEDGSVL	520	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=7621	30.05875882986667	2	1127.6077	1127.6069	M	R	2	13
PSM	MNAGSDPVVIVSAA	521	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6839	28.036051593866667	2	1387.666285	1387.665332	-	R	1	15
PSM	MEGGFGSDFGGSGSG	522	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7398	29.652876134666666	2	1407.543994	1405.509225	-	K	1	16
PSM	AAAAAMAEQESA	523	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6186	25.978	2	1161.4972	1161.4972	M	R	2	14
PSM	AAAEEEDGGPEGPN	524	sp|Q99942|RNF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4759	20.643	2	1383.5426	1383.5426	M	R	2	16
PSM	AAAPVAAGSGAG	525	sp|Q8TEL6-2|TP4AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4746	20.583	2	940.46141	940.4614	M	R	2	14
PSM	AADTQVSETL	526	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6153	25.888	2	1075.5033	1075.5033	M	K	2	12
PSM	AAEEPQQQ	527	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=3953	16.911	2	941.40904	941.4090	M	K	2	10
PSM	AAMAVGGAGGS	528	sp|O14744-5|ANM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=4491	19.404	2	905.39128	905.3913	M	R	2	13
PSM	ADGQVAELLL	529	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7602	30.014	2	1069.5655	1069.5655	M	R	2	12
PSM	ADKEAAFDDAVEE	530	sp|Q09028-3|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5760	24.475	2	1450.61	1450.6100	M	R	2	15
PSM	AEEEGPPVEL	531	sp|Q7Z388|D19L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7127	28.829	2	1110.5081	1110.5081	M	R	2	12
PSM	AEEGAVAVCV	532	sp|Q02224-3|CENPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=6557	27.141	2	1045.475	1045.4750	M	R	2	12
PSM	AELDQLPDESSSA	533	sp|Q5TKA1-3|LIN9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6648	27.446	2	1402.61	1402.6100	M	K	2	15
PSM	ALDPADQHL	534	sp|Q7Z7K0|COXM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6055	25.551	2	1020.4876	1020.4876	M	R	2	11
PSM	AQQQMTSSQ	535	sp|Q712K3|UB2R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=3404	14.457	2	1065.4397	1065.4397	M	K	2	11
PSM	ASAGDTQAGP	536	sp|O95716|RAB3D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4277	18.406	2	915.39339	915.3934	M	R	2	12
PSM	ASGVAVSDGVI	537	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6947	28.341	2	1015.5186	1015.5186	M	K	2	13
PSM	ASPQGGQIAIAM	538	sp|Q9BSM1|PCGF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=5814	24.691	2	1200.5809	1200.5809	M	R	2	14
PSM	ASSSGNDDDLTIP	539	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6809	27.949	2	1332.5681	1332.5681	M	R	2	15
PSM	ATNFLAHE	540	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6340	26.484	2	943.43995	943.4399	M	K	2	10
PSM	ATSLGSNTYN	541	sp|Q9NW64-2|RBM22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5438	23.332	2	1068.4724	1068.4724	M	R	2	12
PSM	MDSSAVITQIS	542	sp|Q9GZU7-2|CTDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6441	26.779	2	1208.5595	1208.5595	-	K	1	12
PSM	MDVLVSECSA	543	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6318	26.415	2	1167.4788	1167.4788	-	R	1	11
PSM	MEAAGSPAATETG	544	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4417	19.058	2	1249.5132	1249.5132	-	K	1	14
PSM	MEAPEEPAPV	545	sp|Q96FL8-2|S47A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5497	23.54	2	1126.4852	1126.4852	-	R	1	11
PSM	MEDSMDMDMSPL	546	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5603	23.939	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	547	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=7111	28.798	2	1474.4972	1474.4972	-	R	1	13
PSM	MEDYTKIE	548	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5286	22.755	2	1085.4587	1085.4587	-	K	1	9
PSM	MEEASEGGGND	549	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4826	20.931	2	1136.3928	1136.3928	-	R	1	12
PSM	MEGLTLSDAEQ	550	sp|Q96D71-2|REPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7490	29.869	2	1234.5387	1234.5387	-	K	1	12
PSM	MELPSGPGPE	551	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5680	24.195	2	1070.459	1070.4590	-	R	1	11
PSM	MEPAAAATVQ	552	sp|O60346|PHLP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4970	21.544	2	1045.475	1045.4750	-	R	1	11
PSM	MESGDEAAIE	553	sp|Q8TDP1|RNH2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5067	21.943	2	1108.423	1108.4230	-	R	1	11
PSM	MESGSTAASEEA	554	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5002	21.678	2	1210.466	1210.4660	-	R	1	13
PSM	MESPASSQPASMPQS	555	sp|P46734|MP2K3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5676	24.179	2	1575.6545	1575.6545	-	K	1	16
PSM	MESQGVPPGPY	556	sp|Q5TB30-2|DEP1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5922	25.072	2	1218.5227	1218.5227	-	R	1	12
PSM	METDLNSQD	557	sp|O75143-3|ATG13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4697	20.365	2	1109.4183	1109.4183	-	R	1	10
PSM	MEVDAPGVDG	558	sp|Q8WVX3|CD003_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5300	22.815	2	1046.4226	1046.4226	-	R	1	11
PSM	MFQVPDSEGG	559	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6349	26.51	2	1123.4492	1123.4492	-	R	1	11
PSM	MFSEQAAQ	560	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5235	22.556	1	968.39095	968.3909	-	R	1	9
PSM	MIVADSEC	561	sp|P58004|SESN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=5428	23.291	2	981.37833	981.3783	-	R	1	9
PSM	MLNVPSQSFPAP	562	sp|Q7L1T6|NB5R4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7345	29.509	2	1344.6384	1344.6384	-	R	1	13
PSM	MNYQQQLANSAAI	563	sp|Q9UPQ3-3|AGAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6796	27.907	2	1508.6929	1508.6929	-	R	1	14
PSM	MTENSTSAPAA	564	sp|P07305|H10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4191	17.999	2	1136.4656	1136.4656	-	K	1	12
PSM	PLENLEEEGLP	565	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6619	27.351	2	1238.603	1238.6030	M	K	2	13
PSM	SADAAAGAPLP	566	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6198	26.014	2	981.47673	981.4767	M	R	2	13
PSM	SAFSEAALE	567	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7204	29.076	2	965.43419	965.4342	M	K	2	11
PSM	SCCDLAAAGQLG	568	sp|Q9UBB6|NCDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=6384	26.6	2	1263.5224	1263.5224	M	K	2	14
PSM	SETAPLAPTIPAPAE	569	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7976	31.227	2	1505.7613	1505.7613	M	K	2	17
PSM	SGELPPNINI	570	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7456	29.81	2	1094.5608	1094.5608	M	K	2	12
PSM	SNIYIQEPPTNG	571	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6419	26.716	2	1373.6463	1373.6463	M	K	2	14
PSM	STADALDDENTF	572	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6869	28.132	2	1339.5416	1339.5416	M	K	2	14
PSM	STGPTAATGSN	573	sp|Q15836|VAMP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=3864	16.504	2	1004.4411	1004.4411	M	R	2	13
PSM	TLEAIRYS	574	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6299	26.352	2	993.51311	993.5131	M	R	2	10
PSM	TSLAQQLQ	575	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6491	26.943	2	929.48181	929.4818	M	R	2	10
PSM	METEQPEETFPNTETNGEFGK	576	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6050	25.539647344	3	2472.026943	2472.027481	-	R	1	22
PSM	AAAAVGNAVPCGA	577	sp|Q9HD20|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=5990	25.327532506933334	2	1169.5512	1169.5494	A	R	3	16
PSM	AAAMDVDTPSGTNSGAG	578	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,4-UNIMOD:35	ms_run[1]:scan=5698	24.2508996768	2	1579.6802	1578.6462	M	K	2	19
PSM	AELVQGQSAPVGM	579	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,13-UNIMOD:35	ms_run[1]:scan=7182	29.002417926400003	2	1344.6712	1343.6382	M	K	2	15
PSM	AFLASGPYLTHQQ	580	sp|Q9Y6M9|NDUB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=7426	29.744742367733334	2	1473.7265	1473.7247	M	K	2	15
PSM	MEDSMDMDMSPL	581	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6209	26.0578337696	2	1507.517880	1506.487035	-	R	1	13
PSM	MEDSMDMDMSPL	582	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=7122	28.81921523866667	2	1491.524040	1490.492120	-	R	1	13
PSM	AGNAEPPPAGAACPQD	583	sp|Q9Y606-2|TRUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=4955	21.476312036533333	2	1563.6641	1563.6618	M	R	2	18
PSM	SGGGPSGGGPGGSG	584	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=3542	15.150979161333334	2	1028.4161	1028.4154	M	R	2	16
PSM	AVPPTYADLGKSA	585	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=6126	25.7918811312	2	1330.6819	1330.6764	M	R	2	15
PSM	SQAVQTNGTQPLS	586	sp|Q99496|RING2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=5273	22.7067308664	2	1372.6482	1371.6622	M	K	2	15
PSM	MEPPEGAGTGEIV	587	sp|Q9H9R9|DBND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6148	25.870120212533333	2	1343.591592	1343.591498	-	K	1	14
PSM	AAGTAAALAFLSQES	588	sp|O75607|NPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7570	29.954	2	1448.7147	1448.7147	M	R	2	17
PSM	AAVLQQVLE	589	sp|P12270-2|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7603	30.017	2	1011.5601	1011.5601	M	R	2	11
PSM	AAVQMDPELA	590	sp|Q9Y312|AAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5914	25.048	2	1101.5012	1101.5012	M	K	2	12
PSM	ADEQEIMC	591	sp|Q9NQZ6-2|ZC4H2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=5007	21.697	2	1052.3791	1052.3791	M	K	2	10
PSM	ADKPDMGEIASFD	592	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6618	27.349	2	1436.613	1436.6130	M	K	2	15
PSM	ADLAECNI	593	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6714	27.655	2	946.4066	946.4066	M	K	2	10
PSM	ADSELQLVEQ	594	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6892	28.183	2	1172.5561	1172.5561	M	R	2	12
PSM	ADSELQLVEQ	595	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8104	31.658	2	1172.5561	1172.5561	M	R	2	12
PSM	AEEQPQVELFV	596	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7533	29.919	2	1329.6452	1329.6452	M	K	2	13
PSM	AENSVLTSTTG	597	sp|Q9H8V3-2|ECT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5801	24.642	2	1120.5248	1120.5248	M	R	2	13
PSM	AMWQGAMDN	598	sp|P51795|CLCN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,2-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=5491	23.518	2	1096.3954	1096.3954	M	R	2	11
PSM	ASGVQVADEVC	599	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=5543	23.726	2	1175.5129	1175.5129	M	R	2	13
PSM	ASNNTASIAQA	600	sp|P59768|GBG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5012	21.717	2	1088.5098	1088.5098	M	R	2	13
PSM	ASVTLSEAE	601	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5999	25.366	2	947.44476	947.4448	M	K	2	11
PSM	ATEAQSEGEVPA	602	sp|Q14CB8-5|RHG19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5057	21.902	2	1229.5412	1229.5412	M	R	2	14
PSM	GTQDPGNMGTGVPASEQISCA	603	sp|Q9HCG7-2|GBA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,8-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=5573	23.814	2	2133.8943	2133.8943	M	K	2	23
PSM	MDDIFTQC	604	sp|Q13418-2|ILK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6901	28.216	2	1086.3998	1086.3998	-	R	1	9
PSM	MDNLSSEEIQQ	605	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5443	23.346	2	1350.5609	1350.5609	-	R	1	12
PSM	MDQVMQFVEPS	606	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=6452	26.815	2	1383.5687	1383.5687	-	R	1	12
PSM	MDVSGQETDW	607	sp|Q96RN5-3|MED15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6490	26.94	2	1224.4605	1224.4605	-	R	1	11
PSM	MEGPGLGSQC	608	sp|Q8IUH4|ZDH13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=5035	21.817	2	1092.4216	1092.4216	-	R	1	11
PSM	MELGSCLEGG	609	sp|O95551-3|TYDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=6320	26.419	2	1109.4369	1109.4369	-	R	1	11
PSM	MEMPLPPDDQEL	610	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7328	29.461	2	1471.6211	1471.6211	-	R	1	13
PSM	MEQEPQNGEPAEI	611	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5726	24.341	2	1528.6352	1528.6352	-	K	1	14
PSM	MESEMETQSA	612	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=3936	16.831	2	1215.4271	1215.4271	-	R	1	11
PSM	MESMAVATDGGE	613	sp|P49069|CAMLG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=4607	19.952	2	1270.4693	1270.4693	-	R	1	13
PSM	METEQPEETFPNTETNGEFG	614	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7322	29.44	2	2327.9376	2327.9376	-	K	1	21
PSM	METEQPEETFPNTETNGEFG	615	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7375	29.592	2	2327.9376	2327.9376	-	K	1	21
PSM	MFPAAPSP	616	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6448	26.805	2	874.38949	874.3895	-	R	1	9
PSM	MLGNSAPGPAT	617	sp|P20248|CCNA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6233	26.127	2	1056.491	1056.4910	-	R	1	12
PSM	MMDPCSVGVQL	618	sp|Q8N8R7|AL14E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6863	28.109	2	1309.5352	1309.5352	-	R	1	12
PSM	MNGEADCPTDLEMAAP	619	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=7304	29.394	2	1762.6848	1762.6848	-	K	1	17
PSM	MTDYGEEQ	620	sp|Q9H446|RWDD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4611	19.966	2	1029.3597	1029.3597	-	R	1	9
PSM	MTGAEIEPSAQA	621	sp|Q96D09|GASP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5241	22.577	2	1261.5496	1261.5496	-	K	1	13
PSM	SAFSEAALEK	622	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6085	25.644	2	1093.5292	1093.5292	M	K	2	12
PSM	SASSLLEQ	623	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6475	26.893	2	875.42363	875.4236	M	R	2	10
PSM	SETAPAAPAAAPPAE	624	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5285	22.753	2	1391.6569	1391.6569	M	K	2	17
PSM	SLEQEEETQPG	625	sp|Q6P4A7-2|SFXN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5298	22.807	2	1287.5467	1287.5467	M	R	2	13
PSM	TENSTSAPAA	626	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=4162	17.865	2	989.43017	989.4302	M	K	2	12
PSM	TSALENYIN	627	sp|O95777|LSM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7431	29.756	2	1065.4979	1065.4979	M	R	2	11
PSM	VDMMDLPRS	628	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6026	25.44	2	1120.4893	1120.4893	M	R	2	11
PSM	VDMMDLPRS	629	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6201	26.023	2	1120.4893	1120.4893	M	R	2	11
PSM	AAMDVDTPSGTNSGAG	630	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,3-UNIMOD:35	ms_run[1]:scan=4745	20.57957212106667	2	1507.6110	1507.6091	A	K	3	19
PSM	AGQPAATGSPSAD	631	sp|Q6P1S2|CC033_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=4261	18.33359548026667	2	1170.5156	1170.5148	M	K	2	15
PSM	AAAAAAGAGPEMV	632	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=6517	27.012802327733333	2	1144.5232	1143.5222	M	R	2	15
PSM	MDEQSQGMQGPPVPQFQPQ	633	sp|Q8TDX7|NEK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,8-UNIMOD:35	ms_run[1]:scan=6843	28.051730512266666	2	2186.943699	2185.940855	-	K	1	20
PSM	MDLQAAGAQAQGAAEPS	634	sp|Q9NQ92|COPRS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5489	23.5071755128	2	1672.744602	1672.736265	-	R	1	18
PSM	AAAAAAGPSPGSGPGDSPEGPEGEAPE	635	sp|Q9UID3|VPS51_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=5576	23.826515119466666	3	2375.0272	2374.0192	M	R	2	29
PSM	ATEAQSEGEVPA	636	sp|Q14CB8|RHG19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=5046	21.856999076	2	1229.5416	1229.5407	M	R	2	14
PSM	AQPPPDVEGDDCLPAY	637	sp|Q9NUI1|DECR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=6984	28.453934149866665	2	1784.7550	1784.7558	M	R	2	18
PSM	AAGESMAQ	638	sp|Q9Y3B8-3|ORN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=3528	15.079	2	821.32253	821.3225	M	R	2	10
PSM	AASPGSGSANP	639	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4140	17.758	2	956.41994	956.4199	M	R	2	13
PSM	AAVQMDPELAK	640	sp|Q9Y312|AAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5046	21.857	2	1229.5962	1229.5962	M	R	2	13
PSM	AGSSTGGGGVGET	641	sp|O14641|DVL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4248	18.272	2	1077.4574	1077.4574	M	K	2	15
PSM	AGTVVLDDVEL	642	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7562	29.947	2	1171.5972	1171.5972	M	R	2	13
PSM	ASLSLAPVNIF	643	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7619	30.055	2	1172.6441	1172.6441	M	K	2	13
PSM	ASMGTLAFDEYG	644	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=7297	29.376	2	1318.5387	1318.5387	M	R	2	14
PSM	ASVPVYCLC	645	sp|Q9UPP1-5|PHF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7368	29.572	2	1109.4886	1109.4886	M	R	2	11
PSM	MAPSVPAAEPEYP	646	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6399	26.643	2	1415.6279	1415.6279	-	K	1	14
PSM	MDNQCTVQV	647	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=5384	23.14	2	1151.4587	1151.4587	-	R	1	10
PSM	MDQVMQFVEPS	648	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7507	29.894	2	1367.5737	1367.5737	-	R	1	12
PSM	MEADASVDMFS	649	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7280	29.306	2	1259.4686	1259.4686	-	K	1	12
PSM	MEADGAGEQM	650	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3748	16.016	2	1111.3798	1111.3798	-	R	1	11
PSM	MEATGTDEVD	651	sp|Q96DT6|ATG4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4605	19.941	2	1124.4179	1124.4180	-	K	1	11
PSM	MEDSMDMDMSPL	652	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6208	26.056	2	1490.4921	1490.4921	-	R	1	13
PSM	MEGEPPPVEE	653	sp|Q6IEG0-2|SNR48_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5095	22.047	2	1170.4751	1170.4751	-	R	1	11
PSM	MESEMETQSA	654	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4809	20.86	2	1199.4322	1199.4322	-	R	1	11
PSM	METEQPEETFPNTETNGEFG	655	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6835	28.024	2	2343.9325	2343.9325	-	K	1	21
PSM	METPPVNTIGE	656	sp|Q9UIM3|FKBPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5816	24.702	2	1244.5595	1244.5595	-	K	1	12
PSM	MEVKPPPG	657	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4438	19.154	2	911.44225	911.4423	-	R	1	9
PSM	MEYMAESTD	658	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=4707	20.41	2	1149.3842	1149.3842	-	R	1	10
PSM	MEYMAESTD	659	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5649	24.082	2	1133.3893	1133.3893	-	R	1	10
PSM	MFSEQAAQ	660	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5208	22.467	2	968.39095	968.3909	-	R	1	9
PSM	MLGAPDESSV	661	sp|Q7Z4S6-6|KI21A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5935	25.124	2	1062.4539	1062.4539	-	R	1	11
PSM	PMFIVNTNVP	662	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6428	26.743	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	663	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6551	27.123	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	664	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7068	28.688	2	1130.5794	1130.5794	M	R	2	12
PSM	SAPSEEEEYA	665	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5278	22.727	2	1152.4459	1152.4459	M	R	2	12
PSM	SDTLTADVIG	666	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7244	29.198	2	1032.4975	1032.4975	M	R	2	12
PSM	SGALDVLQM	667	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7572	29.957	2	974.47428	974.4743	M	K	2	11
PSM	SGTNLDGNDEFDEQL	668	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7154	28.919	2	1694.6908	1694.6908	M	R	2	17
PSM	TTLVLDNGAYNA	669	sp|Q9GZN1-2|ARP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7377	29.598	2	1292.6248	1292.6248	M	K	2	14
PSM	VDMMDLPRS	670	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=5234	22.551	2	1136.4842	1136.4842	M	R	2	11
PSM	SETAPAAPAAAPPAE	671	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5847	24.811681446666668	2	1391.6570	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	672	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=6106	25.723487783733333	2	1392.6602	1391.6562	M	K	2	17
PSM	SETAPAAPAAAPPAE	673	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=7195	29.043957326666668	2	1391.6581	1391.6564	M	K	2	17
PSM	SEGNAAGEPSTPGGP	674	sp|P05423|RPC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=4784	20.757712924	2	1368.5798	1368.5788	M	R	2	17
PSM	AAAAMAEQESA	675	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=4839	20.9805383032	2	1106.4555	1106.4545	A	R	3	14
PSM	SGALDVLQM	676	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=7514	29.901076510666666	2	990.4691	990.4687	M	K	2	11
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	677	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6425	26.734539618933333	3	2499.124950	2498.096623	-	R	1	28
PSM	MQDAENVAVPEAAEE	678	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6576	27.199953084799997	2	1660.727710	1659.693397	-	R	1	16
PSM	MEPGPDGPAASGPAAI	679	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:35	ms_run[1]:scan=6909	28.236052230933335	2	1495.6992	1494.6652	-	R	1	17
PSM	SDNGELEDKPPAPPV	680	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5751	24.431429773599998	2	1605.7540	1605.7517	M	R	2	17
PSM	ASSDLEQLCSHVNE	681	sp|Q96BD8|SKA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,9-UNIMOD:4	ms_run[1]:scan=6334	26.459858132799997	2	1630.7102	1629.6932	M	K	2	16
PSM	MDDVPAPTPAPAPPAAAAP	682	sp|Q96SL8|FIZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6074	25.614894736533333	2	1813.856452	1813.855652	-	R	1	20
PSM	MEPPGGSLGPG	683	sp|O60610|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5388	23.149838262933333	2	1055.460983	1055.459361	-	R	1	12
PSM	MLEELECGAPGA	684	sp|Q13111|CAF1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=7012	28.542329929333334	2	1333.557614	1333.553004	-	R	1	13
PSM	RAQLGGPEAAKSDETAAK	685	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=3688	15.765218985333332	3	1798.919610	1798.917340	S	-	188	206
PSM	MMEGLDDGPDFLSEED	686	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[1]:scan=7498	29.881322446666665	2	1872.692736	1872.691742	-	R	1	17
PSM	AAAATMAAAA	687	sp|Q8N1B4|VPS52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=4865	21.092	2	876.40112	876.4011	M	R	2	12
PSM	AAQLLEE	688	sp|Q6PJ69|TRI65_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7281	29.309	1	814.40725	814.4072	M	K	2	9
PSM	ACLSPSQLQ	689	sp|Q5SRE7-2|PHYD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=6302	26.37	2	1044.491	1044.4910	M	K	2	11
PSM	ADMQNLVE	690	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=5460	23.41	2	976.41716	976.4172	M	R	2	10
PSM	AERPEDLNLPNAVIT	691	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6841	28.044	2	1692.8683	1692.8683	M	R	2	17
PSM	AKPQVVVAPVLMS	692	sp|Q9H074-3|PAIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=6298	26.349	2	1395.7796	1395.7796	M	K	2	15
PSM	ALSDADVQ	693	sp|P36543-3|VATE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5647	24.076	2	859.39233	859.3923	M	K	2	10
PSM	ALSMPLNGL	694	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7525	29.912	2	972.49502	972.4950	M	K	2	11
PSM	AQFDTEYQ	695	sp|Q7Z3C6-3|ATG9A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6188	25.983	1	1042.4244	1042.4244	M	R	2	10
PSM	ASGQGPGPP	696	sp|Q16611-2|BAK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4689	20.327	2	808.37153	808.3715	M	R	2	11
PSM	ASIMEGPLS	697	sp|Q96SU4-7|OSBL9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6297	26.346	2	961.44265	961.4426	M	K	2	11
PSM	ASSDIQV	698	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5846	24.808	1	760.3603	760.3603	M	K	2	9
PSM	ATPYVTDETGG	699	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5716	24.313	2	1151.4982	1151.4982	M	K	2	13
PSM	CNTPTYCDLG	700	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=6054	25.549	2	1241.4693	1241.4693	M	K	2	12
PSM	GDEMDAMIPE	701	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=5449	23.374	2	1180.4264	1180.4264	M	R	2	12
PSM	GDEMDAMIPE	702	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=5461	23.413	2	1180.4264	1180.4264	M	R	2	12
PSM	MAPAEILNG	703	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6628	27.385	2	972.45863	972.4586	-	K	1	10
PSM	MDEPSPLAQPLELNQHS	704	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6667	27.518	2	1962.8993	1962.8993	-	R	1	18
PSM	MDETSPLVSPE	705	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6910	28.241	2	1245.5435	1245.5435	-	R	1	12
PSM	MDGVSSEANEENDNIE	706	sp|Q8NG31-3|KNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5199	22.433	2	1809.6847	1809.6847	-	R	1	17
PSM	MDTAEEDIC	707	sp|O60337-5|MARH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5242	22.58	2	1140.3951	1140.3951	-	R	1	10
PSM	MEAAGSPAATETG	708	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5313	22.862	2	1233.5183	1233.5183	-	K	1	14
PSM	MEASSEPPLDA	709	sp|Q7Z4G1|COMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5618	23.978	2	1203.4965	1203.4965	-	K	1	12
PSM	MEDSMDMDMSPL	710	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5724	24.337	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	711	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5937	25.127	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	712	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6292	26.331	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	713	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=7231	29.168	2	1474.4972	1474.4972	-	R	1	13
PSM	MEEDQELE	714	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5111	22.092	2	1079.3965	1079.3965	-	R	1	9
PSM	MENGYTYEDY	715	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7002	28.511	2	1325.4758	1325.4758	-	K	1	11
PSM	MENSSAASASSEAGSS	716	sp|O43310|CTIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3988	17.075	2	1529.5788	1529.5788	-	R	1	17
PSM	MESGAYGAA	717	sp|O43760|SNG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4779	20.738	1	913.34875	913.3487	-	K	1	10
PSM	MESGAYGAA	718	sp|O43760|SNG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4794	20.802	2	913.34875	913.3487	-	K	1	10
PSM	METEQPEETFPNTETNGEFG	719	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6992	28.478	2	2343.9325	2343.9325	-	K	1	21
PSM	MGGEQEEE	720	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3600	15.401	2	965.32841	965.3284	-	R	1	9
PSM	MLSEQAQ	721	sp|Q7L804|RFIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4681	20.292	1	863.36948	863.3695	M	K	2	9
PSM	MMLGTEGGEGFVV	722	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7548	29.932	2	1383.605	1383.6050	-	K	1	14
PSM	MMLSEQAQ	723	sp|Q7L804|RFIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=4719	20.458	2	1010.4049	1010.4049	-	K	1	9
PSM	MMMGCGESEL	724	sp|Q8TAP8|PPR35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=5341	22.968	2	1233.4022	1233.4022	-	K	1	11
PSM	MNAGPGCEPCT	725	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4603	19.932	2	1250.4366	1250.4366	-	K	1	12
PSM	MNNSGADEIG	726	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4786	20.767	2	1064.4081	1064.4081	-	K	1	11
PSM	MNSDQDVAL	727	sp|Q92738|US6NL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5857	24.852	2	1049.4335	1049.4335	-	K	1	10
PSM	MTNEEPLP	728	sp|Q15007-2|FL2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5815	24.696	2	987.42191	987.4219	-	K	1	9
PSM	MTSALTQGLE	729	sp|Q0VGL1|LTOR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6533	27.072	2	1107.5118	1107.5118	-	R	1	11
PSM	MVLSQEEPDSA	730	sp|Q8TF71|MOT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5738	24.38	2	1262.5336	1262.5336	-	R	1	12
PSM	SATNNIAQA	731	sp|O60262|GBG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4896	21.218	2	930.44067	930.4407	M	R	2	11
PSM	SGGSSCSQTPS	732	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=3475	14.818	2	1095.4139	1095.4139	M	R	2	13
PSM	SQDTEVDM	733	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=4150	17.808	2	981.35971	981.3597	M	K	2	10
PSM	SSGADGGGGAAVAA	734	sp|Q5JPI9|EFMT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4462	19.268	2	1088.4734	1088.4734	M	R	2	16
PSM	STPAVPQDLQLPPSQ	735	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7005	28.52	2	1618.8203	1618.8203	M	R	2	17
PSM	SVGCACPGCSS	736	sp|Q86U70|LDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=4599	19.918	2	1182.4104	1182.4104	M	K	2	13
PSM	TEFWLISAPGE	737	sp|P21283|VATC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7622	30.061	2	1290.6132	1290.6132	M	K	2	13
PSM	AAAAMAEQESA	738	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=4821	20.9086719384	2	1106.4555	1106.4545	A	R	3	14
PSM	SETAPLAPTIPAPAE	739	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=8312	32.3235522016	2	1505.7632	1505.7608	M	K	2	17
PSM	MQGGEPVSTM	740	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5363	23.060611938933334	2	1093.442701	1093.441997	-	K	1	11
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSN	741	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=6127	25.797235610933335	3	2523.2287	2523.2236	M	R	2	30
PSM	AQVAMSTLPVEDEESSES	742	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=7190	29.027515722933334	2	1966.8692	1965.8352	M	R	2	20
PSM	AAQGEPQVQF	743	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=6936	28.3094580128	2	1115.5247	1115.5242	M	K	2	12
PSM	MEQPQEEAPEV	744	sp|Q03181|PPARD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5509	23.585664659733332	2	1343.557095	1343.555112	-	R	1	12
PSM	AEAPPVSGTF	745	sp|Q12986|NFX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=6694	27.601321098933333	2	1016.4830	1016.4810	M	K	2	12
PSM	MEKPSPLLVG	746	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6032	25.4666103448	2	1127.5897	1127.5891	V	R	3	13
PSM	ATPNQTACNAESPVALEEA	747	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=6426	26.738820640266667	2	2013.8988	2013.8944	M	K	3	22
PSM	MEDSMDMDMSPL	748	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6382	26.596273655199997	2	1507.518535	1506.487035	-	R	1	13
PSM	AAAAEGVLAT	749	sp|Q6QNY1|BL1S2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6671	27.532	2	914.47091	914.4709	M	R	2	12
PSM	AAAWGSSLTAATQ	750	sp|Q86U28-2|ISCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7475	29.844	2	1275.6095	1275.6095	M	R	2	15
PSM	AAPPEPGEPEE	751	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5119	22.117	2	1163.4982	1163.4982	M	R	2	13
PSM	AASQVLGE	752	sp|Q9Y5Z9-2|UBIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5989	25.321	2	815.4025	815.4025	M	K	2	10
PSM	AASTDMAGLEESF	753	sp|Q9BW30|TPPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=7038	28.607	2	1385.5657	1385.5657	M	R	2	15
PSM	AAVQAAEV	754	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5757	24.462	2	799.40758	799.4076	M	K	2	10
PSM	ADDPSAAD	755	sp|P62495|ERF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=3938	16.839	2	802.29809	802.2981	M	R	2	10
PSM	ADKMDMSLDDII	756	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6932	28.302	2	1439.616	1439.6160	M	K	2	14
PSM	ADKPDMGEIASFD	757	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5868	24.892	2	1452.6079	1452.6079	M	K	2	15
PSM	ADMQNLVE	758	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6917	28.258	2	960.42225	960.4222	M	R	2	10
PSM	ADMQNLVE	759	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6946	28.338	2	960.42225	960.4222	M	R	2	10
PSM	ADQLTEEQIAEF	760	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8139	31.775	2	1434.6515	1434.6515	M	K	2	14
PSM	AGLNSLEAVK	761	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6176	25.954	2	1042.5659	1042.5659	M	R	2	12
PSM	ALPPAAAPPAGA	762	sp|Q8N5X7|IF4E3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6057	25.558	2	1044.5604	1044.5604	M	R	2	14
PSM	ANSANTNTVP	763	sp|P52655|TF2AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4911	21.281	2	1029.4727	1029.4727	M	K	2	12
PSM	AQFDTEYQ	764	sp|Q7Z3C6-3|ATG9A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6189	25.985	2	1042.4244	1042.4244	M	R	2	10
PSM	ASPSLERPE	765	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4953	21.467	2	1026.4982	1026.4982	M	K	2	11
PSM	ASVAVDPQPSVVT	766	sp|Q99541|PLIN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6264	26.247	2	1310.6718	1310.6718	M	R	2	15
PSM	ATAAYEQL	767	sp|Q9NTJ5|SAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6672	27.534	2	907.42871	907.4287	M	K	2	10
PSM	ATGANATPLDFPS	768	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7338	29.489	2	1302.6092	1302.6092	M	K	2	15
PSM	AVDCPGDLGT	769	sp|Q8N3R9-2|MPP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=5836	24.767	2	1045.4386	1045.4386	M	R	2	12
PSM	AVNVYSTSVTSDNLS	770	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6780	27.859	2	1597.7471	1597.7471	M	R	2	17
PSM	GDAPSPEE	771	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4317	18.601	2	842.32939	842.3294	M	K	2	10
PSM	MDEMATTQIS	772	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=4870	21.111	2	1199.4686	1199.4686	-	K	1	11
PSM	MDGIVPDIAVGT	773	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7575	29.961	2	1228.6009	1228.6009	-	K	1	13
PSM	MDVHDLF	774	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6893	28.185	2	933.39022	933.3902	-	R	1	8
PSM	MEAVATATAA	775	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5288	22.765	2	992.44846	992.4485	-	K	1	11
PSM	MEEDQELE	776	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6022	25.426	2	1063.4016	1063.4016	-	R	1	9
PSM	MEGQDEVSA	777	sp|Q8WVP7-2|LMBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4642	20.116	2	1022.3863	1022.3863	-	R	1	10
PSM	MENSQLC	778	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=4622	20.019	2	938.34737	938.3474	-	K	1	8
PSM	MEQPMQNGEED	779	sp|Q00994-2|BEX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=3903	16.676	2	1380.481	1380.4810	-	R	1	12
PSM	MGDAPSPEE	780	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4430	19.119	2	989.36479	989.3648	-	K	1	10
PSM	MGDAPSPEE	781	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4439	19.16	2	989.36479	989.3648	-	K	1	10
PSM	MMTSVGTN	782	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=3912	16.717	2	913.35212	913.3521	-	R	1	9
PSM	MNIMDFNV	783	sp|Q9Y371|SHLB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=7253	29.22	2	1056.4256	1056.4256	-	K	1	9
PSM	MQSPAVLVTS	784	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6182	25.968	2	1089.5376	1089.5376	-	R	1	11
PSM	MTEQAISFA	785	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6873	28.14	2	1054.4641	1054.4641	-	K	1	10
PSM	PEIVDTCSLASPASVC	786	sp|P09960-2|LKHA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6159	25.904	2	1704.7699	1704.7699	M	R	2	18
PSM	SGSSGTPYLGS	787	sp|Q9BX40-2|LS14B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5667	24.141	2	1053.4615	1053.4615	M	K	2	13
PSM	SSGASASALQ	788	sp|P50151|GBG10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4782	20.75	2	919.42469	919.4247	M	R	2	12
PSM	STNENANTPAA	789	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4071	17.434	2	1130.484	1130.4840	M	R	2	13
PSM	SVPGPSSPDGALT	790	sp|Q9UL45-2|BL1S6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5977	25.277	2	1225.5826	1225.5826	M	R	2	15
PSM	SVQVVSAAAAA	791	sp|Q96HN2-2|SAHH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6346	26.499	2	1014.5346	1014.5346	M	K	2	13
PSM	SYGPLDMY	792	sp|Q86Y82|STX12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=7275	29.289	2	1002.4004	1002.4004	M	R	2	10
PSM	METEQPEETFPNTETNGEFG	793	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=7320	29.435948670933332	2	2327.937638	2327.937603	-	K	1	21
PSM	AAAAGTATSQ	794	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=4425	19.096334287733335	2	847.4041	847.4030	A	R	3	13
PSM	STPAVPQDLQLPPSQ	795	sp|Q8WWK9|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=7293	29.358430210133335	2	1618.8208	1618.8197	M	R	2	17
PSM	MEQEPQNGEPAEI	796	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5830	24.74765680746667	2	1528.631551	1528.635154	-	K	1	14
PSM	AAAAAQGGGGGEP	797	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=4772	20.7000507464	2	1054.4679	1054.4674	M	R	2	15
PSM	AEVQVLVLDG	798	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=7574	29.960084861066665	2	1083.5814	1083.5807	M	R	2	12
PSM	ADFDTYDD	799	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=6487	26.929817217333333	2	1002.3458	1002.3449	M	R	2	10
PSM	ATVPVYCVC	800	sp|O75151|PHF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=6842	28.049193137866666	2	1109.4832	1109.4880	M	R	2	11
PSM	AAAETQSL	801	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=5548	23.7446717856	2	831.3970	831.3969	M	R	2	10
PSM	MMQICDTYNQ	802	sp|Q9NPA3|M1IP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[1]:scan=6360	26.5345594656	2	1360.509613	1360.509759	-	K	1	11
PSM	KEVEADDVMRSGP	803	sp|Q00975|CAC1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:35	ms_run[1]:scan=5760	24.475246214933335	2	1449.657594	1447.661309	K	R	1109	1122
PSM	AAASGSVLQ	804	sp|Q5VWZ2-2|LYPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5506	23.575	2	844.42905	844.4290	M	R	2	11
PSM	AAQIPESDQI	805	sp|Q9Y5J7|TIM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=6453	26.818	2	1112.535	1112.5350	M	K	2	12
PSM	ADKMDMSLDDII	806	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6920	28.271	2	1439.616	1439.6160	M	K	2	14
PSM	AEAPPVSGTF	807	sp|Q12986-3|NFX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=6719	27.668	2	1016.4815	1016.4815	M	K	2	12
PSM	AEFLDDQET	808	sp|O14545-2|TRAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=7436	29.768	2	1108.456	1108.4560	M	R	2	11
PSM	AENHCELLSPA	809	sp|Q9NXV2|KCTD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=5735	24.367	2	1281.566	1281.5660	M	R	2	13
PSM	AGLGHPAAFG	810	sp|O94760|DDAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5938	25.129	2	938.46102	938.4610	M	R	2	12
PSM	AGPLQGGGA	811	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5337	22.958	1	768.37662	768.3766	M	R	2	11
PSM	ALPQSEDAMTGDTD	812	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=5267	22.679	2	1507.5984	1507.5984	M	K	2	16
PSM	ANLEESFP	813	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=7488	29.866	2	947.42363	947.4236	M	R	2	10
PSM	AQEFVNC	814	sp|P35754|GLRX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=6120	25.77	2	908.36982	908.3698	M	K	2	9
PSM	AQISSNSGF	815	sp|O00443-2|P3C2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=6303	26.374	2	951.42977	951.4298	M	K	2	11
PSM	ASSNTVLM	816	sp|O95861-4|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=5251	22.616	2	879.40078	879.4008	M	R	2	10
PSM	ASSSGNDDDLTIP	817	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=7012	28.542	2	1332.5681	1332.5681	M	R	2	15
PSM	AVSVTPIRDT	818	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5584	23.86	2	1099.5873	1099.5873	M	K	2	12
PSM	CSLGLFPPPPP	819	sp|Q9NRG9-2|AAAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=7568	29.952	2	1222.6056	1222.6056	M	R	2	13
PSM	KPLVGLEVI	820	sp|Q4ZHG4-2|FNDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7453	29.805	2	966.61137	966.6114	G	K	1369	1378
PSM	MEADGAGEQM	821	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3549	15.185	2	1111.3798	1111.3798	-	R	1	11
PSM	MELGSCLEGG	822	sp|O95551-3|TYDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=6311	26.395	2	1109.4369	1109.4369	-	R	1	11
PSM	MENCLGES	823	sp|Q9UHB6-2|LIMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=4848	21.02	2	996.35285	996.3528	-	R	1	9
PSM	MEQPPAP	824	sp|Q13188|STK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4827	20.935	2	826.3531	826.3531	-	K	1	8
PSM	MEQVNEL	825	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5845	24.805	2	919.3957	919.3957	-	K	1	8
PSM	MMQICDTYNQ	826	sp|Q9NPA3|M1IP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6165	25.923	2	1360.5098	1360.5098	-	K	1	11
PSM	MNGQLDLSG	827	sp|Q92734-4|TFG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5906	25.02	2	991.42806	991.4281	-	K	1	10
PSM	MNTLQGPVSF	828	sp|Q13401-3|PM2P3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7465	29.824	2	1150.5329	1150.5329	-	K	1	11
PSM	MQAALEVTA	829	sp|Q9BSY4|CHCH5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6114	25.747	2	990.4692	990.4692	-	R	1	10
PSM	MQVSSLNEV	830	sp|Q9BSC4-2|NOL10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6077	25.622	2	1063.4856	1063.4856	-	K	1	10
PSM	MSPEVALN	831	sp|Q9NXR7-1|BABA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5702	24.264	2	917.41643	917.4164	-	R	1	9
PSM	MTGAEIEPSAQA	832	sp|Q96D09|GASP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=6146	25.864	2	1245.5547	1245.5547	-	K	1	13
PSM	MTSEVIEDE	833	sp|Q9BV86-2|NTM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5498	23.545	2	1109.4434	1109.4434	-	K	1	10
PSM	MVSIPEYYEG	834	sp|Q8WVX9|FACR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7273	29.285	2	1244.5271	1244.5271	-	K	1	11
PSM	SDAAVDTSSEITT	835	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5771	24.523	2	1337.5834	1337.5834	M	K	2	15
PSM	SEQSICQA	836	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=4893	21.203	2	963.39676	963.3968	M	R	2	10
PSM	SETAPAAPAAAPPAE	837	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=7689	30.292	2	1391.6569	1391.6569	M	K	2	17
PSM	SGEDEQQEQTIAEDLVVT	838	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=7508	29.895	2	2031.912	2031.9120	M	K	2	20
PSM	METEQPEETFPNTETNGEFG	839	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7914	31.0201128064	2	2344.937127	2343.932518	-	K	1	21
PSM	GITTIEAVK	840	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15		ms_run[1]:scan=6128	25.799412307733334	2	930.5407	930.5381	A	R	3	12
PSM	MEVEAVCGGAGEVEAQDSDPAPAFS	841	sp|P35250|RFC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=7008	28.531141930666667	3	2580.068444	2580.063215	-	K	1	26
PSM	GALDVLQM	842	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	8-UNIMOD:35	ms_run[1]:scan=7336	29.4829189848	2	861.4270	861.4261	S	K	3	11
PSM	AGQPAATGSPSAD	843	sp|Q6P1S2|CC033_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=4273	18.38986381733333	2	1170.5156	1170.5148	M	K	2	15
PSM	MESQEPTESSQNG	844	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4001	17.137455534933334	2	1481.548243	1480.562383	-	K	1	14
PSM	SANNSPPSAQ	845	sp|O94806|KPCD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=3670	15.691411174666666	2	1013.4425	1013.4409	M	K	2	12
PSM	MMEDDGQP	846	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[1]:scan=4061	17.395176712533335	2	995.320736	995.321213	-	R	1	9
PSM	AQGLIEVE	847	sp|Q9BU02|THTPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=7234	29.172641858400002	2	899.4601	899.4595	M	R	2	10
PSM	MDVDAE	848	sp|Q5SXM2|SNPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4245	18.262323116	1	736.259069	736.258536	-	R	1	7
PSM	MDPAPSLGCSL	849	sp|Q9H706|GARE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=6918	28.2628833296	2	1204.511326	1204.510411	-	K	1	12
PSM	MEKPSPLLVG	850	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=6639	27.41246608106667	2	1111.5958	1111.5942	V	R	3	13
PSM	MEQLSSANT	851	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4793	20.7998935672	2	1037.433934	1037.433541	-	R	1	10
PSM	AQFDTEYQ	852	sp|Q7Z3C6|ATG9A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=6176	25.953540582133332	2	1042.4248	1042.4238	M	R	2	10
PSM	MLLLPSAADG	853	sp|Q99543|DNJC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1	ms_run[1]:scan=7630	30.0833733704	2	1028.515269	1028.521233	-	R	1	11
PSM	AAGPISE	854	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1	ms_run[1]:scan=5175	22.353914712	1	685.3288	685.3277	M	R	2	9
PSM	MDGLLNP	855	sp|Q5T6V5|QSPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6622	27.363978934666665	1	816.370545	816.368756	-	R	1	8
PSM	MDEAVGDL	856	sp|Q15645|PCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6280	26.296767261333333	2	906.366478	906.364064	-	K	1	9
PSM	MTENSTSAPAA	857	sp|P07305|H10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1	ms_run[1]:scan=5037	21.820049335466667	2	1120.469400	1120.470654	-	K	1	12
PSM	MEDSMDMDMSPL	858	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=5661	24.116871452266665	2	1474.482972	1474.497205	-	R	1	13
PSM	RESYISDNLDLDMDQLE	859	sp|Q96NE9|FRMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:35	ms_run[1]:scan=6178	25.9579674296	2	2070.898384	2070.905180	Y	K	347	364