MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F03.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69.0	null	2-UNIMOD:1	0.03	69.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	66.0	null	2-UNIMOD:1	0.10	66.0	5	2	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63.0	null	2-UNIMOD:1	0.04	63.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	58.0	null	2-UNIMOD:1	0.06	58.0	2	1	0
PRT	sp|Q14151-2|SAFB2_HUMAN	Isoform 2 of Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	2-UNIMOD:1	0.24	56.0	1	1	1
PRT	sp|A6NHR9|SMHD1_HUMAN	Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	55.0	null	2-UNIMOD:1	0.01	55.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	55.0	null	2-UNIMOD:1	0.16	55.0	4	2	0
PRT	sp|Q9UID3|VPS51_HUMAN	Vacuolar protein sorting-associated protein 51 homolog OS=Homo sapiens OX=9606 GN=VPS51 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	2-UNIMOD:1	0.04	54.0	1	1	1
PRT	sp|P63027|VAMP2_HUMAN	Vesicle-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=VAMP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	2-UNIMOD:1	0.26	54.0	3	1	0
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	2-UNIMOD:1,25-UNIMOD:35	0.08	53.0	3	2	1
PRT	sp|P55210-2|CASP7_HUMAN	Isoform Beta of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	2-UNIMOD:1,7-UNIMOD:4	0.11	52.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1	0.03	51.0	4	2	0
PRT	sp|Q15543|TAF13_HUMAN	Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	2-UNIMOD:1	0.22	50.0	2	1	0
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1	0.18	49.0	3	1	0
PRT	sp|Q9UBF6-3|RBX2_HUMAN	Isoform 3 of RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1,11-UNIMOD:4	0.24	49.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1	0.05	49.0	2	1	0
PRT	sp|P68402-3|PA1B2_HUMAN	Isoform 3 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1	0.17	49.0	1	1	1
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	2-UNIMOD:1,9-UNIMOD:4,11-UNIMOD:35,15-UNIMOD:4,29-UNIMOD:35	0.11	48.0	4	2	1
PRT	sp|O75312|ZPR1_HUMAN	Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	2-UNIMOD:1	0.07	48.0	1	1	1
PRT	sp|Q9Y2K2-7|SIK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1	0.02	47.0	1	1	1
PRT	sp|Q96EV2-2|RBM33_HUMAN	Isoform 2 of RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1	0.10	47.0	1	1	1
PRT	sp|O95197-6|RTN3_HUMAN	Isoform 6 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1,34-UNIMOD:4	0.18	47.0	1	1	0
PRT	sp|Q9UHX1-6|PUF60_HUMAN	Isoform 6 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1,15-UNIMOD:35	0.04	47.0	2	1	0
PRT	sp|Q4ZIN3-2|MBRL_HUMAN	Isoform 2 of Membralin OS=Homo sapiens OX=9606 GN=TMEM259	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1	0.06	47.0	2	1	0
PRT	sp|Q86U42-2|PABP2_HUMAN	Isoform 2 of Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.07	46.0	2	2	2
PRT	sp|Q9BZE9|ASPC1_HUMAN	Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.04	46.0	1	1	1
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	46.0	2	1	0
PRT	sp|O43347|MSI1H_HUMAN	RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:4	0.06	46.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	2-UNIMOD:1	0.09	46.0	20	3	2
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	45.0	1	1	1
PRT	sp|Q8WW01-2|SEN15_HUMAN	Isoform 2 of tRNA-splicing endonuclease subunit Sen15 OS=Homo sapiens OX=9606 GN=TSEN15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.17	45.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	45.0	8	2	0
PRT	sp|Q9Y4L5|RN115_HUMAN	E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens OX=9606 GN=RNF115 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1	0.06	44.0	1	1	1
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1	0.12	44.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1,9-UNIMOD:35	0.05	44.0	2	1	0
PRT	sp|Q9NQC3-2|RTN4_HUMAN	Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	44.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	44.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1,18-UNIMOD:35	0.11	44.0	4	2	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	44.0	10	1	0
PRT	sp|Q9NR33|DPOE4_HUMAN	DNA polymerase epsilon subunit 4 OS=Homo sapiens OX=9606 GN=POLE4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.31	43.0	1	1	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,18-UNIMOD:4	0.05	43.0	3	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.02	43.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:35	0.02	43.0	2	1	0
PRT	sp|Q86TI2-4|DPP9_HUMAN	Isoform 3 of Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.03	43.0	1	1	1
PRT	sp|P80297|MT1X_HUMAN	Metallothionein-1X OS=Homo sapiens OX=9606 GN=MT1X PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	43.0	1	1	1
PRT	sp|P19622|HME2_HUMAN	Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	43.0	1	1	1
PRT	sp|Q9H098|F107B_HUMAN	Protein FAM107B OS=Homo sapiens OX=9606 GN=FAM107B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.14	42.0	1	1	1
PRT	sp|O15294-3|OGT1_HUMAN	Isoform 1 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.02	42.0	1	1	1
PRT	sp|Q9P0P0|RN181_HUMAN	E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens OX=9606 GN=RNF181 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,10-UNIMOD:4	0.12	42.0	1	1	1
PRT	sp|Q9BYP7-3|WNK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.01	42.0	1	1	1
PRT	sp|Q9NQ92|COPRS_HUMAN	Coordinator of PRMT5 and differentiation stimulator OS=Homo sapiens OX=9606 GN=COPRS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	42.0	1	1	1
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.03	42.0	1	1	1
PRT	sp|O95999|BCL10_HUMAN	B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	42.0	1	1	1
PRT	sp|Q8IWT0|ARCH_HUMAN	Protein archease OS=Homo sapiens OX=9606 GN=ZBTB8OS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.10	42.0	1	1	1
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,3-UNIMOD:35,17-UNIMOD:4	0.07	41.0	1	1	1
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.12	41.0	2	1	0
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,16-UNIMOD:4	0.08	41.0	1	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,49-UNIMOD:35	0.10	41.0	2	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.06	40.0	1	1	1
PRT	sp|O95670-2|VATG2_HUMAN	Isoform 2 of V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.21	40.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	40.0	2	2	2
PRT	sp|P53384-2|NUBP1_HUMAN	Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.06	40.0	2	1	0
PRT	sp|Q8WV99-2|ZFN2B_HUMAN	Isoform 2 of AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,15-UNIMOD:4	0.10	40.0	1	1	1
PRT	sp|Q8N5S9|KKCC1_HUMAN	Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4	0.04	40.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	0.02	40.0	1	1	1
PRT	sp|Q8WUH6|TM263_HUMAN	Transmembrane protein 263 OS=Homo sapiens OX=9606 GN=TMEM263 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	0.22	40.0	1	1	1
PRT	sp|P05423|RPC4_HUMAN	DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.06	40.0	1	1	1
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.09	40.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1	0.04	40.0	2	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,13-UNIMOD:4	0.09	39.0	5	3	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,19-UNIMOD:35	0.07	39.0	1	1	1
PRT	sp|P14859-5|PO2F1_HUMAN	Isoform 5 of POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.03	39.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	0.24	39.0	3	1	0
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.08	39.0	2	2	2
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.11	39.0	1	1	1
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:35	0.03	39.0	2	1	0
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.04	39.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.06	39.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.12	39.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.03	38.0	1	1	1
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,5-UNIMOD:35	0.18	38.0	4	2	0
PRT	sp|Q02978-2|M2OM_HUMAN	Isoform 2 of Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.06	38.0	3	2	1
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,16-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,18-UNIMOD:35,19-UNIMOD:35	0.09	38.0	4	1	0
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.09	38.0	1	1	1
PRT	sp|Q6NXT6-2|TAPT1_HUMAN	Isoform 2 of Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.04	38.0	1	1	1
PRT	sp|O15294|OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.02	38.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.09	38.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	12-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|Q15369|ELOC_HUMAN	Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:35	0.18	38.0	2	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.09	38.0	4	3	2
PRT	sp|Q92522|H1X_HUMAN	Histone H1.10 OS=Homo sapiens OX=9606 GN=H1-10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:35	0.09	38.0	2	2	2
PRT	sp|Q9BTD8|RBM42_HUMAN	RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.07	38.0	1	1	1
PRT	sp|Q6PI98|IN80C_HUMAN	INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.10	37.0	2	1	0
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.04	37.0	1	1	1
PRT	sp|Q6P1K2-3|PMF1_HUMAN	Isoform 3 of Polyamine-modulated factor 1 OS=Homo sapiens OX=9606 GN=PMF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,13-UNIMOD:4	0.09	37.0	2	2	2
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.15	37.0	1	1	1
PRT	sp|Q7LG56-5|RIR2B_HUMAN	Isoform 5 of Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.37	37.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q8IVW6-3|ARI3B_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	37.0	1	1	1
PRT	sp|P49069|CAMLG_HUMAN	Calcium signal-modulating cyclophilin ligand OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.09	37.0	1	1	1
PRT	sp|Q92600-3|CNOT9_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	37.0	1	1	1
PRT	sp|P56211|ARP19_HUMAN	cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:35	0.17	37.0	2	2	2
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.15	37.0	21	2	1
PRT	sp|Q12996-3|CSTF3_HUMAN	Isoform 3 of Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.41	37.0	2	2	2
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|Q8TAE6|PP14C_HUMAN	Protein phosphatase 1 regulatory subunit 14C OS=Homo sapiens OX=9606 GN=PPP1R14C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.12	37.0	1	1	1
PRT	sp|Q8IWC1|MA7D3_HUMAN	MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	3-UNIMOD:1	0.02	37.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35,17-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|Q15283-2|RASA2_HUMAN	Isoform 2 of Ras GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RASA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.04	36.0	1	1	1
PRT	sp|Q9UBL3|ASH2L_HUMAN	Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,32-UNIMOD:35	0.05	36.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.02	36.0	2	2	2
PRT	sp|Q96EC8-2|YIPF6_HUMAN	Isoform 2 of Protein YIPF6 OS=Homo sapiens OX=9606 GN=YIPF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.08	36.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.17	36.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,10-UNIMOD:35	0.02	36.0	3	2	1
PRT	sp|Q9GZT9-3|EGLN1_HUMAN	Isoform 3 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.05	36.0	1	1	1
PRT	sp|Q16514-2|TAF12_HUMAN	Isoform TAFII15 of Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.14	36.0	1	1	1
PRT	sp|Q2VPK5-5|CTU2_HUMAN	Isoform 3 of Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,2-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4	0.05	36.0	16	2	1
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.06	36.0	1	1	1
PRT	sp|P02795|MT2_HUMAN	Metallothionein-2 OS=Homo sapiens OX=9606 GN=MT2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	36.0	1	1	1
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.15	36.0	3	1	0
PRT	sp|Q9NX46|ADPRS_HUMAN	ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,6-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,37-UNIMOD:35	0.10	35.0	1	1	1
PRT	sp|Q9H9E3-2|COG4_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens OX=9606 GN=COG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.07	35.0	1	1	0
PRT	sp|Q8TAG9|EXOC6_HUMAN	Exocyst complex component 6 OS=Homo sapiens OX=9606 GN=EXOC6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.02	35.0	2	2	2
PRT	sp|P85298-2|RHG08_HUMAN	Isoform 2 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.06	35.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.02	35.0	1	1	1
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	35.0	3	2	1
PRT	sp|Q96F24-2|NRBF2_HUMAN	Isoform 2 of Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.07	35.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.01	35.0	3	1	0
PRT	sp|Q7L266|ASGL1_HUMAN	Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	35.0	1	1	1
PRT	sp|Q9P0S3|ORML1_HUMAN	ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	35.0	2	1	0
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.25	35.0	1	1	1
PRT	sp|Q8TBZ6|TM10A_HUMAN	tRNA methyltransferase 10 homolog A OS=Homo sapiens OX=9606 GN=TRMT10A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,5-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.07	35.0	2	1	0
PRT	sp|Q96E14|RMI2_HUMAN	RecQ-mediated genome instability protein 2 OS=Homo sapiens OX=9606 GN=RMI2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.10	34.0	1	1	1
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,21-UNIMOD:4	0.10	34.0	1	1	1
PRT	sp|Q96G46-3|DUS3L_HUMAN	Isoform 3 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.06	34.0	1	1	0
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.03	34.0	1	1	1
PRT	sp|Q9NUP7-2|TRM13_HUMAN	Isoform 2 of tRNA:m(4)X modification enzyme TRM13 homolog OS=Homo sapiens OX=9606 GN=TRMT13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.10	34.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4	0.05	34.0	11	1	0
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	34.0	3	3	3
PRT	sp|Q9H4I3-2|TRABD_HUMAN	Isoform 2 of TraB domain-containing protein OS=Homo sapiens OX=9606 GN=TRABD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	34.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.04	34.0	3	1	0
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q9UNI6|DUS12_HUMAN	Dual specificity protein phosphatase 12 OS=Homo sapiens OX=9606 GN=DUSP12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:1	0.03	34.0	3	2	1
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	8-UNIMOD:4,17-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q8TAC2-2|JOS2_HUMAN	Isoform 2 of Josephin-2 OS=Homo sapiens OX=9606 GN=JOSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.12	34.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,13-UNIMOD:35	0.08	34.0	5	1	0
PRT	sp|P63165|SUMO1_HUMAN	Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.15	34.0	1	1	1
PRT	sp|Q9UMX0|UBQL1_HUMAN	Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.06	34.0	1	1	1
PRT	sp|Q05397-7|FAK1_HUMAN	Isoform 7 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.02	33.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.03	33.0	4	1	0
PRT	sp|P47755-2|CAZA2_HUMAN	Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.08	33.0	1	1	1
PRT	sp|Q6P1Q9|MET2B_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.03	33.0	3	1	0
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.03	33.0	1	1	1
PRT	sp|Q5BKZ1-2|ZN326_HUMAN	Isoform 2 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,12-UNIMOD:4,1-UNIMOD:35	0.19	33.0	2	1	0
PRT	sp|Q9Y462|ZN711_HUMAN	Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|Q8IWJ2-3|GCC2_HUMAN	Isoform 2 of GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.42	33.0	1	1	1
PRT	sp|Q96AY4|TTC28_HUMAN	Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	33.0	1	1	1
PRT	sp|P30519|HMOX2_HUMAN	Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.05	33.0	3	2	1
PRT	sp|Q12962|TAF10_HUMAN	Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,3-UNIMOD:4	0.19	33.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.02	33.0	2	1	0
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,5-UNIMOD:35	0.09	32.0	2	1	0
PRT	sp|Q9Y5X3-2|SNX5_HUMAN	Isoform 2 of Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.13	32.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,10-UNIMOD:4	0.00	32.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|O43399-2|TPD54_HUMAN	Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	32.0	2	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	32.0	3	2	1
PRT	sp|O95677-3|EYA4_HUMAN	Isoform 3 of Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=EYA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q99504-5|EYA3_HUMAN	Isoform 5 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	4	2	0
PRT	sp|Q9BT23|LIMD2_HUMAN	LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1	0.13	32.0	1	1	1
PRT	sp|O43715|TRIA1_HUMAN	TP53-regulated inhibitor of apoptosis 1 OS=Homo sapiens OX=9606 GN=TRIAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	0.17	32.0	1	1	1
PRT	sp|P60602-2|ROMO1_HUMAN	Isoform 2 of Reactive oxygen species modulator 1 OS=Homo sapiens OX=9606 GN=ROMO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	15-UNIMOD:4	0.29	32.0	1	1	1
PRT	sp|P15336-7|ATF2_HUMAN	Isoform 7 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.09	32.0	1	1	1
PRT	sp|Q96DH6|MSI2H_HUMAN	RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|P52655|TF2AA_HUMAN	Transcription initiation factor IIA subunit 1 OS=Homo sapiens OX=9606 GN=GTF2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.04	32.0	2	1	0
PRT	sp|P08397|HEM3_HUMAN	Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,18-UNIMOD:35	0.05	32.0	3	1	0
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.29	32.0	2	1	0
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	1	1	1
PRT	sp|Q9UL63|MKLN1_HUMAN	Muskelin OS=Homo sapiens OX=9606 GN=MKLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.03	31.0	1	1	1
PRT	sp|P42575|CASP2_HUMAN	Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.03	31.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,5-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	31.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35,13-UNIMOD:4	0.01	31.0	2	1	0
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,14-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|Q96IZ6|MET2A_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,5-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|Q16600|ZN239_HUMAN	Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,11-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9BTC0-2|DIDO1_HUMAN	Isoform 2 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q9H871-2|RMD5A_HUMAN	Isoform 2 of E3 ubiquitin-protein transferase RMND5A OS=Homo sapiens OX=9606 GN=RMND5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	0.13	31.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.09	31.0	2	2	2
PRT	sp|Q9BRT3|MIEN1_HUMAN	Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.20	31.0	1	1	1
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:4	0.07	31.0	2	2	2
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.01	31.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.09	31.0	2	1	0
PRT	sp|Q99942|RNF5_HUMAN	E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.08	30.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:35	0.03	30.0	3	2	1
PRT	sp|Q9H2C0|GAN_HUMAN	Gigaxonin OS=Homo sapiens OX=9606 GN=GAN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.02	30.0	1	1	1
PRT	sp|Q9Y5J9|TIM8B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.16	30.0	1	1	1
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.12	30.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.08	30.0	1	1	1
PRT	sp|P56134-3|ATPK_HUMAN	Isoform 3 of ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,7-UNIMOD:4	0.27	30.0	1	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|P10155-2|RO60_HUMAN	Isoform Short of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,8-UNIMOD:35	0.07	30.0	2	1	0
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.17	30.0	1	1	1
PRT	sp|P47224|MSS4_HUMAN	Guanine nucleotide exchange factor MSS4 OS=Homo sapiens OX=9606 GN=RABIF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	30.0	2	1	0
PRT	sp|Q9UK41|VPS28_HUMAN	Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	30.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.04	30.0	4	3	2
PRT	sp|Q92567-3|F168A_HUMAN	Isoform 3 of Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	30.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	30.0	2	1	0
PRT	sp|Q8N138-4|ORML3_HUMAN	Isoform 2 of ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.11	30.0	1	1	1
PRT	sp|Q96SK2-4|TM209_HUMAN	Isoform 4 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.07	30.0	2	2	2
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:35	0.07	30.0	3	1	0
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.19	30.0	1	1	1
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	14-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P78563|RED1_HUMAN	Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q9HD26|GOPC_HUMAN	Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,7-UNIMOD:4,20-UNIMOD:4,30-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:35	0.19	30.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.04	29.0	2	1	0
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.04	29.0	1	1	1
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.07	29.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.11	29.0	2	1	0
PRT	sp|O15428|PINL_HUMAN	Putative PIN1-like protein OS=Homo sapiens OX=9606 GN=PIN1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.12	29.0	2	1	0
PRT	sp|Q9UHD9|UBQL2_HUMAN	Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.02	29.0	2	1	0
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.09	29.0	1	1	1
PRT	sp|O14569|C56D2_HUMAN	Cytochrome b561 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CYB561D2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.05	29.0	1	1	1
PRT	sp|Q96DG6|CMBL_HUMAN	Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q99622|C10_HUMAN	Protein C10 OS=Homo sapiens OX=9606 GN=C12orf57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.13	29.0	1	1	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.01	29.0	1	1	1
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,5-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.01	29.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	1	1	1
PRT	sp|Q8TDX7-2|NEK7_HUMAN	Isoform 2 of Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.17	29.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|Q8N3P4-2|VPS8_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens OX=9606 GN=VPS8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|Q9NX76|CKLF6_HUMAN	CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	29.0	3	2	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	29.0	2	1	0
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|Q5BJH7-4|YIF1B_HUMAN	Isoform 4 of Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	29.0	1	1	0
PRT	sp|O00422-2|SAP18_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	29.0	2	1	0
PRT	sp|P48059-2|LIMS1_HUMAN	Isoform 2 of LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:35,22-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|O95391|SLU7_HUMAN	Pre-mRNA-splicing factor SLU7 OS=Homo sapiens OX=9606 GN=SLU7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	1	1	1
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,3-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.03	29.0	3	1	0
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	1	1	1
PRT	sp|Q9H0L4|CSTFT_HUMAN	Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,11-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q7L5D6|GET4_HUMAN	Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,7-UNIMOD:35,3-UNIMOD:1	0.04	28.0	3	2	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.00	28.0	2	2	2
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.16	28.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.05	28.0	2	1	0
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.03	28.0	2	1	0
PRT	sp|O60282|KIF5C_HUMAN	Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35,13-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9Y4E8-4|UBP15_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.05	28.0	1	1	1
PRT	sp|Q9NRR5-2|UBQL4_HUMAN	Isoform 2 of Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	1	1	1
PRT	sp|Q12840|KIF5A_HUMAN	Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,10-UNIMOD:4,13-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q9BUP0|EFHD1_HUMAN	EF-hand domain-containing protein D1 OS=Homo sapiens OX=9606 GN=EFHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q96NC0|ZMAT2_HUMAN	Zinc finger matrin-type protein 2 OS=Homo sapiens OX=9606 GN=ZMAT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	1	1	1
PRT	sp|Q7Z4H3-3|HDDC2_HUMAN	Isoform 3 of 5'-deoxynucleotidase HDDC2 OS=Homo sapiens OX=9606 GN=HDDC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.20	28.0	1	1	1
PRT	sp|Q9NV56|MRGBP_HUMAN	MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.07	28.0	1	1	1
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q96DT6|ATG4C_HUMAN	Cysteine protease ATG4C OS=Homo sapiens OX=9606 GN=ATG4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q9UHR6|ZNHI2_HUMAN	Zinc finger HIT domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZNHIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|A1KXE4-2|F168B_HUMAN	Isoform 2 of Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	28.0	1	1	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.04	28.0	5	1	0
PRT	sp|Q8TDH9-2|BL1S5_HUMAN	Isoform 2 of Biogenesis of lysosome-related organelles complex 1 subunit 5 OS=Homo sapiens OX=9606 GN=BLOC1S5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,12-UNIMOD:4	0.18	28.0	1	1	1
PRT	sp|Q8N6T7-2|SIR6_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens OX=9606 GN=SIRT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.05	28.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	2	2	2
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,25-UNIMOD:35	0.07	28.0	2	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,15-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q9NXW9-2|ALKB4_HUMAN	Isoform 2 of Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4 OS=Homo sapiens OX=9606 GN=ALKBH4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.29	27.0	1	1	1
PRT	sp|O95249|GOSR1_HUMAN	Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q9NP79|VTA1_HUMAN	Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens OX=9606 GN=VTA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.13	27.0	1	1	1
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.04	27.0	1	1	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.01	27.0	1	1	1
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.04	27.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	5-UNIMOD:35	0.02	27.0	1	1	0
PRT	sp|Q9UEU0|VTI1B_HUMAN	Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens OX=9606 GN=VTI1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,7-UNIMOD:35	0.03	27.0	3	2	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	27.0	3	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	0.09	27.0	1	1	1
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	27.0	2	1	0
PRT	sp|P46734|MP2K3_HUMAN	Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|Q8WVX3|CD003_HUMAN	Uncharacterized protein C4orf3 OS=Homo sapiens OX=9606 GN=C4orf3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.23	27.0	3	2	1
PRT	sp|P51003-2|PAPOA_HUMAN	Isoform 2 of Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	2	1	0
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.03	27.0	2	1	0
PRT	sp|Q68CZ6-2|HAUS3_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 3 OS=Homo sapiens OX=9606 GN=HAUS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,3-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.07	27.0	1	1	1
PRT	sp|Q16774|KGUA_HUMAN	Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.08	27.0	1	1	1
PRT	sp|Q16537-2|2A5E_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.04	27.0	1	1	1
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.07	27.0	1	1	1
PRT	sp|Q14155-6|ARHG7_HUMAN	Isoform 6 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|Q9BV86-2|NTM1A_HUMAN	Isoform 2 of N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.10	27.0	2	2	2
PRT	sp|P55036-2|PSMD4_HUMAN	Isoform Rpn10E of 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	7-UNIMOD:35,9-UNIMOD:4,16-UNIMOD:35	0.06	27.0	2	1	0
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	3-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.05	27.0	2	2	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,11-UNIMOD:35,12-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q9HD20|AT131_HUMAN	Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,13-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.07	26.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.06	26.0	1	1	1
PRT	sp|O14733|MP2K7_HUMAN	Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|Q9Y312|AAR2_HUMAN	Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	26.0	3	2	1
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	0.05	26.0	2	1	0
PRT	sp|Q9NVE7|PANK4_HUMAN	4'-phosphopantetheine phosphatase OS=Homo sapiens OX=9606 GN=PANK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,4-UNIMOD:4	0.02	26.0	2	1	0
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.01	26.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.01	26.0	1	1	1
PRT	sp|Q8IXJ6-4|SIR2_HUMAN	Isoform 4 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.06	26.0	1	1	0
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	2	1	0
PRT	sp|P09493-5|TPM1_HUMAN	Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.10	26.0	1	1	1
PRT	sp|Q9BXK5-2|B2L13_HUMAN	Isoform 1 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.07	26.0	1	1	1
PRT	sp|Q15020-3|SART3_HUMAN	Isoform 3 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.12	26.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.03	26.0	2	2	2
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.08	26.0	1	1	1
PRT	sp|Q9BZ67-2|FRMD8_HUMAN	Isoform 2 of FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	26.0	2	1	0
PRT	sp|Q9UGL1|KDM5B_HUMAN	Lysine-specific demethylase 5B OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q8IUH4|ZDH13_HUMAN	Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	26.0	2	2	2
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P20248|CCNA2_HUMAN	Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q6AI12|ANR40_HUMAN	Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q9NPF4|OSGEP_HUMAN	Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P53350|PLK1_HUMAN	Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	1	1	1
PRT	sp|Q6NW29|RWDD4_HUMAN	RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,9-UNIMOD:35	0.07	26.0	1	1	1
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.08	26.0	2	1	0
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,16-UNIMOD:4	0.06	26.0	2	1	0
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,34-UNIMOD:4	0.04	26.0	1	1	0
PRT	sp|Q9H9E3|COG4_HUMAN	Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens OX=9606 GN=COG4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	0
PRT	sp|Q8IXJ6|SIR2_HUMAN	NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.04	26.0	1	1	0
PRT	sp|Q4V328|GRAP1_HUMAN	GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.01	26.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|Q86WB0-3|NIPA_HUMAN	Isoform 3 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,5-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,10-UNIMOD:35	0.04	25.0	3	2	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q53GT1|KLH22_HUMAN	Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,11-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q92793-2|CBP_HUMAN	Isoform 2 of CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.09	25.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.11	25.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.06	25.0	1	1	1
PRT	sp|Q6FIF0-2|ZFAN6_HUMAN	Isoform 2 of AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,12-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:4	0.12	25.0	1	1	1
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,12-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.12	25.0	3	2	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|O95997|PTTG1_HUMAN	Securin OS=Homo sapiens OX=9606 GN=PTTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|Q9NR56-3|MBNL1_HUMAN	Isoform 3 of Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P17707|DCAM_HUMAN	S-adenosylmethionine decarboxylase proenzyme OS=Homo sapiens OX=9606 GN=AMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.05	25.0	7	1	0
PRT	sp|Q8N2Z9-3|CENPS_HUMAN	Isoform 3 of Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	25.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.00	25.0	2	1	0
PRT	sp|Q8NEZ5-2|FBX22_HUMAN	Isoform 2 of F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	0.24	25.0	1	1	1
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.00	25.0	2	2	2
PRT	sp|Q96P16|RPR1A_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	2	1	0
PRT	sp|Q8WYA6|CTBL1_HUMAN	Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9BXR0|TGT_HUMAN	Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	0
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q9NWT6|HIF1N_HUMAN	Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.09	24.0	2	2	2
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.08	24.0	2	1	0
PRT	sp|Q92830|KAT2A_HUMAN	Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.26	24.0	1	1	1
PRT	sp|Q8N653|LZTR1_HUMAN	Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens OX=9606 GN=LZTR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|P78347-5|GTF2I_HUMAN	Isoform 5 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,6-UNIMOD:35	0.07	24.0	2	1	0
PRT	sp|Q9Y530|OARD1_HUMAN	ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.08	24.0	1	1	1
PRT	sp|Q9BQS8-3|FYCO1_HUMAN	Isoform 3 of FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	0.14	24.0	1	1	1
PRT	sp|P55957-3|BID_HUMAN	Isoform 3 of BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|Q8N3Y1-2|FBXW8_HUMAN	Isoform 2 of F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	24.0	1	1	1
PRT	sp|O95155-2|UBE4B_HUMAN	Isoform 2 of Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	2	1	0
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	2	1	0
PRT	sp|Q9BQC3-2|DPH2_HUMAN	Isoform 2 of 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.06	24.0	1	1	0
PRT	sp|Q9BWK5-4|CYREN_HUMAN	Isoform 4 of Cell cycle regulator of non-homologous end joining OS=Homo sapiens OX=9606 GN=CYREN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	24.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	24.0	2	1	0
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,2-UNIMOD:1	0.04	24.0	4	2	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|Q9BRL6-2|SRSF8_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 8 OS=Homo sapiens OX=9606 GN=SRSF8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:35	0.06	24.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q16352|AINX_HUMAN	Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P78356-2|PI42B_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,5-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|O43805|SSNA1_HUMAN	Sjoegren syndrome nuclear autoantigen 1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.14	24.0	2	2	2
PRT	sp|Q9BV57|MTND_HUMAN	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Homo sapiens OX=9606 GN=ADI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	7-UNIMOD:35	0.08	24.0	2	1	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	3-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,12-UNIMOD:35	0.07	24.0	1	1	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.06	24.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,9-UNIMOD:35,13-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P40123|CAP2_HUMAN	Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,4-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	24.0	1	1	1
PRT	sp|O95352-3|ATG7_HUMAN	Isoform 3 of Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens OX=9606 GN=ATG7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q8WTS1|ABHD5_HUMAN	1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|A6NFI3|ZN316_HUMAN	Zinc finger protein 316 OS=Homo sapiens OX=9606 GN=ZNF316 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q09028-2|RBBP4_HUMAN	Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q8N371-2|KDM8_HUMAN	Isoform 2 of Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q3ZCW2|LEGL_HUMAN	Galectin-related protein OS=Homo sapiens OX=9606 GN=LGALSL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.07	23.0	1	1	1
PRT	sp|P63272|SPT4H_HUMAN	Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|Q5VZF2-3|MBNL2_HUMAN	Isoform 3 of Muscleblind-like protein 2 OS=Homo sapiens OX=9606 GN=MBNL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q9H875|PKRI1_HUMAN	PRKR-interacting protein 1 OS=Homo sapiens OX=9606 GN=PRKRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.07	23.0	2	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.12	23.0	2	1	0
PRT	sp|Q9BW19|KIFC1_HUMAN	Kinesin-like protein KIFC1 OS=Homo sapiens OX=9606 GN=KIFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|O14530-2|TXND9_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.06	23.0	1	1	0
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P0DPB5|RPC22_HUMAN	Protein POLR1D, isoform 2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	23.0	2	2	2
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9BU64|CENPO_HUMAN	Centromere protein O OS=Homo sapiens OX=9606 GN=CENPO PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	3	2	1
PRT	sp|Q96RS6|NUDC1_HUMAN	NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9Y371|SHLB1_HUMAN	Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|O75486|SUPT3_HUMAN	Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.06	23.0	1	1	1
PRT	sp|Q04637-5|IF4G1_HUMAN	Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q58FF6|H90B4_HUMAN	Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens OX=9606 GN=HSP90AB4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9BRF8-3|CPPED_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase CPPED1 OS=Homo sapiens OX=9606 GN=CPPED1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,9-UNIMOD:35,10-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,6-UNIMOD:35,12-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,5-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q9NWU2|GID8_HUMAN	Glucose-induced degradation protein 8 homolog OS=Homo sapiens OX=9606 GN=GID8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|Q10567-4|AP1B1_HUMAN	Isoform 4 of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,4-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q12968-5|NFAC3_HUMAN	Isoform 5 of Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,6-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	23.0	1	1	0
PRT	sp|Q5BJH7|YIF1B_HUMAN	Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	23.0	1	1	0
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	0
PRT	sp|P53384|NUBP1_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.06	23.0	1	1	0
PRT	sp|O43324-2|MCA3_HUMAN	Isoform 2 of Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.08	22.0	1	1	1
PRT	sp|O75352-2|MPU1_HUMAN	Isoform 2 of Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens OX=9606 GN=MPDU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.02	22.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.05	22.0	3	1	0
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|P14854|CX6B1_HUMAN	Cytochrome c oxidase subunit 6B1 OS=Homo sapiens OX=9606 GN=COX6B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,5-UNIMOD:35	0.10	22.0	2	1	0
PRT	sp|Q9BXR0-2|TGT_HUMAN	Isoform 2 of Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.06	22.0	1	1	0
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|O60427|FADS1_HUMAN	Acyl-CoA (8-3)-desaturase OS=Homo sapiens OX=9606 GN=FADS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.07	22.0	2	1	0
PRT	sp|Q92620-2|PRP16_HUMAN	Isoform 2 of Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q8ND82|Z280C_HUMAN	Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q9Y6I4-2|UBP3_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,11-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	22.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q96EY9|ADAT3_HUMAN	Probable inactive tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens OX=9606 GN=ADAT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	2	2	2
PRT	sp|P78364|PHC1_HUMAN	Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q15036-2|SNX17_HUMAN	Isoform 2 of Sorting nexin-17 OS=Homo sapiens OX=9606 GN=SNX17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P20290-2|BTF3_HUMAN	Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,10-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.01	22.0	2	1	0
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35,5-UNIMOD:35,2-UNIMOD:1	0.09	22.0	6	2	0
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.09	22.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q6PL24|TMED8_HUMAN	Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|P62995|TRA2B_HUMAN	Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q9UMY4-3|SNX12_HUMAN	Isoform 3 of Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.06	22.0	1	1	1
PRT	sp|Q969E2-3|SCAM4_HUMAN	Isoform 3 of Secretory carrier-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=SCAMP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.09	22.0	2	1	0
PRT	sp|P63218|GBG5_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:35	0.16	22.0	2	1	0
PRT	sp|Q0VGL1|LTOR4_HUMAN	Ragulator complex protein LAMTOR4 OS=Homo sapiens OX=9606 GN=LAMTOR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.10	22.0	1	1	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	6-UNIMOD:4,9-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	22.0	1	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|P58557|YBEY_HUMAN	Endoribonuclease YbeY OS=Homo sapiens OX=9606 GN=YBEY PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|P49914|MTHFS_HUMAN	5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q96A65-2|EXOC4_HUMAN	Isoform 2 of Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q7Z406-5|MYH14_HUMAN	Isoform 5 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q9UK97-2|FBX9_HUMAN	Isoform 2 of F-box only protein 9 OS=Homo sapiens OX=9606 GN=FBXO9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,8-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9H8V3-2|ECT2_HUMAN	Isoform 2 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q9NQ66-2|PLCB1_HUMAN	Isoform B of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,14-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q5T447|HECD3_HUMAN	E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.09	21.0	1	1	1
PRT	sp|Q15208|STK38_HUMAN	Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:35,9-UNIMOD:4,12-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q8N4C6-6|NIN_HUMAN	Isoform 6 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|P52306-2|GDS1_HUMAN	Isoform 2 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|O14653-3|GOSR2_HUMAN	Isoform 3 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	2	1	0
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q8IY22|CMIP_HUMAN	C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q9UJY5-5|GGA1_HUMAN	Isoform 5 of ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.15	21.0	1	1	1
PRT	sp|P53990-2|IST1_HUMAN	Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null		0.03	21.0	4	1	0
PRT	sp|O60825-2|F262_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,5-UNIMOD:35	0.10	21.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.11	21.0	1	1	1
PRT	sp|Q16539-5|MK14_HUMAN	Isoform 5 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|P50151|GBG10_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 OS=Homo sapiens OX=9606 GN=GNG10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.16	21.0	1	1	1
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P20340-3|RAB6A_HUMAN	Isoform 3 of Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.12	21.0	1	1	1
PRT	sp|O14907|TX1B3_HUMAN	Tax1-binding protein 3 OS=Homo sapiens OX=9606 GN=TAX1BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.11	21.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.03	21.0	2	2	2
PRT	sp|Q9BQ15|SOSB1_HUMAN	SOSS complex subunit B1 OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q9UM13|APC10_HUMAN	Anaphase-promoting complex subunit 10 OS=Homo sapiens OX=9606 GN=ANAPC10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.07	21.0	1	1	1
PRT	sp|Q96S99|PKHF1_HUMAN	Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q13283-2|G3BP1_HUMAN	Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:35	0.10	21.0	1	1	1
PRT	sp|Q96H22|CENPN_HUMAN	Centromere protein N OS=Homo sapiens OX=9606 GN=CENPN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|P10155|RO60_HUMAN	60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.03	21.0	1	1	0
PRT	sp|Q6QNY1|BL1S2_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O14744-5|ANM5_HUMAN	Isoform 5 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,11-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,4-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|P49427|UB2R1_HUMAN	Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens OX=9606 GN=CDC34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|O75164|KDM4A_HUMAN	Lysine-specific demethylase 4A OS=Homo sapiens OX=9606 GN=KDM4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	2	1	0
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,11-UNIMOD:35	0.02	20.0	3	1	0
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,7-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q9NW64-2|RBM22_HUMAN	Isoform 2 of Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,2-UNIMOD:4,8-UNIMOD:4	0.05	20.0	2	2	2
PRT	sp|Q9Y421-2|FA32A_HUMAN	Isoform 2 of Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	20.0	1	1	1
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	20.0	1	1	1
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P58004|SESN2_HUMAN	Sestrin-2 OS=Homo sapiens OX=9606 GN=SESN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q96A57|TM230_HUMAN	Transmembrane protein 230 OS=Homo sapiens OX=9606 GN=TMEM230 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.13	20.0	1	1	1
PRT	sp|Q9NPA3|M1IP1_HUMAN	Mid1-interacting protein 1 OS=Homo sapiens OX=9606 GN=MID1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	0.06	20.0	2	1	0
PRT	sp|Q9UPQ3-3|AGAP1_HUMAN	Isoform 3 of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q8WWK9-5|CKAP2_HUMAN	Isoform 3 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,9-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9UL45-2|BL1S6_HUMAN	Isoform 2 of Biogenesis of lysosome-related organelles complex 1 subunit 6 OS=Homo sapiens OX=9606 GN=BLOC1S6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.18	20.0	1	1	1
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.06	20.0	2	2	2
PRT	sp|O95139-2|NDUB6_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.09	20.0	1	1	1
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	3-UNIMOD:1,3-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	0
PRT	sp|Q9UI09|NDUAC_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	20.0	1	1	0
PRT	sp|P00167|CYB5_HUMAN	Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.13	20.0	1	1	1
PRT	sp|Q99541|PLIN2_HUMAN	Perilipin-2 OS=Homo sapiens OX=9606 GN=PLIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.04	20.0	3	1	0
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	0
PRT	sp|Q8N8K9|K1958_HUMAN	Uncharacterized protein KIAA1958 OS=Homo sapiens OX=9606 GN=KIAA1958 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q9Y3C7|MED31_HUMAN	Mediator of RNA polymerase II transcription subunit 31 OS=Homo sapiens OX=9606 GN=MED31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:35	0.11	19.0	1	1	1
PRT	sp|Q9H9A5-4|CNO10_HUMAN	Isoform 4 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q7Z7C8|TAF8_HUMAN	Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|Q5BJH7-2|YIF1B_HUMAN	Isoform 2 of Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.06	19.0	2	1	0
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,10-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|O60493-3|SNX3_HUMAN	Isoform 3 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.08	19.0	1	1	1
PRT	sp|Q9NP97-2|DLRB1_HUMAN	Isoform 2 of Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.19	19.0	1	1	1
PRT	sp|Q8NC56|LEMD2_HUMAN	LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LEMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.07	19.0	1	1	1
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q8WTW3|COG1_HUMAN	Conserved oligomeric Golgi complex subunit 1 OS=Homo sapiens OX=9606 GN=COG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,5-UNIMOD:35,8-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q13418-2|ILK_HUMAN	Isoform 2 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|P60059|SC61G_HUMAN	Protein transport protein Sec61 subunit gamma OS=Homo sapiens OX=9606 GN=SEC61G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.18	19.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	0.12	19.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q9UI09-2|NDUAC_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	19.0	1	1	0
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q15758|AAAT_HUMAN	Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q6P4E1-3|GOLM2_HUMAN	Isoform 3 of Protein GOLM2 OS=Homo sapiens OX=9606 GN=GOLM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	3-UNIMOD:35,1-UNIMOD:35	0.10	19.0	9	3	2
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|P0CG35|TB15B_HUMAN	Thymosin beta-15B OS=Homo sapiens OX=9606 GN=TMSB15B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.24	19.0	1	1	0
PRT	sp|P08047-3|SP1_HUMAN	Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,8-UNIMOD:35,11-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q6P4A7-2|SFXN4_HUMAN	Isoform 2 of Sideroflexin-4 OS=Homo sapiens OX=9606 GN=SFXN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|O00401|WASL_HUMAN	Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	2	2	2
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|Q86WQ0|NR2CA_HUMAN	Nuclear receptor 2C2-associated protein OS=Homo sapiens OX=9606 GN=NR2C2AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:4	0.09	19.0	1	1	1
PRT	sp|O75190-2|DNJB6_HUMAN	Isoform B of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|P56134|ATPK_HUMAN	ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:4	0.16	19.0	1	1	0
PRT	sp|Q9BQC3|DPH2_HUMAN	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	19.0	1	1	0
PRT	sp|Q96BP3|PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	2	2	2
PRT	sp|Q8N668-2|COMD1_HUMAN	Isoform 2 of COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.06	18.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P35232-2|PHB_HUMAN	Isoform 2 of Prohibitin OS=Homo sapiens OX=9606 GN=PHB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.06	18.0	1	1	1
PRT	sp|Q9NRY2-2|SOSSC_HUMAN	Isoform 2 of SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.27	18.0	1	1	1
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q9NRG1-3|PRDC1_HUMAN	Isoform 3 of Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.07	18.0	1	1	1
PRT	sp|O14641|DVL2_HUMAN	Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P11766|ADHX_HUMAN	Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,8-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9NWA0|MED9_HUMAN	Mediator of RNA polymerase II transcription subunit 9 OS=Homo sapiens OX=9606 GN=MED9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.06	18.0	1	1	1
PRT	sp|Q14CB8-5|RHG19_HUMAN	Isoform 5 of Rho GTPase-activating protein 19 OS=Homo sapiens OX=9606 GN=ARHGAP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P10074|TZAP_HUMAN	Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P55327-2|TPD52_HUMAN	Isoform 2 of Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	18.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P24941-2|CDK2_HUMAN	Isoform 2 of Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P51790-4|CLCN3_HUMAN	Isoform 3 of H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens OX=9606 GN=CLCN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	5	1	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.02	18.0	2	2	2
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|Q9UPQ9-2|TNR6B_HUMAN	Isoform 3 of Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P35610|SOAT1_HUMAN	Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q5JPI3-2|CC038_HUMAN	Isoform 2 of Uncharacterized protein C3orf38 OS=Homo sapiens OX=9606 GN=C3orf38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	2	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|P17480|UBF1_HUMAN	Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|Q16254|E2F4_HUMAN	Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P43378|PTN9_HUMAN	Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens OX=9606 GN=PTPN9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	18.0	1	1	1
PRT	sp|Q8TBC3-2|SHKB1_HUMAN	Isoform 2 of SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 GN=SHKBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|O00443-2|P3C2A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q5VSY0-2|GKAP1_HUMAN	Isoform 2 of G kinase-anchoring protein 1 OS=Homo sapiens OX=9606 GN=GKAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q5SSJ5-5|HP1B3_HUMAN	Isoform 4 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.10	17.0	1	1	1
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|P19388|RPAB1_HUMAN	DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q9BS40|LXN_HUMAN	Latexin OS=Homo sapiens OX=9606 GN=LXN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:35,5-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q9ULR5|PAI2B_HUMAN	Polyadenylate-binding protein-interacting protein 2B OS=Homo sapiens OX=9606 GN=PAIP2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.11	17.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:35	0.17	17.0	1	1	1
PRT	sp|Q9Y6D0|SELK_HUMAN	Selenoprotein K OS=Homo sapiens OX=9606 GN=SELENOK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.13	17.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	17.0	1	1	0
PRT	sp|Q9NUI1|DECR2_HUMAN	Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,13-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P51817|PRKX_HUMAN	cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens OX=9606 GN=PRKX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q9P035|HACD3_HUMAN	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4,14-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.10	16.0	1	1	1
PRT	sp|Q5SRE7-2|PHYD1_HUMAN	Isoform 2 of Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHYHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,3-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|Q7Z7A4-2|PXK_HUMAN	Isoform 2 of PX domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=PXK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,10-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,8-UNIMOD:35	0.00	16.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.06	16.0	1	1	1
PRT	sp|Q8NG31-3|KNL1_HUMAN	Isoform 3 of Kinetochore scaffold 1 OS=Homo sapiens OX=9606 GN=KNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|O95551-3|TYDP2_HUMAN	Isoform 3 of Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	0.04	16.0	2	1	0
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9H7B4|SMYD3_HUMAN	Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q8N5J2|MINY1_HUMAN	Ubiquitin carboxyl-terminal hydrolase MINDY-1 OS=Homo sapiens OX=9606 GN=MINDY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q9H1Y0|ATG5_HUMAN	Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q15007-2|FL2D_HUMAN	Isoform 2 of Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	16.0	1	1	1
PRT	sp|Q9NPA8|ENY2_HUMAN	Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.08	16.0	1	1	1
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|O94782|UBP1_HUMAN	Ubiquitin carboxyl-terminal hydrolase 1 OS=Homo sapiens OX=9606 GN=USP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q9UBB6|NCDN_HUMAN	Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,3-UNIMOD:4,4-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.02	16.0	1	1	0
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,13-UNIMOD:35	0.07	16.0	1	1	0
PRT	sp|O14530|TXND9_HUMAN	Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.05	16.0	1	1	0
PRT	sp|P0CG34|TB15A_HUMAN	Thymosin beta-15A OS=Homo sapiens OX=9606 GN=TMSB15A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.24	16.0	1	1	0
PRT	sp|O43660|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q8NBZ0|IN80E_HUMAN	INO80 complex subunit E OS=Homo sapiens OX=9606 GN=INO80E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	16.0	1	1	1
PRT	sp|Q96GV9|MACIR_HUMAN	Macrophage immunometabolism regulator OS=Homo sapiens OX=9606 GN=MACIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	77-UNIMOD:4	0.08	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AETLSGLGDSGAAGAAALSSASSETGTR	1	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69	1-UNIMOD:1	ms_run[2]:scan=8541	33.381	2	2536.1889	2536.1889	M	R	2	30
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	2	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	66	1-UNIMOD:1	ms_run[1]:scan=7524	30.679282322933332	4	5340.4322	5340.4224	M	R	2	70
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	3	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63	1-UNIMOD:1	ms_run[2]:scan=7298	30.075	3	2428.1102	2428.1102	M	R	2	32
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	4	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	1-UNIMOD:1	ms_run[2]:scan=8250	32.577	3	3105.3912	3105.3912	M	R	2	37
PSM	AETLPGSGDSGPGTASLGPGVAETGTR	5	sp|Q14151-2|SAFB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	1-UNIMOD:1	ms_run[2]:scan=7603	30.893	2	2483.1776	2483.1776	M	R	2	29
PSM	AAADGGGPGGASVGTEEDGGGVGH	6	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	55	1-UNIMOD:1	ms_run[1]:scan=6207	26.533084556	2	2022.8560	2022.8510	M	R	2	26
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	7	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	55	1-UNIMOD:1	ms_run[1]:scan=7437	30.444312596	4	4385.0614	4385.0526	M	K	2	52
PSM	AAAAAAGPSPGSGPGDSPEGPEGEAPER	8	sp|Q9UID3|VPS51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1	ms_run[2]:scan=6485	27.54	3	2530.1208	2530.1208	M	R	2	30
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	9	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1	ms_run[2]:scan=7028	29.313	3	2679.3253	2679.3253	M	R	2	31
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	10	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	1-UNIMOD:1	ms_run[2]:scan=6941	29.038	3	2664.1861	2664.1861	M	R	2	29
PSM	ADDQGCIEEQGVEDSANEDSVDAKPD	11	sp|P55210-2|CASP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6929	29	3	2834.1308	2834.1308	M	R	2	28
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	12	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	1-UNIMOD:1,24-UNIMOD:35	ms_run[2]:scan=6314	26.913	3	2680.181	2680.1810	M	R	2	29
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	13	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1	ms_run[2]:scan=6501	27.596	3	2984.3999	2984.3999	M	K	2	34
PSM	ADEEEDPTFEEENEEIGGGAEGGQGK	14	sp|Q15543|TAF13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1	ms_run[2]:scan=7387	30.31	3	2764.1108	2764.1108	M	R	2	28
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	15	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=7558	30.76	2	2001.9392	2001.9392	M	R	2	27
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	16	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=7567	30.786	2	2001.9392	2001.9392	M	R	2	27
PSM	ADVEDGEETCALASHSGSSGS	17	sp|Q9UBF6-3|RBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=6807	28.63	2	2106.8284	2106.8284	M	K	2	23
PSM	AGVEEVAASGSHLNGDLDPDD	18	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=8239	32.552	2	2108.9134	2108.9134	M	R	2	23
PSM	SQGDSNPAAIPHAAEDIQGDD	19	sp|P68402-3|PA1B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=7097	29.518	2	2148.9196	2148.9196	M	R	2	23
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	20	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=8101	32.203	3	3231.2948	3231.2948	M	K	2	32
PSM	AASGAVEPGPPGAAVAPSPAPAPPPAPDHLF	21	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:1	ms_run[2]:scan=8909	34.362	3	2854.429	2854.4290	M	R	2	33
PSM	AAAAASGAGGAAGAGTGGAGPAG	22	sp|Q9Y2K2-7|SIK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=6404	27.246	2	1639.755	1639.7550	M	R	2	25
PSM	AAALGASGGAGAGDDDFDQFDKPGAE	23	sp|Q96EV2-2|RBM33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=8431	33.078	2	2451.0462	2451.0462	M	R	2	28
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	24	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=7572	30.798	3	2001.9392	2001.9392	M	R	2	27
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGT	25	sp|O95197-6|RTN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1,33-UNIMOD:4	ms_run[2]:scan=7725	31.213	3	3483.5485	3483.5485	M	K	2	40
PSM	ATATIALGTDSIKMENGQSTAA	26	sp|Q9UHX1-6|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=7942	31.79	2	2208.058	2208.0580	M	K	2	24
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	27	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=7306	30.091	3	3089.3751	3089.3751	M	R	2	40
PSM	SEHVEPAAPGPGPNGGGGGPAPA	28	sp|Q4ZIN3-2|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=6361	27.068	2	2020.9239	2020.9239	M	R	2	25
PSM	AAAAAAAAAAGAAGGRGSGPG	29	sp|Q86U42-2|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=7791	31.38	2	1594.7812	1594.7812	M	R	2	23
PSM	AAPAGGGGSAVSVLAPNGR	30	sp|Q9BZE9|ASPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=7375	30.277	2	1649.8485	1649.8485	M	R	2	21
PSM	MEGGLADGEPDRTSLLGDS	31	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7892	31.639	2	1976.8633	1976.8633	-	K	1	20
PSM	METDAPQPGLASPDSPHDPC	32	sp|O43347|MSI1H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6705	28.276	2	2178.8834	2178.8834	-	K	1	21
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	33	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=7176	29.75	3	2679.3253	2679.3253	M	R	2	31
PSM	SETAPAAPAAAPPAEKAPV	34	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=6637	28.041	2	1786.9101	1786.9101	M	K	2	21
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGGR	35	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7517	30.663	3	2868.3348	2868.3348	-	R	1	32
PSM	MEERGDSEPTPGCSGLGPGGV	36	sp|Q8WW01-2|SEN15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=7064	29.413	2	2145.8943	2145.8943	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	37	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=7925	31.73	2	2456.0326	2456.0326	-	R	1	22
PSM	AEASAAGADSGAAVAAH	38	sp|Q9Y4L5|RN115_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=6121	26.203	2	1467.659	1467.6590	M	R	2	19
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPK	39	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=8854	34.228	3	3424.4954	3424.4954	M	K	2	32
PSM	ALDGPEQMELEEGKAGSGL	40	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=8187	32.416	2	1987.9045	1987.9045	M	R	2	21
PSM	MEDLDQSPLVSSSDSPPRPQPAF	41	sp|Q9NQC3-2|RTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8595	33.531	3	2557.1642	2557.1642	-	K	1	24
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	42	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7327	30.143	2	2498.0966	2498.0966	-	R	1	28
PSM	ASGVAVSDGVIKVFNDM	43	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=8943	34.43827765013334	2	1765.8575	1765.8551	M	K	2	19
PSM	METEQPEETFPNTETNGEFGK	44	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7416	30.39211507306667	2	2472.024117	2472.027481	-	R	1	22
PSM	AAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGA	45	sp|Q9NR33|DPOE4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=7039	29.345	3	3173.4861	3173.4861	M	R	2	37
PSM	AFAETYPAASSLPNGDCGRP	46	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=8275	32.637	2	2121.9426	2121.9426	M	R	2	22
PSM	ALDGPEQMELEEGKAGSGL	47	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=8711	33.834	2	1971.9095	1971.9095	M	R	2	21
PSM	ASSAQSGGSSGGPAVPTVQ	48	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=6864	28.815	2	1685.7857	1685.7857	M	R	2	21
PSM	ATQADLMELDMAMEPDR	49	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,7-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7905	31.677	2	2025.8329	2025.8329	M	K	2	19
PSM	ATTGTPTADRGDAAATDDPAA	50	sp|Q86TI2-4|DPP9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=6119	26.192	2	1986.8767	1986.8767	M	R	2	23
PSM	MDPNCSCSPVGSCACAGSC	51	sp|P80297|MT1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=6446	27.4	2	2133.6989	2133.6989	-	K	1	20
PSM	MEENDPKPGEAAAAVEGQ	52	sp|P19622|HME2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6460	27.449	2	1899.8156	1899.8156	-	R	1	19
PSM	SASAPAAEGEGTPTQPASE	53	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=6203	26.514	2	1798.7857	1798.7857	M	K	2	21
PSM	METEQPEETFPNTETNGEFGK	54	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9246	35.27684497653333	2	2473.030338	2472.027481	-	R	1	22
PSM	AEPDYIEDDNPELIRPQ	55	sp|Q9H098|F107B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=8376	32.898	2	2054.9433	2054.9433	M	K	2	19
PSM	ASGVAVSDGVIKVFNDM	56	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=8789	34.073	2	1765.8557	1765.8557	M	K	2	19
PSM	ASSVGNVADSTGLAELAH	57	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=8639	33.643	2	1739.8326	1739.8326	M	R	2	20
PSM	ASYFDEHDCEPSDPEQET	58	sp|Q9P0P0|RN181_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=7667	31.06	2	2196.8066	2196.8066	M	R	2	20
PSM	ATDSGDPASTEDSEKPDGISFEN	59	sp|Q9BYP7-3|WNK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=7417	30.396	2	2409.9932	2409.9932	M	R	2	25
PSM	MDLQAAGAQAQGAAEPSRGPPLPSA	60	sp|Q9NQ92|COPRS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7512	30.652	3	2448.1703	2448.1703	-	R	1	26
PSM	MEDSEALGFEHMGLDP	61	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=8309	32.724	2	1850.7339	1850.7339	-	R	1	17
PSM	MEPTAPSLTEEDLTEVK	62	sp|O95999|BCL10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8074	32.113	2	1946.9031	1946.9031	-	K	1	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	63	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=7445	30.467	3	3089.3751	3089.3751	M	R	2	40
PSM	METEQPEETFPNTETNGEFGK	64	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9291	35.42401919226666	2	2473.030338	2472.027481	-	R	1	22
PSM	AQEEEDVRDYNLTEEQ	65	sp|Q8IWT0|ARCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=7384	30.3015031168	2	2008.8542	2008.8492	M	K	2	18
PSM	AMNYNAKDEVDGGPPCAPGGTA	66	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,2-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=6659	28.098	2	2248.9365	2248.9365	M	K	2	24
PSM	AQESPKNSAAEIPVTSNGEVDDS	67	sp|P53367-3|ARFP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=6823	28.688	2	2386.0772	2386.0772	M	R	2	25
PSM	SGGGVIRGPAGNNDC	68	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=6248	26.681	2	1471.6474	1471.6474	M	R	2	17
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	69	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,48-UNIMOD:35	ms_run[2]:scan=7944	31.795	3	4211.9149	4211.9149	M	R	2	50
PSM	METEQPEETFPNTETNGEFGK	70	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7957	31.82887201733333	2	2473.049044	2472.027481	-	R	1	22
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	71	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=8330	32.784	3	3215.2999	3215.2999	M	K	2	32
PSM	AAPEEHDSPTEASQPIVEEEET	72	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=6963	29.101	2	2436.0452	2436.0452	M	K	2	24
PSM	ADEEEDPTFEEENEEIGGGAEGGQGK	73	sp|Q15543|TAF13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=7393	30.328	3	2764.1108	2764.1108	M	R	2	28
PSM	ASQSQGIQQLLQAEK	74	sp|O95670-2|VATG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=8600	33.54	2	1669.8635	1669.8635	M	R	2	17
PSM	MDEMATTQISKDELDEL	75	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=8415	33.023	2	2041.8708	2041.8708	-	K	1	18
PSM	MEEVPHDCPGADSAQAG	76	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6130	26.234	2	1827.704	1827.7040	-	R	1	18
PSM	MEFPDLGAHCSEPSCQ	77	sp|Q8WV99-2|ZFN2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7736	31.239	2	1921.7281	1921.7281	-	R	1	17
PSM	MEGGPAVCCQDPRAELVE	78	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7339	30.182	2	2074.8758	2074.8758	-	R	1	19
PSM	MELEDGVVYQEEPGGSGAVMSE	79	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=8386	32.933	2	2385.9828	2385.9828	-	R	1	23
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	80	sp|Q8WUH6|TM263_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=7452	30.483	3	2838.196	2838.1960	-	K	1	25
PSM	SEGNAAGEPSTPGGPRPLLTGA	81	sp|P05423|RPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=7529	30.69	2	2077.0076	2077.0076	M	R	2	24
PSM	SGEENPASKPTPVQDVQGDG	82	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=6341	27.007	2	2052.9236	2052.9236	M	R	2	22
PSM	MEGGLADGEPDRTSLLGDS	83	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7902	31.6677565288	2	1976.866489	1976.863316	-	K	1	20
PSM	ADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQ	84	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1	ms_run[1]:scan=8022	32.00212094213334	4	4972.3732	4972.3632	M	R	2	58
PSM	AADISESSGADCKGDP	85	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6265	26.732	2	1620.6573	1620.6573	M	R	2	18
PSM	ADDAGAAGGPGGPGGPGMGN	86	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=6151	26.316	2	1639.6533	1639.6533	M	R	2	22
PSM	ADGGAASQDESSAAAAAAADS	87	sp|P14859-5|PO2F1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6841	28.741	2	1834.7453	1834.7453	M	R	2	23
PSM	METEQPEETFPNTETNGEFGK	88	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9410	35.821	2	2472.0275	2472.0275	-	R	1	22
PSM	MMCGAPSATQPATAETQHIADQV	89	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=7348	30.21	2	2488.0669	2488.0669	-	R	1	24
PSM	MVEKEEAGGGISEEEAAQYD	90	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6999	29.219	2	2198.9161	2198.9161	-	R	1	21
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	91	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=7813	31.434	3	3008.4098	3008.4098	M	K	2	33
PSM	SNNGLDIQDKPPAPPM	92	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=7077	29.453	2	1750.8196	1750.8196	M	R	2	18
PSM	SSSGLNSEKVAALIQ	93	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=8403	32.982	2	1544.8046	1544.8046	M	K	2	17
PSM	STATTVAPAGIPATPGPVNPPPPEVSNPSKPG	94	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=7656	31.027	3	3046.5611	3046.5611	M	R	2	34
PSM	SVAGGEIRGDTGGEDTAAPG	95	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6491	27.558	2	1857.8341	1857.8341	M	R	2	22
PSM	AAAAAATAAAAASIRE	96	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=8818	34.146	2	1427.7369	1427.7369	M	R	2	18
PSM	AAAMDVDTPSGTNSGAGK	97	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=5876	25.197	2	1706.7417	1706.7417	M	K	2	20
PSM	AATASAGAGGIDGKP	98	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=6175	26.402	2	1284.631	1284.6310	M	R	2	17
PSM	AAVAVAVREDSGSGM	99	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,15-UNIMOD:35	ms_run[2]:scan=7738	31.245	2	1476.6879	1476.6879	M	K	2	17
PSM	ADTTPNGPQGAGAVQFMMTN	100	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=7407	30.365	2	2080.883	2080.8830	M	K	2	22
PSM	AGGGAGDPGLGAAAAPAPET	101	sp|Q13637|RAB32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=7278	30.036	2	1648.7693	1648.7693	M	R	2	22
PSM	AGVGDAAAPGEGGGGGVDGPQRDG	102	sp|Q6NXT6-2|TAPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=6380	27.149	2	2064.9097	2064.9097	M	R	2	26
PSM	ASSVGNVADSTEPTK	103	sp|O15294|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=6312	26.907	2	1503.7053	1503.7053	M	R	2	17
PSM	ATPYVTDETGGKYIASTQ	104	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=7479	30.56	2	1942.916	1942.9160	M	R	2	20
PSM	GPPGPALPATMNNSSSET	105	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=6438	27.375	2	1742.7781	1742.7781	M	R	2	20
PSM	MDEPSPLAQPLELNQHS	106	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8325	32.769	2	1962.8993	1962.8993	-	R	1	18
PSM	MDEQAGPGVFFSNNHPGAGGA	107	sp|O43815-2|STRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8371	32.882	2	2116.8909	2116.8909	-	K	1	22
PSM	MDGEEKTYGGCEGPDAMYV	108	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7128	29.615	2	2181.8177	2181.8177	-	K	1	20
PSM	SETAPAAPAAPAPAEKTPV	109	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=6612	27.953	2	1816.9207	1816.9207	M	K	2	21
PSM	SVELEEALPVTTAEGMAK	110	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=8736	33.91	2	1931.9398	1931.9398	M	K	2	20
PSM	METEQPEETFPNTETNGEFGK	111	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7610	30.914867730399997	2	2472.024117	2472.027481	-	R	1	22
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	112	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=7563	30.773225210933333	4	4385.0614	4385.0526	M	K	2	52
PSM	AGAGPAPGLPGAGGPVVPGPGAGIPGKSGEE	113	sp|Q9BTD8|RBM42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=8142	32.29770017013333	3	2619.3344	2619.3288	M	R	2	33
PSM	ADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQ	114	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=8035	32.033081142133334	4	4972.3732	4972.3632	M	R	2	58
PSM	AAQIPIVATTSTPGIVRNS	115	sp|Q6PI98|IN80C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=8564	33.438	2	1937.0582	1937.0582	M	K	2	21
PSM	AATASAGAGGIDGKP	116	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6279	26.776	2	1284.631	1284.6310	M	R	2	17
PSM	ADEAALALQPGGSPSAAGAD	117	sp|Q96EB6-2|SIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=8509	33.305	2	1809.8381	1809.8381	M	R	2	22
PSM	AEASSANLGSGCEE	118	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6513	27.623	2	1422.5569	1422.5569	M	K	2	16
PSM	AGAGSAAVSGAGTPVAGPTG	119	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6962	29.098	2	1596.7744	1596.7744	M	R	2	22
PSM	ATQADLMELDMAMEPDR	120	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=8418	33.032	2	2009.838	2009.8380	M	K	2	19
PSM	GDPERPEAAGLDQDE	121	sp|Q7LG56-5|RIR2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6526	27.658	2	1639.6962	1639.6962	M	R	2	17
PSM	MDLAAAAEPGAGSQHLEV	122	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8064	32.091	2	1823.836	1823.8360	-	R	1	19
PSM	MEPLQQQQQQQQQQQ	123	sp|Q8IVW6-3|ARI3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6178	26.413	2	1954.8803	1954.8803	-	K	1	16
PSM	MESMAVATDGGERPGVPAGSGLSASQ	124	sp|P49069|CAMLG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6764	28.485	3	2535.1217	2535.1217	-	R	1	27
PSM	MHSLATAAPVPTTLAQVD	125	sp|Q92600-3|CNOT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8195	32.434	2	1879.935	1879.9350	-	R	1	19
PSM	SAEVPEAASAEEQKEMED	126	sp|P56211|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=6656	28.087	2	2006.8263	2006.8263	M	K	2	20
PSM	SDAAVDTSSEITTKDL	127	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=7568	30.787	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	128	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=7997	31.938	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	129	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=8442	33.112	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	130	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=9687	36.829	2	1693.7894	1693.7894	M	K	2	18
PSM	SEHVEPAAPGPGPNGGGGGPAPA	131	sp|Q4ZIN3-2|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6428	27.338	2	2020.9239	2020.9239	M	R	2	25
PSM	SETAPAAPAAAPPAE	132	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6511	27.62	2	1391.6569	1391.6569	M	K	2	17
PSM	SGDGATEQAAEYVPEKV	133	sp|Q12996-3|CSTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=7469	30.528	2	1791.8163	1791.8163	M	K	2	19
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	134	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,48-UNIMOD:35	ms_run[2]:scan=7938	31.779	4	4211.9149	4211.9149	M	R	2	50
PSM	SSDASQGVITTPPPPSMPH	135	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=6728	28.372	2	1962.8993	1962.8993	M	K	2	21
PSM	SVATGSSETAGGASGGGA	136	sp|Q8TAE6|PP14C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=5962	25.558	2	1464.6328	1464.6328	M	R	2	20
PSM	ADGAAAGAGGSPSL	137	sp|Q8IWC1|MA7D3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=7276	30.03146321706667	2	1142.5209	1142.5199	M	R	3	17
PSM	MEGSEPVAAHQGEEASCSSWGTGSTN	138	sp|A0AVT1|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:1,1-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=6709	28.291306232266667	3	2723.069933	2723.071154	-	K	1	27
PSM	MNGTLDHPDQPDLDAI	139	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8139	32.2906172464	2	1809.794444	1808.788694	-	K	1	17
PSM	AAAAPAAAAASSEAPAASATAEPEAGDQDS	140	sp|Q15283-2|RASA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=7073	29.438	3	2668.1736	2668.1736	M	R	2	32
PSM	AAAEAANCIMEVSCGQAESSE	141	sp|Q99873-5|ANM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=8697	33.805	2	2241.8824	2241.8824	M	K	2	23
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	142	sp|Q9UBL3|ASH2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,31-UNIMOD:35	ms_run[2]:scan=7208	29.842	3	2680.1671	2680.1671	M	K	2	33
PSM	AAATGAVAASAASGQAEG	143	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=7027	29.311	2	1501.7009	1501.7009	M	K	2	20
PSM	AEAEESPGDPGTASP	144	sp|Q96EC8-2|YIPF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6416	27.291	2	1455.6001	1455.6001	M	R	2	17
PSM	AEASSANLGSGCEEK	145	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6015	25.765	2	1550.6519	1550.6519	M	R	2	17
PSM	AEQEPTAEQLAQIAAENEEDEHSVNY	146	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8899	34.339	3	2956.2846	2956.2846	M	K	2	28
PSM	AESSESFTMASSPAQR	147	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6536	27.689	2	1742.7417	1742.7417	M	R	2	18
PSM	ANDSGGPGGPSPSE	148	sp|Q9GZT9-3|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5850	25.083	2	1269.5109	1269.5109	M	R	2	16
PSM	ANSTAVVKIPGTPGAGG	149	sp|Q16514-2|TAF12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=7628	30.953	2	1537.81	1537.8100	M	R	2	19
PSM	AQESPKNSAAEIPVTSNGEVDDS	150	sp|P53367-3|ARFP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6842	28.743	2	2386.0772	2386.0772	M	R	2	25
PSM	CQVGEDYGEPAPEEPPPAPRPS	151	sp|Q2VPK5-5|CTU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=7012	29.263	2	2420.0591	2420.0591	M	R	2	24
PSM	DDDIAALVVDNGSGMC	152	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9387	35.745	2	1708.692	1708.6920	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	153	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=7623	30.942	2	1910.8494	1910.8494	M	K	2	24
PSM	MDPNCSCAAGDSCTCAGSC	154	sp|P02795|MT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5905	25.333	2	2137.6574	2137.6574	-	K	1	20
PSM	MEATLEQHLEDTM	155	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7721	31.207	2	1620.6647	1620.6647	-	K	1	14
PSM	MEEVPHDCPGADSAQAG	156	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=6836	28.728	2	1811.7091	1811.7091	-	R	1	18
PSM	MEGGPAVCCQDPRAELVE	157	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7349	30.212	2	2074.8758	2074.8758	-	R	1	19
PSM	METEQPEETFPNTETNGEFGK	158	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9339	35.583	2	2472.0275	2472.0275	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	159	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9373	35.699	2	2472.0275	2472.0275	-	R	1	22
PSM	SDAAVDTSSEITTKDL	160	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8149	32.318	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	161	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8299	32.701	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	162	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8620	33.588	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	163	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8754	33.963	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	164	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8927	34.408	2	1693.7894	1693.7894	M	K	2	18
PSM	SETAPAAPAAPAPAE	165	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=6147	26.303454728000002	2	1391.6573	1391.6564	M	K	2	17
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	166	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=7630	30.958509122666666	3	3089.3812	3089.3746	M	R	2	40
PSM	DDDIAALVVDNGSGMC	167	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9596	36.44674965466667	2	1708.6934	1708.6915	M	K	2	18
PSM	METEQPEETFPNTETNGEFGK	168	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7556	30.758373054666666	3	2472.025526	2472.027481	-	R	1	22
PSM	AAAAMAAAAGGGAGAA	169	sp|Q9NX46|ADPRS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=6834	28.722	2	1216.5506	1216.5506	M	R	2	18
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQG	170	sp|P45985|MP2K4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,36-UNIMOD:35	ms_run[2]:scan=6360	27.063	3	3172.4116	3172.4116	M	K	2	40
PSM	ADLDSPPKLSGVQQPSEGVGGG	171	sp|Q9H9E3-2|COG4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=7616	30.927	2	2136.0335	2136.0335	M	R	2	24
PSM	ADTTPNGPQGAGAVQFMMTN	172	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=8488	33.241	2	2064.8881	2064.8881	M	K	2	22
PSM	AENSESLGTVPEHE	173	sp|Q8TAG9|EXOC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6654	28.08	2	1539.6689	1539.6689	M	R	2	16
PSM	AESSESFTMASSPAQ	174	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6994	29.204	2	1586.6406	1586.6406	M	R	2	17
PSM	AGQDPALSTSHPFYDVA	175	sp|P85298-2|RHG08_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=8613	33.571	2	1816.8268	1816.8268	M	R	2	19
PSM	AHSPVQSGLPGMQNL	176	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7438	30.447	2	1592.7617	1592.7617	M	K	2	17
PSM	ASGADSKGDDLSTAIL	177	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=8304	32.713	2	1561.7471	1561.7471	M	K	2	18
PSM	DDDIAALVVDNGSGMC	178	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9283	35.406	2	1708.692	1708.6920	M	K	2	18
PSM	METGTAPLVAPPR	179	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7010	29.253	2	1396.7021	1396.7021	-	R	1	14
PSM	MEVMEGPLNLAHQQS	180	sp|Q96F24-2|NRBF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=7592	30.853	2	1756.776	1756.7760	-	R	1	16
PSM	MEVSPLQPVNENMQVN	181	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7845	31.52	2	1901.8499	1901.8499	-	K	1	17
PSM	MNPIVVVHGGGAGPIS	182	sp|Q7L266|ASGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7910	31.69	2	1561.7923	1561.7923	-	K	1	17
PSM	MNVGVAHSEVNPNT	183	sp|Q9P0S3|ORML1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6183	26.43	2	1525.6831	1525.6831	-	R	1	15
PSM	PGLVDSNPAPPESQE	184	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6546	27.726	2	1535.7104	1535.7104	M	K	2	17
PSM	SDAAVDTSSEITTKDL	185	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=7853	31.547	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	186	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9181	35.078	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	187	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9286	35.415	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	188	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9392	35.759	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	189	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9523	36.153	2	1693.7894	1693.7894	M	K	2	18
PSM	SSDASQGVITTPPPPSMPH	190	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=7496	30.607	2	1946.9044	1946.9044	M	K	2	21
PSM	SSEMLPAFIETSNVDK	191	sp|Q8TBZ6|TM10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=8717	33.85	2	1824.8451	1824.8451	M	K	2	18
PSM	SDEFSLADALPEHSPA	192	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=8928	34.40909652533333	2	1726.7716	1726.7681	M	K	2	18
PSM	AAAADSFSGGPAGV	193	sp|Q96E14|RMI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=8457	33.151	2	1218.5517	1218.5517	M	R	2	16
PSM	AALGHLAGEAAAAPGPGTPCAS	194	sp|Q9H7E9|CH033_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,20-UNIMOD:4	ms_run[2]:scan=8138	32.288	3	1987.9422	1987.9422	M	R	2	24
PSM	AEGTAEAPLENGGGGDSGAGALE	195	sp|Q96G46-3|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=7798	31.402	2	2070.8978	2070.8978	M	R	2	25
PSM	AGGEAGVTLGQPHLS	196	sp|Q2VIR3-2|IF2GL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=7468	30.525	2	1434.7103	1434.7103	M	R	2	17
PSM	ATSATSPHAPGFPAEG	197	sp|Q9NUP7-2|TRM13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=7154	29.688	2	1538.7001	1538.7001	M	R	2	18
PSM	DDDIAALVVDNGSGMC	198	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9094	34.786	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	199	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9420	35.851	2	1764.7546	1764.7546	M	K	2	18
PSM	MAPSVPAAEPEYPKGI	200	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7824	31.455	2	1713.8284	1713.8284	-	R	1	17
PSM	MDGEEQQPPHEANVEPVVPSEASEPVP	201	sp|Q9H4I3-2|TRABD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7591	30.849	3	2955.308	2955.3080	-	R	1	28
PSM	MEAAVGVPDGGDQGGAGP	202	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7193	29.8	2	1641.6941	1641.6941	-	R	1	19
PSM	MEPAVSEPMRDQVA	203	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6918	28.975	2	1616.7174	1616.7174	-	R	1	15
PSM	MEQPGAAASGAGGGSEEPGGG	204	sp|O60879-2|DIAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6013	25.756	2	1830.7326	1830.7326	-	R	1	22
PSM	MLEAPGPSDGCELSNPSAS	205	sp|Q9UNI6|DUS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=7784	31.361	2	1975.8139	1975.8139	-	R	1	20
PSM	MMADEEEEVKPILQ	206	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=7575	30.807	2	1734.7692	1734.7692	-	K	1	15
PSM	PEIVDTCSLASPASVC	207	sp|P09960-2|LKHA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=7713	31.186	2	1704.7699	1704.7699	M	R	2	18
PSM	SDAAVDTSSEITTKDL	208	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=7700	31.152	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	209	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=9080	34.742	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	210	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=9607	36.494	2	1693.7894	1693.7894	M	K	2	18
PSM	SDEFSLADALPEHSPA	211	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=8938	34.43	2	1726.7686	1726.7686	M	K	2	18
PSM	SQAPGAQPSPPTVYHE	212	sp|Q8TAC2-2|JOS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=6700	28.25	2	1706.79	1706.7900	M	R	2	18
PSM	SYGRPPPDVEGMTSL	213	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7357	30.238	2	1662.7559	1662.7559	M	K	2	17
PSM	AADISESSGADCKGD	214	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=6104	26.123428869333335	2	1523.6052	1523.6041	M	P	2	17
PSM	METEQPEETFPNTETNGEFGK	215	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9071	34.71716560906667	2	2474.032973	2472.027481	-	R	1	22
PSM	AAATGAVAASAASGQAEGK	216	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=6602	27.9294376936	2	1629.8005	1629.7953	M	K	2	21
PSM	SDQEAKPSTEDLGD	217	sp|P63165|SUMO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=6127	26.22382199946667	2	1532.6495	1532.6473	M	K	2	16
PSM	AESGESGGPPGSQDSAAGAEGAGAPAAAASAEP	218	sp|Q9UMX0|UBQL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=6885	28.8712732816	3	2823.2117	2823.2062	M	K	2	35
PSM	AAAYLDPNLNHTPNSST	219	sp|Q05397-7|FAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=8177	32.392	2	1826.8435	1826.8435	M	K	2	19
PSM	AAPAQQTTQPGGGK	220	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5460	23.266	2	1352.6684	1352.6684	M	R	2	16
PSM	AAVQAAEVKVDGSEP	221	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7475	30.547	2	1511.7468	1511.7468	M	K	2	17
PSM	ADLEEQLSDEEKV	222	sp|P47755-2|CAZA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=8558	33.426	2	1545.7046	1545.7046	M	R	2	15
PSM	AGSYPEGAPAILADK	223	sp|Q6P1Q9|MET2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=8116	32.239	2	1500.746	1500.7460	M	R	2	17
PSM	AGVEEVAASGSHLNGDLDPDD	224	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=8216	32.485	2	2108.9134	2108.9134	M	R	2	23
PSM	ATGANATPLDFPSK	225	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7855	31.551	2	1430.7042	1430.7042	M	K	2	16
PSM	AVAVGRPSNEEL	226	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7273	30.024	2	1282.6517	1282.6517	M	R	2	14
PSM	DDDIAALVVDNGSGMC	227	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=8679	33.754	2	1666.6815	1666.6815	M	K	2	18
PSM	DDDIAALVVDNGSGMC	228	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9212	35.17	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	229	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9318	35.513	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	230	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9100	34.808	2	1764.7546	1764.7546	M	K	2	18
PSM	MDFEDDYTHSAC	231	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=8349	32.831	2	1531.5232	1531.5232	-	R	1	13
PSM	MDSGGGSLGLHTPDS	232	sp|Q9Y462|ZN711_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6935	29.019	2	1487.6198	1487.6198	-	R	1	16
PSM	MDSVEKGAATSVSNP	233	sp|Q8NFW8-2|NEUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6266	26.736	2	1549.693	1549.6930	-	R	1	16
PSM	MEDLVQDGVASPATPGTG	234	sp|Q8IWJ2-3|GCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7904	31.673	2	1801.804	1801.8040	-	K	1	19
PSM	MEQSPPPAPEPTQGPTPA	235	sp|Q96AY4|TTC28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6683	28.191	2	1888.8513	1888.8513	-	R	1	19
PSM	METEQPEETFPNTETNGEFGK	236	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=8106	32.215	2	2456.0326	2456.0326	-	R	1	22
PSM	MTTDEGAKNNEESPTATVAEQGEDITS	237	sp|Q13451-2|FKBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6855	28.785	3	2882.2247	2882.2247	-	K	1	28
PSM	SAEVETSEGVDESEK	238	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=6213	26.559	2	1636.6952	1636.6952	M	K	2	17
PSM	SCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAEN	239	sp|Q12962|TAF10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=7856	31.552	3	3587.6322	3587.6322	M	K	2	42
PSM	SLQVLNDKNVSNE	240	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7647	30.998	2	1500.742	1500.7420	M	K	2	15
PSM	DDDIAALVVDNGSGMC	241	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9754	37.12056196186666	2	1708.6916	1708.6915	M	K	2	18
PSM	DDDIAALVVDNGSGMC	242	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9676	36.78231003573333	2	1708.6934	1708.6915	M	K	2	18
PSM	STASSSSSSSSSQTPHPPSQ	243	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=5666	24.260620403466664	2	1975.8472	1974.8402	M	R	2	22
PSM	EEEIAALVIDNGSGMC	244	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9330	35.55294303786666	2	1765.7572	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	245	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9213	35.17253969146667	2	1765.7592	1764.7542	M	K	2	18
PSM	AAAAAAAAAAGAAGG	246	sp|Q86U42-2|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=8523	33.346	2	1083.5309	1083.5309	M	R	2	17
PSM	AAAMVPGRSESWE	247	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7182	29.768	2	1447.6402	1447.6402	M	R	2	15
PSM	AAAMVPGRSESWE	248	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7996	31.936	2	1431.6453	1431.6453	M	R	2	15
PSM	AADISESSGADCKGDP	249	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6359	27.06	2	1620.6573	1620.6573	M	R	2	18
PSM	AASAAAASAAAASAASGSPGPGEGSAGGE	250	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7914	31.698	3	2300.0153	2300.0153	M	K	2	31
PSM	AAVPELLQQQEEDRS	251	sp|Q9Y5X3-2|SNX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=8681	33.758	2	1753.8483	1753.8483	M	K	2	17
PSM	AAVQAAEVKVDGSEP	252	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7490	30.596	2	1511.7468	1511.7468	M	K	2	17
PSM	AGSGAGVRCSLL	253	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=7781	31.352	2	1188.5921	1188.5921	M	R	2	14
PSM	MDELAGGGGGGPGMAAPP	254	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=7173	29.743	2	1614.6654	1614.6654	-	R	1	19
PSM	MDSAGQDINLNSPN	255	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7954	31.821	2	1516.6464	1516.6464	-	K	1	15
PSM	MDSTLTASEIRQ	256	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6754	28.455	2	1408.6504	1408.6504	-	R	1	13
PSM	MEDSQDLNEQSVK	257	sp|O95677-3|EYA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6048	25.897	2	1579.6672	1579.6672	-	K	1	14
PSM	MEEEQDLPEQPVK	258	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6610	27.949	2	1628.724	1628.7240	-	K	1	14
PSM	MEQEPQNGEPAEIKII	259	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8319	32.753	2	1882.8982	1882.8982	-	R	1	17
PSM	MFQAAGAAQATPSHDA	260	sp|Q9BT23|LIMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7703	31.157	2	1614.7097	1614.7097	-	K	1	17
PSM	MNSVGEACTDMK	261	sp|O43715|TRIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=5656	24.213	2	1415.5367	1415.5367	-	R	1	13
PSM	PVAVGPYGQSQPSCFD	262	sp|P60602-2|ROMO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4	ms_run[2]:scan=7483	30.571	2	1707.7563	1707.7563	M	R	2	18
PSM	SDDKPFLCTAPGCGQ	263	sp|P15336-7|ATF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7474	30.543	2	1693.7076	1693.7076	M	R	2	17
PSM	SETAPAAPAAAPPAE	264	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6027	25.815	2	1349.6463	1349.6463	M	K	2	17
PSM	TTTTTFKGVDPNS	265	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6848	28.764	2	1409.6674	1409.6674	M	R	2	15
PSM	ADEEEEVKPILQ	266	sp|Q8N0Z6|TTC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=7665	31.055729686666666	2	1440.6997	1440.6979	M	K	3	15
PSM	ADEEEEVKPILQ	267	sp|Q8N0Z6|TTC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=7660	31.042289795733332	2	1440.6997	1440.6979	M	K	3	15
PSM	MEANGSQGTSGSANDSQHDPG	268	sp|Q96DH6|MSI2H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5325	22.691999663466667	2	2104.794781	2103.803569	-	K	1	22
PSM	DDDIAALVVDNGSGMC	269	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9125	34.903437047733334	2	1709.6962	1708.6912	M	K	2	18
PSM	SAEVPEAASAEEQ	270	sp|P56211|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=6755	28.457477865066668	2	1358.5853	1358.5832	M	K	2	15
PSM	MEATLEQHLEDTM	271	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8796	34.09192597813333	2	1604.671805	1604.669825	-	K	1	14
PSM	ANSANTNTVPKLY	272	sp|P52655|TF2AA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=7557	30.759056284266666	2	1434.7112	1433.7142	M	R	2	15
PSM	SGNGNAAATAEENSPKM	273	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=5830	25.003302973866667	2	1706.7072	1705.7212	M	R	2	19
PSM	MEPEQMLEGQTQVAENPHSEYGLTDNVE	274	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7773	31.327927573866667	3	3248.380618	3248.376169	-	R	1	29
PSM	AAAAAGAGSGPWAAQE	275	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=8089	32.166	2	1426.6477	1426.6477	M	K	2	18
PSM	AAGGAVAAAPEC	276	sp|Q9UL63|MKLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6478	27.511	2	1085.4812	1085.4812	M	R	2	14
PSM	AAGGDHGSPDSY	277	sp|P30566-2|PUR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5970	25.587	2	1174.4527	1174.4527	M	R	2	14
PSM	AAPSAGSWSTFQH	278	sp|P42575|CASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=7940	31.786	2	1387.6157	1387.6157	M	K	2	15
PSM	AASCVLLHTGQ	279	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=7766	31.315	2	1197.5812	1197.5812	M	K	2	13
PSM	ADKPDMGEIASFD	280	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=7402	30.354	2	1452.6079	1452.6079	M	K	2	15
PSM	ADLAECNIKVMC	281	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,6-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7513	30.654	2	1480.636	1480.6360	M	R	2	14
PSM	ADLAECNIKVMC	282	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,6-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8242	32.557	2	1464.6411	1464.6411	M	R	2	14
PSM	AELVQGQSAPVGM	283	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=7822	31.45	2	1343.6391	1343.6391	M	K	2	15
PSM	AGSYPEGAPAVLADK	284	sp|Q96IZ6|MET2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=7613	30.92	2	1486.7304	1486.7304	M	R	2	17
PSM	ALSMPLNGLKEED	285	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=8033	32.029	2	1473.7021	1473.7021	M	K	2	15
PSM	ASTITGSQDCIVNH	286	sp|Q16600|ZN239_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=6976	29.144	2	1543.6937	1543.6937	M	R	2	16
PSM	EEEIAALVIDNGSGMC	287	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9300	35.45	2	1764.7546	1764.7546	M	K	2	18
PSM	GDMANNSVAYSGVKNSL	288	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=7282	30.044	2	1783.8047	1783.8047	M	K	2	19
PSM	MDDKGDPSNEEAP	289	sp|Q9BTC0-2|DIDO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5698	24.414	2	1461.5566	1461.5566	-	K	1	14
PSM	MDFEDDYTHSAC	290	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7292	30.062	2	1547.5181	1547.5181	-	R	1	13
PSM	MDQCVTVERELE	291	sp|Q9H871-2|RMD5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=7526	30.683	2	1565.6702	1565.6702	-	K	1	13
PSM	MDSAGQDINLNSPN	292	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7082	29.468	2	1532.6413	1532.6413	-	K	1	15
PSM	MEATLEQHLEDTM	293	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8805	34.11	2	1604.6698	1604.6698	-	K	1	14
PSM	MEPAVSEPMRDQVA	294	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6352	27.041	2	1632.7124	1632.7124	-	R	1	15
PSM	MEPAVSEPMRDQVA	295	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=7638	30.977	2	1600.7225	1600.7225	-	R	1	15
PSM	MEPRPTAPSSGAPGLAGVGETPSAAALAAA	296	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8355	32.844	3	2762.3545	2762.3545	-	R	1	31
PSM	MMLSTEGREGFVV	297	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=8314	32.738	2	1528.6902	1528.6902	-	K	1	14
PSM	MNVGVAHSEVNPNT	298	sp|Q9P0S3|ORML1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6974	29.136	2	1509.6882	1509.6882	-	R	1	15
PSM	MQDAENVAVPEAAEE	299	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7291	30.059	2	1659.6934	1659.6934	-	R	1	16
PSM	MQDAENVAVPEAAEE	300	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=8240	32.553	2	1643.6985	1643.6985	-	R	1	16
PSM	SDQQLDCALDLMR	301	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=8294	32.693	2	1621.7076	1621.7076	M	R	2	15
PSM	SETAPLAPTIPAPAEKTPV	302	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=8114	32.235	2	1931.0252	1931.0252	M	K	2	21
PSM	SGEPGQTSVAPPPEEVEPGSGV	303	sp|Q9BRT3|MIEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=7648	31.001	2	2147.9859	2147.9859	M	R	2	24
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	304	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6624	27.998	3	2984.3999	2984.3999	M	K	2	34
PSM	SSPQAPEDGQGCGDRGDPPGDL	305	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6717	28.329	2	2252.924	2252.9240	M	R	2	24
PSM	SSVAVLTQESFAEH	306	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=8758	33.976	2	1545.7311	1545.7311	M	R	2	16
PSM	SYGRPPPDVEGMTSL	307	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7368	30.261	2	1662.7559	1662.7559	M	K	2	17
PSM	DDDIAALVVDNGSGMC	308	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9033	34.596532836	2	1709.6982	1708.6912	M	K	2	18
PSM	SAEVETSEGVDESEK	309	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=6192	26.464991767733334	2	1636.6979	1636.6946	M	K	2	17
PSM	EEEIAALVIDNGSGMC	310	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9173	35.05039020666666	2	1765.7562	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	311	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9426	35.87229935813333	2	1764.7530	1764.7541	M	K	2	18
PSM	SGNGNAAATAEENSPKM	312	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=5995	25.686794452799997	2	1707.7292	1705.7212	M	R	2	19
PSM	ATVEPETTPTPNPPTTEEE	313	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=7104	29.5505416664	2	2080.9365	2080.9319	M	K	2	21
PSM	ATVEPETTPTPNPPTTEEE	314	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=6980	29.159446110933334	2	2080.9365	2080.9319	M	K	2	21
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	315	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=8908	34.36	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAEEEDGGPEGPN	316	sp|Q99942|RNF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6185	26.439	2	1383.5426	1383.5426	M	R	2	16
PSM	AADISESSGADC	317	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6537	27.693	2	1223.4612	1223.4612	M	K	2	14
PSM	ADMQNLVERLE	318	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=8347	32.826	2	1374.6449	1374.6449	M	R	2	13
PSM	AEGSAVSDPQHAA	319	sp|Q9H2C0|GAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5904	25.328	2	1280.5633	1280.5633	M	R	2	15
PSM	AELGEADEAELQ	320	sp|Q9Y5J9|TIM8B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=8293	32.691	2	1315.578	1315.5780	M	R	2	14
PSM	AELVQGQSAPVGM	321	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=8897	34.334	2	1327.6442	1327.6442	M	K	2	15
PSM	AESSESFTMASSPAQ	322	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7831	31.481	2	1570.6457	1570.6457	M	R	2	17
PSM	AGDSEQTLQNHQQPNGGEPFLIGVSGGTASG	323	sp|Q9BZX2|UCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=8619	33.585	3	3094.4228	3094.4228	M	K	2	33
PSM	ASSDIQVKELE	324	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7404	30.357	2	1259.6245	1259.6245	M	K	2	13
PSM	ASVGECPAPVPVKD	325	sp|P56134-3|ATPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6756	28.46	2	1466.7075	1466.7075	M	K	2	16
PSM	ATGANATPLDFPSK	326	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7699	31.151	2	1430.7042	1430.7042	M	K	2	16
PSM	ATGANATPLDFPSK	327	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7880	31.611	2	1430.7042	1430.7042	M	K	2	16
PSM	DDDIAALVVDNGSGMC	328	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=9392	35.759	2	1692.6971	1692.6971	M	K	2	18
PSM	MDGIVPDIAVGTK	329	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8232	32.531	2	1372.6908	1372.6908	-	R	1	14
PSM	MDSTLTASEIRQ	330	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7635	30.968	2	1392.6555	1392.6555	-	R	1	13
PSM	MEESVNQMQPLNE	331	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=7588	30.838	2	1605.6651	1605.6651	-	K	1	14
PSM	MEGGFGSDFGGSGSG	332	sp|Q9Y5L4|TIM13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8173	32.386	2	1405.5092	1405.5092	-	K	1	16
PSM	MEPAEQPSELVSAEG	333	sp|P47224|MSS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7809	31.427	2	1630.7032	1630.7032	-	R	1	16
PSM	MFHGIPATPGIGAPGN	334	sp|Q9UK41|VPS28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8163	32.363	2	1593.761	1593.7610	-	K	1	17
PSM	MMLGTEGGEGFVVKV	335	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=8667	33.72	2	1626.7633	1626.7633	-	R	1	16
PSM	MNPVYSPVQPGAPYGNP	336	sp|Q92567-3|F168A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8421	33.045	2	1844.8403	1844.8403	-	K	1	18
PSM	MNSNVENLPPHII	337	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8217	32.488	2	1534.745	1534.7450	-	R	1	14
PSM	MNVGTAHSEVNPNT	338	sp|Q8N138-4|ORML3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5893	25.274	2	1527.6624	1527.6624	-	R	1	15
PSM	MQGEAHPSASLID	339	sp|Q96SK2-4|TM209_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6932	29.008	2	1412.6242	1412.6242	M	R	2	15
PSM	PAGPVQAVPPPPPVPTEP	340	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7679	31.094	2	1745.9352	1745.9352	M	K	2	20
PSM	SDAAVDTSSEITTKDL	341	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7053	29.387	2	1693.7894	1693.7894	M	K	2	18
PSM	SETAPAAPAAAPPAE	342	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6053	25.919	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	343	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6744	28.423	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	344	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7014	29.273	2	1391.6569	1391.6569	M	K	2	17
PSM	SIMSYNGGAVMAM	345	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7155	29.69	2	1420.5673	1420.5673	M	K	2	15
PSM	SSAAEPPPPPPPESAPS	346	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6558	27.76	2	1655.7679	1655.7679	M	K	2	19
PSM	SSEAETQQPPAAPPAAPALSAADT	347	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7883	31.617	2	2319.0866	2319.0866	M	K	2	26
PSM	STDTGVSLPSYEEDQGS	348	sp|Q9Y241|HIG1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7929	31.745	2	1812.7537	1812.7537	M	K	2	19
PSM	VGQLSEGAIAAIMQ	349	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:35	ms_run[2]:scan=7898	31.657	2	1402.7126	1402.7126	M	K	2	16
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	350	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=9546	36.2459071952	3	3089.3824	3089.3746	M	R	2	40
PSM	DDDIAALVVDNGSGMC	351	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9510	36.10835199893334	2	1708.6934	1708.6915	M	K	2	18
PSM	DDIAALVVDNGSGMC	352	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	14-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=8407	32.99892260426667	2	1551.6568	1551.6540	D	K	3	18
PSM	METEQPEETFPNTETNGEFGK	353	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9092	34.7793169784	2	2474.038181	2472.027481	-	R	1	22
PSM	MDIEDEENMSSSSTDVKEN	354	sp|P78563|RED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6287	26.801153558933333	2	2233.859471	2232.852219	-	R	1	20
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	355	sp|Q9HD26|GOPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4,29-UNIMOD:35	ms_run[1]:scan=8409	33.0032225376	3	2605.1050	2605.0990	M	R	2	32
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINAS	356	sp|Q99729-2|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=6693	28.227904471733332	4	5747.4490	5747.4541	M	K	2	64
PSM	AAAAAAGAGPEMV	357	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7127	29.614	2	1143.523	1143.5230	M	R	2	15
PSM	AAAAAQGGGGGEP	358	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6035	25.848	2	1054.468	1054.4680	M	R	2	15
PSM	AAAEEGCSVGAEAD	359	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=6444	27.396	2	1377.5354	1377.5354	M	R	2	16
PSM	AAAVAVAAASR	360	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7688	31.121	2	998.55089	998.5509	M	R	2	13
PSM	AASAAAAELQASGGP	361	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=8793	34.082	2	1312.6259	1312.6259	M	R	2	17
PSM	AASAPPPPDKLEGGGGPAPPPAPPSTG	362	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6954	29.077	3	2431.202	2431.2020	M	R	2	29
PSM	AATTGSGVKVP	363	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6719	28.335	2	1028.5502	1028.5502	M	R	2	13
PSM	AAVQAAEVKVDGSEP	364	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7351	30.218	2	1511.7468	1511.7468	M	K	2	17
PSM	ADEEKLPPGWE	365	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7919	31.709	2	1311.5983	1311.5983	M	K	2	13
PSM	AENGESSGPPRPS	366	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5677	24.316	2	1325.5848	1325.5848	M	R	2	15
PSM	AESDWDTVTVLR	367	sp|O60869-2|EDF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=8902	34.344	2	1432.6834	1432.6834	M	K	2	14
PSM	ALSAETESHIY	368	sp|O14569|C56D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7868	31.577	2	1261.5826	1261.5826	M	R	2	13
PSM	ANEAYPCPCDIGH	369	sp|Q96DG6|CMBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7132	29.621	2	1544.6024	1544.6024	M	R	2	15
PSM	ASASTQPAALSAEQA	370	sp|Q99622|C10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6996	29.209	2	1443.6842	1443.6842	M	K	2	17
PSM	ASASYHISNLLE	371	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=8766	34.001	2	1345.6514	1345.6514	M	K	2	14
PSM	ASDCEPALNQAEG	372	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=6830	28.714	2	1402.5671	1402.5671	M	R	2	15
PSM	ASGAGGVGGGGGG	373	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5565	23.769	2	901.38897	901.3890	M	K	2	15
PSM	ASKEMFEDTVEE	374	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=6851	28.774	2	1471.6025	1471.6025	M	R	2	14
PSM	ATVTATTKVPEI	375	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7896	31.652	2	1271.6973	1271.6973	M	R	2	14
PSM	DDDIAALVVDNGSGMC	376	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=9523	36.153	2	1692.6971	1692.6971	M	K	2	18
PSM	MDEQSQGMQGPPVPQFQPQ	377	sp|Q8TDX7-2|NEK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=8008	31.965	3	2201.9358	2201.9358	-	K	1	20
PSM	MEGLTLSDAEQ	378	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7952	31.819	2	1250.5336	1250.5336	-	K	1	12
PSM	MEMTEMTGVSLK	379	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6382	27.158	2	1445.6088	1445.6088	-	R	1	13
PSM	MENEPDHENVEQSLCA	380	sp|Q8N3P4-2|VPS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=6923	28.985	2	1958.7622	1958.7622	-	K	1	17
PSM	MENGAVYSPTTEEDPGPA	381	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7243	29.922	2	1921.7888	1921.7888	-	R	1	19
PSM	MEPAVGGPGPLIVNN	382	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8592	33.526	2	1521.7497	1521.7497	-	K	1	16
PSM	MEPPGGSLGPGRGT	383	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6316	26.92	2	1369.6296	1369.6296	-	R	1	15
PSM	MEVSPLQPVNENMQVN	384	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=8847	34.212	2	1885.855	1885.8550	-	K	1	17
PSM	MEVTGDAGVPESGEI	385	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8042	32.046	2	1547.6661	1547.6661	-	R	1	16
PSM	MHPAGLAAAAAGTP	386	sp|Q5BJH7-4|YIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6873	28.839	2	1292.6183	1292.6183	-	R	1	15
PSM	MLAAGVGGQGE	387	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7086	29.475	2	1046.4703	1046.4703	-	R	1	12
PSM	MLGVAAGMTHSNMANALASATCE	388	sp|P48059-2|LIMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:35,22-UNIMOD:4	ms_run[2]:scan=7440	30.454	3	2397.0069	2397.0069	-	R	1	24
PSM	MNGDQNSDVYAQE	389	sp|P14324-2|FPPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6374	27.128	2	1527.5784	1527.5784	-	K	1	14
PSM	SATVVDAVNAAPLSGS	390	sp|O95391|SLU7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=8812	34.127	2	1499.7468	1499.7468	M	K	2	18
PSM	SCINLPTVLPGSPSKT	391	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=8673	33.737	2	1711.8815	1711.8815	M	R	2	18
PSM	SDNGELEDKPPAPPV	392	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7101	29.539	2	1605.7522	1605.7522	M	R	2	17
PSM	SESGHSQPGLYGIE	393	sp|Q9H0W8-2|SMG9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7618	30.931	2	1501.6685	1501.6685	M	R	2	16
PSM	SSEAETQQPPAAPPAAPALSAADT	394	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=7732	31.23	3	2319.0866	2319.0866	M	K	2	26
PSM	SSLAVRDPAMD	395	sp|Q9H0L4|CSTFT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=6713	28.309	2	1218.5551	1218.5551	M	R	2	13
PSM	SETAPAAPAAAPPAE	396	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=6631	28.028539099733333	2	1391.6574	1391.6564	M	K	2	17
PSM	SETAPAAPAAPAPAE	397	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=6598	27.9183649536	2	1391.6574	1391.6564	M	K	2	17
PSM	MMCGAPSATQPATAETQHIADQV	398	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=6804	28.617718691733334	2	2489.066990	2488.066861	-	R	1	24
PSM	SNNGLDIQDKPPAPPM	399	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,16-UNIMOD:35	ms_run[1]:scan=7199	29.816925218133335	2	1751.8062	1750.8192	M	R	2	18
PSM	MAPAEILNGKEISAQI	400	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8813	34.12908379866666	2	1741.896789	1741.892037	-	R	1	17
PSM	METEQPEETFPNTETNGEFGK	401	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9177	35.06350471333334	2	2475.028904	2472.027481	-	R	1	22
PSM	AAAAAMAEQESA	402	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=6697	28.241	2	1177.4921	1177.4921	M	R	2	14
PSM	AADTQVSETLK	403	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6643	28.06	2	1203.5983	1203.5983	M	R	2	13
PSM	AALTRDPQFQ	404	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7504	30.626	2	1187.5935	1187.5935	M	K	2	12
PSM	AAQIPESDQIKQF	405	sp|Q9Y5J7|TIM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8061	32.086	2	1515.7569	1515.7569	M	K	2	15
PSM	ADHSFSDGVPSDSVEAA	406	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7258	29.968	2	1731.7224	1731.7224	M	K	2	19
PSM	ADKEAAFDDAVEE	407	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6983	29.17	2	1450.61	1450.6100	M	R	2	15
PSM	ADPAECSIKVMC	408	sp|O60282|KIF5C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,6-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6860	28.804	2	1437.5938	1437.5938	M	R	2	14
PSM	AEGGAADLDTQ	409	sp|Q9Y4E8-4|UBP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6649	28.069	2	1088.4622	1088.4622	M	R	2	13
PSM	AEPSGAETRPPI	410	sp|Q9NRR5-2|UBQL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6890	28.892	2	1265.6252	1265.6252	M	R	2	14
PSM	AETNNECSIKVLC	411	sp|Q12840|KIF5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7431	30.43	2	1578.7018	1578.7018	M	R	2	15
PSM	AGLTVRDPAVD	412	sp|P33240-2|CSTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7319	30.123	2	1154.5932	1154.5932	M	R	2	13
PSM	AKQYDSVECPFCDEVS	413	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7934	31.764	2	1974.7975	1974.7975	M	K	2	18
PSM	ASEELACKLE	414	sp|Q9BUP0|EFHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=7637	30.974	2	1190.5489	1190.5489	M	R	2	12
PSM	ASGSGTKNLDF	415	sp|Q96NC0|ZMAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7372	30.27	2	1137.5302	1137.5302	M	R	2	13
PSM	ASVSSATFSGHGA	416	sp|Q7Z4H3-3|HDDC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6862	28.81	2	1219.5469	1219.5469	M	R	2	15
PSM	EEEIAALVIDNGSGMC	417	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9561	36.305	2	1764.7546	1764.7546	M	K	2	18
PSM	GEAEVGGGGAAGD	418	sp|Q9NV56|MRGBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5984	25.639	2	1087.4418	1087.4418	M	K	2	15
PSM	MDGASAEQDGLQED	419	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6512	27.621	2	1522.5729	1522.5729	-	R	1	15
PSM	MEATGTDEVDKL	420	sp|Q96DT6|ATG4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7100	29.533	2	1365.597	1365.5970	-	K	1	13
PSM	MEEEQDLPEQPVK	421	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6602	27.929	2	1628.724	1628.7240	-	K	1	14
PSM	MEESVNQMQPLNE	422	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8614	33.573	2	1589.6702	1589.6702	-	K	1	14
PSM	MEPAGPCGFCPAGEVQPA	423	sp|Q9UHR6|ZNHI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8266	32.618	2	1931.7852	1931.7852	-	R	1	19
PSM	METGTAPLVAPPR	424	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7823	31.453	2	1380.7071	1380.7071	-	R	1	14
PSM	MMQGEAHPSASLID	425	sp|Q96SK2-4|TM209_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=6942	29.04	2	1559.6596	1559.6596	-	R	1	15
PSM	MNPVYSPGSSGVPYANA	426	sp|A1KXE4-2|F168B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8162	32.361	2	1767.7774	1767.7774	-	K	1	18
PSM	SGELPPNINIKEP	427	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7911	31.692	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	428	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8052	32.07	2	1448.7511	1448.7511	M	R	2	15
PSM	SGGGTETPVGCEAAPGGGS	429	sp|Q8TDH9-2|BL1S5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=6411	27.27	2	1688.6948	1688.6948	M	K	2	21
PSM	SIMSYNGGAVMAM	430	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,3-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7970	31.862	2	1404.5724	1404.5724	M	K	2	15
PSM	SVNYAAGLSPYADKG	431	sp|Q8N6T7-2|SIR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7966	31.852	2	1553.7362	1553.7362	M	K	2	17
PSM	SYGRPPPDVEGMTSL	432	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8372	32.885	2	1646.761	1646.7610	M	K	2	17
PSM	TTEVGSVSEVK	433	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6495	27.576	2	1176.5874	1176.5874	M	K	2	13
PSM	AADISESSGADCKGD	434	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=6112	26.158755694133333	2	1523.6052	1523.6041	M	P	2	17
PSM	ETAPAAPAAAPPAE	435	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=6018	25.778910418133332	2	1262.6151	1262.6138	S	K	3	17
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	436	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=6020	25.789629183733332	3	2681.1882	2680.1802	M	R	2	29
PSM	METEQPEETFPNTETNGEFGK	437	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7754	31.289744738666666	2	2472.024117	2472.027481	-	R	1	22
PSM	AAVQAAEVKVDGSEP	438	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=7343	30.197008287733336	2	1511.7479	1511.7462	M	K	2	17
PSM	SGNGNAAATAEENSPKM	439	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=5788	24.809264812	2	1706.7072	1705.7212	M	R	2	19
PSM	SGPDVETPSAIQIC	440	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,14-UNIMOD:4	ms_run[1]:scan=8560	33.4291655584	2	1514.6935	1514.6918	M	R	2	16
PSM	AAAAAETPEVL	441	sp|Q9NXW9-2|ALKB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8704	33.82	2	1083.5448	1083.5448	M	R	2	13
PSM	AAAAAQGGGGGEP	442	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6133	26.25	2	1054.468	1054.4680	M	R	2	15
PSM	AAGTSSYWEDLR	443	sp|O95249|GOSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8608	33.559	2	1396.6259	1396.6259	M	K	2	14
PSM	AALAPLPPLPAQF	444	sp|Q9NP79|VTA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=9005	34.52	2	1346.7598	1346.7598	M	K	2	15
PSM	AAQGVGPGPGSAAPPGLEAA	445	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8128	32.269	2	1715.8479	1715.8479	M	R	2	22
PSM	AATTGSGVKVP	446	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6831	28.716	2	1028.5502	1028.5502	M	R	2	13
PSM	ADKEAAFDDAVEE	447	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7269	30.015	2	1450.61	1450.6100	M	R	2	15
PSM	AEAEGVPTTPGPASGSTF	448	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8366	32.868	2	1716.7843	1716.7843	M	R	2	20
PSM	AETAAGVGRF	449	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7456	30.493	2	1019.5036	1019.5036	M	K	2	12
PSM	AGLGHPAAFG	450	sp|O94760|DDAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7566	30.784	2	938.46102	938.4610	M	R	2	12
PSM	APAMQPAEIQFAQ	451	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=7259	29.971	2	1416.6708	1416.6708	M	R	2	15
PSM	ASSAASSEHFE	452	sp|Q9UEU0|VTI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6346	27.023	2	1163.4731	1163.4731	M	K	2	13
PSM	ATDELATKLS	453	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7501	30.623	2	1089.5554	1089.5554	M	R	2	12
PSM	ATTATMATSGSAR	454	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5597	23.929	2	1282.5823	1282.5823	M	K	2	15
PSM	MDDREDLVYQA	455	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7886	31.626	2	1395.5976	1395.5976	-	K	1	12
PSM	MDETSPLVSPE	456	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7657	31.03	2	1261.5384	1261.5384	-	R	1	12
PSM	MDGEEKTYGGCEGPDAMYV	457	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,11-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7668	31.062	2	2165.8228	2165.8228	-	K	1	20
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	458	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8011	31.972	3	2482.1017	2482.1017	-	R	1	28
PSM	MEEQPQMQDADEPADSGGEG	459	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=5967	25.577	2	2193.795	2193.7950	-	R	1	21
PSM	MEMTEMTGVSLK	460	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7041	29.35	2	1429.6139	1429.6139	-	R	1	13
PSM	MEPGPDGPAASGPAAI	461	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7790	31.378	2	1494.6661	1494.6661	-	R	1	17
PSM	MESPASSQPASMPQS	462	sp|P46734|MP2K3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5765	24.71	2	1607.6443	1607.6443	-	K	1	16
PSM	MESQEPTESSQNG	463	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5471	23.314	2	1480.5624	1480.5624	-	K	1	14
PSM	METMASPGKDNY	464	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=5927	25.421	2	1416.5537	1416.5537	-	R	1	13
PSM	MEVDAPGVDGRDGL	465	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8351	32.833	2	1471.6613	1471.6613	-	R	1	15
PSM	MEVSPLQPVNENMQVN	466	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8539	33.376	2	1885.855	1885.8550	-	K	1	17
PSM	MNSNVENLPPHII	467	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8486	33.234	2	1534.745	1534.7450	-	R	1	14
PSM	PFPVTTQGSQQTQPPQ	468	sp|P51003-2|PAPOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6769	28.503	2	1739.8479	1739.8479	M	K	2	18
PSM	SADAAAGAPLP	469	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7757	31.295	2	981.47673	981.4767	M	R	2	13
PSM	SCGNEFVETLK	470	sp|Q68CZ6-2|HAUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=7999	31.942	2	1324.5969	1324.5969	M	K	2	13
PSM	SDNGELEDKPPAPPV	471	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7214	29.862	2	1605.7522	1605.7522	M	R	2	17
PSM	SDTLTADVIGR	472	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8054	32.073	2	1188.5986	1188.5986	M	R	2	13
PSM	SEGDSVGESVHG	473	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5960	25.555	2	1200.4895	1200.4895	M	K	2	14
PSM	SETAPLAPTIPAPAE	474	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8609	33.562	2	1505.7613	1505.7613	M	K	2	17
PSM	SGDGATEQAAEYVPE	475	sp|Q12996-3|CSTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7626	30.948	2	1564.6529	1564.6529	M	K	2	17
PSM	SGPRPVVLSGPSGAG	476	sp|Q16774|KGUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7074	29.44	2	1378.7205	1378.7205	M	K	2	17
PSM	SSAPTTPPSVDKVDGFS	477	sp|Q16537-2|2A5E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7481	30.564	2	1732.8156	1732.8156	M	R	2	19
PSM	SYTPGVGGDPAQLAQ	478	sp|O15400-2|STX7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8057	32.078	2	1501.7049	1501.7049	M	R	2	17
PSM	TDNSNNQLVVRA	479	sp|Q14155-6|ARHG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6818	28.671	2	1371.6743	1371.6743	M	K	2	14
PSM	TSEVIEDEKQFYS	480	sp|Q9BV86-2|NTM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8323	32.766	2	1615.7253	1615.7253	M	K	2	15
PSM	VLESTMVCVDNSEYM	481	sp|P55036-2|PSMD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35,8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=6907	28.95	2	1807.7314	1807.7314	M	R	2	17
PSM	AAAAAAAAAGAAGG	482	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=8056	32.0752622056	2	1012.4935	1012.4932	A	R	3	17
PSM	AGVEEVAASGSHLNGDLD	483	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=8121	32.25014424426667	2	1782.8152	1781.8062	M	P	2	20
PSM	ANSANTNTVPKLY	484	sp|P52655|TF2AA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=7662	31.047458572266667	2	1434.7052	1433.7142	M	R	2	15
PSM	APAMQPAEIQFAQ	485	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=7864	31.570380139466668	2	1400.6706	1400.6753	M	R	2	15
PSM	ARGSVSDEEMMEL	486	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,10-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=6710	28.2933164928	2	1526.6169	1526.6224	M	R	2	15
PSM	AAAAAMAEQESA	487	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7857	31.554	2	1161.4972	1161.4972	M	R	2	14
PSM	AAAAAVGNAVPCGA	488	sp|Q9HD20|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=7765	31.314	2	1240.587	1240.5870	M	R	2	16
PSM	AAAAPVAADDDER	489	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6083	26.035	2	1312.5895	1312.5895	M	R	2	15
PSM	AAAGGGGGGAAAAG	490	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5440	23.17	2	956.43117	956.4312	M	R	2	16
PSM	AAAMDVDTPSGTNSGAGK	491	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6607	27.941	2	1690.7468	1690.7468	M	K	2	20
PSM	AALGEPVRLE	492	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8146	32.31	2	1095.5924	1095.5924	M	R	2	12
PSM	AASSLEQKLS	493	sp|O14733|MP2K7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7467	30.523	2	1074.5557	1074.5557	M	R	2	12
PSM	AAVQMDPELAK	494	sp|Q9Y312|AAR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=6472	27.491	2	1229.5962	1229.5962	M	R	2	13
PSM	ADAEVIILPK	495	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8663	33.711	2	1109.6332	1109.6332	M	K	2	12
PSM	ADEEKLPPGWE	496	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7941	31.788	2	1311.5983	1311.5983	M	K	2	13
PSM	ADHSFSDGVPSDSVEAA	497	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7120	29.598	2	1731.7224	1731.7224	M	K	2	19
PSM	ADKMDMSLDDII	498	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8645	33.664	2	1439.616	1439.6160	M	K	2	14
PSM	ADTTPNGPQGAGAVQFMMTN	499	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=7385	30.305	2	2080.883	2080.8830	M	K	2	22
PSM	AECGASGSGSSGDSLD	500	sp|Q9NVE7|PANK4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=6257	26.709	2	1497.5525	1497.5525	M	K	2	18
PSM	AEFTSYKETASS	501	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7151	29.678	2	1361.5987	1361.5987	M	R	2	14
PSM	AENVVEPGPPSAK	502	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6505	27.605	2	1335.667	1335.6670	M	R	2	15
PSM	AEPDPSHPLETQAG	503	sp|Q8IXJ6-4|SIR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6588	27.878	2	1489.6685	1489.6685	M	K	2	16
PSM	AGITTIEAVK	504	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7788	31.372	2	1043.5863	1043.5863	M	R	2	12
PSM	AGSSSLEAVR	505	sp|P09493-5|TPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6554	27.75	2	1017.5091	1017.5091	M	R	2	12
PSM	AKISSPTETE	506	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6072	25.995	2	1103.5346	1103.5346	M	R	2	12
PSM	ASSSTVPLGFHYET	507	sp|Q9BXK5-2|B2L13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8380	32.915	2	1536.7096	1536.7096	M	K	2	16
PSM	ATAAETSASEPEAES	508	sp|Q15020-3|SART3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6202	26.512	2	1491.6213	1491.6213	M	K	2	17
PSM	ATAEVLNIGK	509	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8006	31.96	2	1056.5815	1056.5815	M	K	2	12
PSM	ATVQQLEGRW	510	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8778	34.035	2	1228.62	1228.6200	M	R	2	12
PSM	MDDREDLVYQA	511	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7149	29.671	2	1411.5926	1411.5926	-	K	1	12
PSM	MDGTEGSAGQPGPAE	512	sp|Q9BZ67-2|FRMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5887	25.246	2	1460.5726	1460.5726	-	R	1	16
PSM	MDNLSSEEIQQ	513	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6953	29.075	2	1350.5609	1350.5609	-	R	1	12
PSM	MEAATTLHPGP	514	sp|Q9UGL1|KDM5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6622	27.988	2	1181.5387	1181.5387	-	R	1	12
PSM	MEGPGLGSQC	515	sp|Q8IUH4|ZDH13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=6504	27.602	2	1092.4216	1092.4216	-	R	1	11
PSM	MEPAGPCGFCPAGEVQPA	516	sp|Q9UHR6|ZNHI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8273	32.633	2	1931.7852	1931.7852	-	R	1	19
PSM	MFQVPDSEGGRAGS	517	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7164	29.717	2	1494.6409	1494.6409	-	R	1	15
PSM	MHGGGPPSGDSACPL	518	sp|P24928-2|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6579	27.839	2	1496.6024	1496.6024	-	R	1	16
PSM	MLGNSAPGPAT	519	sp|P20248|CCNA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6686	28.203	2	1072.4859	1072.4859	-	R	1	12
PSM	MNAGSDPVVIVSAA	520	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8607	33.555	2	1387.6653	1387.6653	-	R	1	15
PSM	MNALLEQKEQQE	521	sp|Q6AI12|ANR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6779	28.537	2	1517.7032	1517.7032	-	R	1	13
PSM	MQSPAVLVTSR	522	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7185	29.774	2	1245.6387	1245.6387	-	R	1	12
PSM	MTSEVIEDEKQFYS	523	sp|Q9BV86-2|NTM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8134	32.281	2	1762.7607	1762.7607	-	K	1	15
PSM	PAVLGFEGSAN	524	sp|Q9NPF4|OSGEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7710	31.179	2	1060.5189	1060.5189	M	K	2	13
PSM	PFPVTTQGSQQTQPPQ	525	sp|P51003-2|PAPOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6658	28.095	2	1739.8479	1739.8479	M	K	2	18
PSM	SAAVTAGKLA	526	sp|P53350|PLK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6809	28.636	2	929.5182	929.5182	M	R	2	12
PSM	SANEDQEMELEAL	527	sp|Q6NW29|RWDD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=8790	34.075	2	1535.6297	1535.6297	M	R	2	15
PSM	SDAAVDTSSEITTKDL	528	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6899	28.92	2	1693.7894	1693.7894	M	K	2	18
PSM	SETAPAAPAAAPPAE	529	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7089	29.489	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	530	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7102	29.544	2	1391.6569	1391.6569	M	K	2	17
PSM	SSAAEPPPPPPPESAPS	531	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6678	28.167	2	1655.7679	1655.7679	M	K	2	19
PSM	SSGIHVALVTGGN	532	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7808	31.425	2	1252.6412	1252.6412	M	K	2	15
PSM	SVELEEALPVTTAEGMA	533	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:35	ms_run[2]:scan=8287	32.672	2	1761.8342	1761.8342	M	K	2	19
PSM	VLESTMVCVDNSEYM	534	sp|P55036-2|PSMD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=7564	30.777	2	1791.7365	1791.7365	M	R	2	17
PSM	SETAPAAPAAAPPAE	535	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=9532	36.191780787999996	2	1391.6583	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	536	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=9535	36.203880714133334	2	1391.6583	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	537	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=9398	35.7805292544	2	1391.6584	1391.6564	M	K	2	17
PSM	ETAPAAPAAPAPAE	538	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=6595	27.909400516266665	2	1262.6155	1262.6138	S	K	3	17
PSM	SGGGVIRGPAGNNDC	539	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=6196	26.48393270613333	2	1471.6489	1471.6469	M	R	2	17
PSM	EEEIAALVIDNGSGMC	540	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=9002	34.51222946986666	2	1749.7452	1748.7592	M	K	2	18
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGT	541	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,33-UNIMOD:4	ms_run[1]:scan=7799	31.404175191466667	3	3483.5499	3483.5479	M	K	2	40
PSM	ADLDSPPKLSGVQQPSEGVGGG	542	sp|Q9H9E3|COG4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=7573	30.801062317333333	2	2136.0411	2136.0330	M	R	2	24
PSM	AEPDPSHPLETQAG	543	sp|Q8IXJ6|SIR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=6561	27.767086765600002	2	1489.6690	1489.6680	M	K	2	16
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	544	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=8437	33.100294912	3	3105.3947	3105.3906	M	R	2	37
PSM	AQALSEEEFQ	545	sp|Q4V328|GRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=8586	33.5095152312	2	1192.5251	1192.5243	M	R	2	12
PSM	AAAAAAGAGPEMV	546	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8228	32.521	2	1127.5281	1127.5281	M	R	2	15
PSM	AAAAAGTATSQ	547	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5871	25.176	2	960.45124	960.4512	M	R	2	13
PSM	AAPCEGQAFAVGVE	548	sp|Q86WB0-3|NIPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=8767	34.003	2	1446.6449	1446.6449	M	K	2	16
PSM	AASQAVEEMRS	549	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=5874	25.185	2	1235.5452	1235.5452	M	R	2	13
PSM	ADKMDMSLDDII	550	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8637	33.639	2	1439.616	1439.6160	M	K	2	14
PSM	AEEEVAKLE	551	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7646	30.995	2	1058.5132	1058.5132	M	K	2	11
PSM	AEEQEFTQLC	552	sp|Q53GT1|KLH22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=8638	33.64	2	1295.534	1295.5340	M	K	2	12
PSM	AENLLDGPPNPK	553	sp|Q92793-2|CBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7814	31.435	2	1305.6565	1305.6565	M	R	2	14
PSM	AEPASVAAESLAGS	554	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8590	33.523	2	1300.6147	1300.6147	M	R	2	16
PSM	AERPEDLNLPNAVIT	555	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8512	33.314	2	1692.8683	1692.8683	M	R	2	17
PSM	ANRGPAYGLS	556	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6745	28.424	2	1046.5145	1046.5145	M	R	2	12
PSM	AQETNHSQVPMLCSTGCGFYGNP	557	sp|Q6FIF0-2|ZFAN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=7958	31.832	3	2612.073	2612.0730	M	R	2	25
PSM	AQPGPASQPDVSLQQ	558	sp|Q15276-2|RABE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7238	29.912	2	1563.7529	1563.7529	M	R	2	17
PSM	ASGVQVADEVC	559	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=7502	30.624	2	1175.5129	1175.5129	M	R	2	13
PSM	ASSGAGDPLDSK	560	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6262	26.723	2	1145.52	1145.5200	M	R	2	14
PSM	ASSSGSKAEFIVGG	561	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7462	30.512	2	1337.6463	1337.6463	M	K	2	16
PSM	ATLIYVDKENGEPGT	562	sp|O95997|PTTG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8262	32.606	2	1647.7992	1647.7992	M	R	2	17
PSM	AVSVTPIRDT	563	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7090	29.493	2	1099.5873	1099.5873	M	K	2	12
PSM	AVTLDKDAYY	564	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8039	32.041	2	1199.571	1199.5710	M	R	2	12
PSM	EEEIAALVIDNGSGMC	565	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=8989	34.487	2	1748.7597	1748.7597	M	K	2	18
PSM	MDGIVPDIAVGTK	566	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8935	34.422	2	1356.6959	1356.6959	-	R	1	14
PSM	MDYLTTFTEKSG	567	sp|Q8N573-2|OXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8716	33.847	2	1449.6334	1449.6334	-	R	1	13
PSM	MEAAHFFEGTE	568	sp|P17707|DCAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8466	33.18	2	1325.5234	1325.5234	-	K	1	12
PSM	MEADGAGEQM	569	sp|Q9Y6M7-11|S4A7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5407	23.027	2	1111.3798	1111.3798	-	R	1	11
PSM	MEDSMDMDMSPL	570	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7045	29.364	2	1506.487	1506.4870	-	R	1	13
PSM	MEEEAETEEQQ	571	sp|Q8N2Z9-3|CENPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5852	25.094	2	1409.514	1409.5140	-	R	1	12
PSM	MEEVVIAGMSG	572	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7560	30.764	2	1195.5101	1195.5101	-	K	1	12
PSM	MEPGPDGPAASGPAAI	573	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8662	33.706	2	1478.6711	1478.6711	-	R	1	17
PSM	MEPPGGSLGPGRGT	574	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6449	27.409	2	1369.6296	1369.6296	-	R	1	15
PSM	MEPVGCCGEC	575	sp|Q8NEZ5-2|FBX22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6180	26.419	2	1255.3978	1255.3978	-	R	1	11
PSM	MESGSTAASEEA	576	sp|P10644-2|KAP0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5694	24.4	2	1226.4609	1226.4609	-	R	1	13
PSM	METGTAPLVAPP	577	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8202	32.451	2	1240.6009	1240.6009	-	R	1	13
PSM	MEVDAPGVDGRDGL	578	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7396	30.338	2	1487.6562	1487.6562	-	R	1	15
PSM	MEWGSESAAVR	579	sp|Q7Z2K6|ERMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7036	29.336	2	1279.5503	1279.5503	-	R	1	12
PSM	MKLNISFPATGCQ	580	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8267	32.62	2	1523.7112	1523.7112	-	K	1	14
PSM	MTSLAQQLQ	581	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7897	31.654	2	1076.5172	1076.5172	-	R	1	10
PSM	SAFSEAALEK	582	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7720	31.205	2	1093.5292	1093.5292	M	K	2	12
PSM	SEQTPAEAGAAGA	583	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6095	26.084	2	1200.5259	1200.5259	M	R	2	15
PSM	SGELPPNINIKEP	584	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8626	33.605	2	1448.7511	1448.7511	M	R	2	15
PSM	SLSNKLTLD	585	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7863	31.568	2	1031.5499	1031.5499	M	K	2	11
PSM	SNIYIQEPPTNG	586	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7948	31.809	2	1373.6463	1373.6463	M	K	2	14
PSM	MENGAVYSPTTEEDPGPARGP	587	sp|Q9NX76|CKLF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6867	28.82042558506667	3	2232.970526	2231.964093	-	R	1	22
PSM	MDVGELLSYQPNRGT	588	sp|Q8WYA6|CTBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8785	34.06208852906666	2	1737.808920	1736.803950	-	K	1	16
PSM	MEPEQMLEGQTQVAENPHSEYGLTDNVE	589	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7787	31.370164831733334	3	3248.380618	3248.376169	-	R	1	29
PSM	AGAATQASLESAP	590	sp|Q9BXR0|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=7386	30.30801971733333	2	1214.5784	1214.5774	M	R	2	15
PSM	AAASGYTDL	591	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8255	32.588	1	909.40798	909.4080	M	R	2	11
PSM	AAPVVAPPGVVVS	592	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8837	34.192	2	1203.6863	1203.6863	M	R	2	15
PSM	AATAAEAVASGSGEP	593	sp|Q9NWT6|HIF1N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7951	31.816	2	1329.6048	1329.6048	M	R	2	17
PSM	AATASAGAGGIDG	594	sp|Q02978-2|M2OM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6534	27.685	2	1059.4833	1059.4833	M	K	2	15
PSM	AAVQMDPELAK	595	sp|Q9Y312|AAR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7535	30.703	2	1213.6013	1213.6013	M	R	2	13
PSM	ADEELEALR	596	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8017	31.992	2	1086.5193	1086.5193	M	R	2	11
PSM	ADSELQLVEQ	597	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8800	34.1	2	1172.5561	1172.5561	M	R	2	12
PSM	AEPSQAPTPAPAAQP	598	sp|Q92830|KAT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6590	27.885	2	1473.71	1473.7100	M	R	2	17
PSM	AGPESDAQYQFTGI	599	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8320	32.757	2	1482.6627	1482.6627	M	K	2	16
PSM	AGPGSTGGQIGAAALAGGA	600	sp|Q8N653|LZTR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8381	32.917	2	1524.7532	1524.7532	M	R	2	21
PSM	APSVPAAEPEYP	601	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6984	29.172	2	1226.5819	1226.5819	M	K	2	14
PSM	AQVAMSTLPVEDEESSES	602	sp|P78347-5|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8855	34.23	2	1949.8412	1949.8412	M	R	2	20
PSM	ASKEMFEDTVEE	603	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7735	31.236	2	1455.6075	1455.6075	M	R	2	14
PSM	ASSLNEDPEGS	604	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6596	27.913	2	1146.4677	1146.4677	M	R	2	13
PSM	ASTNAESQLQ	605	sp|Q9BQS8-3|FYCO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6386	27.176	2	1089.4938	1089.4938	M	R	2	12
PSM	GDDRPFVCNAPGCGQ	606	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6965	29.107	2	1690.6828	1690.6828	M	R	2	17
PSM	MDCEVNNGSSL	607	sp|P55957-3|BID_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=6853	28.778	2	1282.4806	1282.4806	-	R	1	12
PSM	MDDYSLDEFR	608	sp|Q8N3Y1-2|FBXW8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8263	32.608	2	1347.5289	1347.5289	-	R	1	11
PSM	MDKYDDLGLEAS	609	sp|Q9UGP4|LIMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7624	30.943	2	1413.597	1413.5970	-	K	1	13
PSM	MEAAGSPAATETG	610	sp|Q9BRP8|PYM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5882	25.224	2	1249.5132	1249.5132	-	K	1	14
PSM	MEDSMDMDMSPL	611	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=8710	33.831	2	1474.4972	1474.4972	-	R	1	13
PSM	MEELSADEIR	612	sp|O95155-2|UBE4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7071	29.431	2	1249.5496	1249.5496	-	R	1	11
PSM	MESAIAEGGAS	613	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6400	27.237	2	1079.4441	1079.4441	-	R	1	12
PSM	MESMFSSPAEAALQ	614	sp|Q9BQC3-2|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=8439	33.105	2	1571.6484	1571.6484	-	R	1	15
PSM	METLQSETKT	615	sp|Q9BWK5-4|CYREN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6162	26.361	2	1224.5544	1224.5544	-	R	1	11
PSM	MFEEKASSPSG	616	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6237	26.642	2	1226.5125	1226.5125	-	K	1	12
PSM	MNDTVTIRT	617	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7286	30.05	2	1091.5281	1091.5281	-	R	1	10
PSM	MNGEADCPTDLEMAAP	618	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=8455	33.145	2	1778.6797	1778.6797	-	K	1	17
PSM	MTMDKSELVQ	619	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=6126	26.223	2	1254.5472	1254.5472	-	K	1	11
PSM	PFLELDTNLPAN	620	sp|P30046-2|DOPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8931	34.415	2	1342.6769	1342.6769	M	R	2	14
PSM	SCGRPPPDVDGMITL	621	sp|Q9BRL6-2|SRSF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=8080	32.136	2	1671.7596	1671.7596	M	K	2	17
PSM	SDTSESGAGLT	622	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6323	26.951	2	1065.4462	1065.4462	M	R	2	13
PSM	SFGSEHYLCSSSSY	623	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=7998	31.94	2	1651.6461	1651.6461	M	R	2	16
PSM	SIMSYNGGAVMAM	624	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=8285	32.665	2	1404.5724	1404.5724	M	K	2	15
PSM	SSFSESALEK	625	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7131	29.619	2	1125.519	1125.5190	M	K	2	12
PSM	SSGIHVALVTGGN	626	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7802	31.41	2	1252.6412	1252.6412	M	K	2	15
PSM	SSNCTSTTAVAVAPLSAS	627	sp|P78356-2|PI42B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=7891	31.635	2	1764.82	1764.8200	M	K	2	20
PSM	SYGRPPPDVEGMTSL	628	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7717	31.197	2	1662.7559	1662.7559	M	K	2	17
PSM	TQQGAALQNYNNELV	629	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8633	33.627	2	1703.8115	1703.8115	M	K	2	17
PSM	VQAWYMDDAPGDP	630	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8384	32.925	2	1463.6027	1463.6027	M	R	2	15
PSM	ASAAAASAAAASAASGSPGPGEGSAGGEK	631	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=7078	29.4563087264	3	2357.0737	2357.0726	A	R	3	32
PSM	DDDIAALVVDNGSGMC	632	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=9687	36.8293928392	2	1693.6972	1692.6962	M	K	2	18
PSM	SGGGVIRGPAGNNDC	633	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=6337	26.997643842133336	2	1472.6342	1471.6472	M	R	2	17
PSM	AQDQGEKENPM	634	sp|P62913|RL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,11-UNIMOD:35	ms_run[1]:scan=5125	21.8793509312	2	1303.5355	1303.5345	M	R	2	13
PSM	SLQVLNDKNVSNE	635	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=7618	30.9310822152	2	1500.7437	1500.7415	M	K	2	15
PSM	ASSEQAEQPSQPSSTPGSENVLP	636	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=7819	31.443806179466666	3	2368.0699	2368.0661	M	R	2	25
PSM	SNGYEDHMAEDC	637	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=5762	24.70060914906667	2	1485.4712	1484.4812	M	R	2	14
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRL	638	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=8910	34.36427601333333	3	2720.4202	2720.4092	M	R	2	34
PSM	ANMQGLVERLE	639	sp|P40123|CAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,3-UNIMOD:35	ms_run[1]:scan=7937	31.7741453288	2	1317.6252	1316.6392	M	R	2	13
PSM	MELLGEYVGQEGKPQ	640	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8748	33.9442851392	2	1735.819331	1734.813453	-	K	1	16
PSM	AAATGDPGLS	641	sp|O95352-3|ATG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6708	28.288	2	900.41888	900.4189	M	K	2	12
PSM	AAEEEEVDSADTGE	642	sp|Q8WTS1|ABHD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6793	28.589	2	1492.5689	1492.5689	M	R	2	16
PSM	AALHTTPDSPAAQLE	643	sp|A6NFI3|ZN316_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7441	30.457	2	1562.7577	1562.7577	M	R	2	17
PSM	AASQAVEEM	644	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6079	26.026	2	992.41208	992.4121	M	R	2	11
PSM	ADKEAFDDAVEE	645	sp|Q09028-2|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7294	30.065	2	1379.5729	1379.5729	M	R	2	14
PSM	AGDTHCPAEPLA	646	sp|Q8N371-2|KDM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6626	28.008	2	1279.5503	1279.5503	M	R	2	14
PSM	AGSVADSDAVV	647	sp|Q3ZCW2|LEGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7678	31.092	2	1031.4771	1031.4771	M	K	2	13
PSM	ALETVPKDL	648	sp|P63272|SPT4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=8402	32.98	2	1026.5597	1026.5597	M	R	2	11
PSM	ALNVAPVRDT	649	sp|Q5VZF2-3|MBNL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7241	29.918	2	1096.5877	1096.5877	M	K	2	12
PSM	ANQVNGNAVQL	650	sp|O43390-3|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7963	31.845	2	1168.5836	1168.5837	M	K	2	13
PSM	ASPAASSVRPP	651	sp|Q9H875|PKRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6480	27.518	2	1080.5564	1080.5564	M	R	2	13
PSM	GVQVETISPGDG	652	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6606	27.936	2	1157.5564	1157.5564	M	R	2	14
PSM	MDPQRSPLLEV	653	sp|Q9BW19|KIFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8474	33.203	2	1341.6599	1341.6599	-	K	1	12
PSM	MEADASVDMFS	654	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7724	31.212	2	1275.4635	1275.4635	-	K	1	12
PSM	MEDVNSNVNADQEV	655	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6845	28.753	2	1620.6573	1620.6573	-	R	1	15
PSM	MEEDQELER	656	sp|P0DPB5|RPC22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6129	26.231	2	1235.4976	1235.4976	-	K	1	10
PSM	MEELSADEIR	657	sp|O95155-2|UBE4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=8300	32.704	2	1233.5547	1233.5547	-	R	1	11
PSM	MENGYTYEDY	658	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7933	31.762	2	1341.4707	1341.4707	-	K	1	11
PSM	MEPAEQPSELVSAEG	659	sp|P47224|MSS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=8593	33.527	2	1614.7083	1614.7083	-	R	1	16
PSM	MEQANPLRPDGES	660	sp|Q9BU64|CENPO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6538	27.699	2	1500.6515	1500.6515	-	K	1	14
PSM	MEQEPQNGEPAEI	661	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7216	29.865	2	1528.6352	1528.6352	-	K	1	14
PSM	METEQPEETFPNTETNGEFG	662	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8400	32.974	2	2343.9325	2343.9325	-	K	1	21
PSM	METILEQQR	663	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6961	29.096	2	1204.5758	1204.5758	-	R	1	10
PSM	METMASPGKDNY	664	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6453	27.428	2	1400.5588	1400.5588	-	R	1	13
PSM	MEVAANCSL	665	sp|Q96RS6|NUDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=7403	30.356	2	1051.4314	1051.4314	-	R	1	10
PSM	MLQNVTPHN	666	sp|P25440|BRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6427	27.335	2	1110.5128	1110.5128	-	K	1	10
PSM	MMCGAPSATQPATAETQHIADQV	667	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=7676	31.089	3	2472.0719	2472.0719	-	R	1	24
PSM	MNIMDFNVK	668	sp|Q9Y371|SHLB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=7423	30.408	2	1184.5206	1184.5206	-	K	1	10
PSM	MNNTAASPMSTATSSSG	669	sp|O75486|SUPT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5557	23.73	2	1687.6665	1687.6665	-	R	1	18
PSM	MNQPPQIAPK	670	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6170	26.388	2	1180.591	1180.5910	-	R	1	11
PSM	MSLIINTFYSN	671	sp|Q58FF6|H90B4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=8844	34.207	2	1317.6275	1317.6275	-	K	1	12
PSM	MTMDKSELVQ	672	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6810	28.638	2	1238.5523	1238.5523	-	K	1	11
PSM	SAAEAGGVFH	673	sp|Q9BRF8-3|CPPED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7061	29.406	2	986.44576	986.4458	M	R	2	12
PSM	SAATHSPMMQVASGNGD	674	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,8-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5670	24.282	2	1733.6985	1733.6985	M	R	2	19
PSM	SAQGDCEFLVQ	675	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=8721	33.864	2	1294.55	1294.5500	M	R	2	13
PSM	SDAAVDTSSEITT	676	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7049	29.378	2	1337.5834	1337.5834	M	K	2	15
PSM	SETAPAAPAAAPPAE	677	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=9295	35.438	2	1391.6569	1391.6569	M	K	2	17
PSM	SGDEMIFDPTMSK	678	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=7530	30.692	2	1530.6218	1530.6218	M	K	2	15
PSM	SREMQDVDLAEV	679	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7528	30.687	2	1448.6453	1448.6453	M	K	2	14
PSM	SYAEKPDEIT	680	sp|Q9NWU2|GID8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6601	27.926	2	1193.5452	1193.5452	M	K	2	12
PSM	TDSKYFTTT	681	sp|Q10567-4|AP1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7063	29.41	2	1104.4975	1104.4975	M	K	2	11
PSM	TECFLPPTSSPSEH	682	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=7913	31.696	2	1629.6981	1629.6981	M	R	2	16
PSM	TTANCGAHDELDF	683	sp|Q12968-5|NFAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=8055	32.074	2	1491.5936	1491.5936	M	K	2	15
PSM	VQAWYMDDAPGDP	684	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=7614	30.922	2	1479.5976	1479.5976	M	R	2	15
PSM	SETAPAAPAAAPPAE	685	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=9617	36.53050536986667	2	1391.6583	1391.6564	M	K	2	17
PSM	AASQAVEEM	686	sp|O15160|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=6074	26.003308827466665	2	992.4119	992.4116	M	R	2	11
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	687	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7208	29.841668753066664	3	2679.3285	2679.3247	M	R	2	31
PSM	MHPAGLAAAAAGTP	688	sp|Q5BJH7|YIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6909	28.953132948533334	2	1292.618594	1292.618322	-	R	1	15
PSM	SGPTWLPPKQPEPA	689	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7866	31.5739987792	2	1545.7855	1545.7822	M	R	2	16
PSM	ADKEAAFDDAVEE	690	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=6933	29.011757590933332	2	1451.6342	1450.6092	M	R	2	15
PSM	SADAAAGAPLP	691	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7737	31.2415947248	2	981.4766	981.4762	M	R	2	13
PSM	MEEVPHDCPGADSAQAG	692	sp|P53384|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=6115	26.174813974933333	2	1827.706263	1827.703979	-	R	1	18
PSM	AAAAELSLLE	693	sp|O43324-2|MCA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9000	34.51	2	1028.539	1028.5390	M	K	2	12
PSM	AAAMDVDTPSGTNSGAG	694	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6227	26.606	2	1578.6468	1578.6468	M	K	2	19
PSM	AAEADGPLK	695	sp|O75352-2|MPU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6338	27	2	912.45526	912.4553	M	R	2	11
PSM	AAPEGSGLGEDA	696	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6917	28.972	2	1114.4778	1114.4778	M	R	2	14
PSM	AAQGEPQVQF	697	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8498	33.271	2	1115.5247	1115.5247	M	K	2	12
PSM	AAVDLEKL	698	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8699	33.811	2	899.4964	899.4964	M	R	2	10
PSM	ADAAASPVGK	699	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5849	25.081	2	927.46616	927.4662	M	R	2	12
PSM	ADKPDMGEIASFD	700	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8295	32.694	2	1436.613	1436.6130	M	K	2	15
PSM	ADPKYADLPGIA	701	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8339	32.81	2	1271.6398	1271.6398	M	R	2	14
PSM	AEDMETKI	702	sp|P14854|CX6B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6250	26.685	2	993.43248	993.4325	M	K	2	10
PSM	AGAATQASLESAP	703	sp|Q9BXR0-2|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7390	30.32	2	1214.5779	1214.5779	M	R	2	15
PSM	ANNDAVLK	704	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6158	26.347	1	885.4556	885.4556	M	R	2	10
PSM	APDPVAAETAAQGPTP	705	sp|O60427|FADS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6715	28.32	2	1491.7205	1491.7205	M	R	2	18
PSM	ASLSLAPVNIF	706	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9021	34.563	2	1172.6441	1172.6441	M	K	2	13
PSM	ATTATMATSGSA	707	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6499	27.592	2	1110.4863	1110.4863	M	R	2	14
PSM	ATTATMATSGSAR	708	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6037	25.854	2	1266.5874	1266.5874	M	K	2	15
PSM	AVSTGVKVP	709	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7126	29.611	2	898.51238	898.5124	M	R	2	11
PSM	GDTSEDASIH	710	sp|Q92620-2|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5771	24.737	2	1072.4309	1072.4309	M	R	2	12
PSM	MDDDKPFQP	711	sp|Q8ND82|Z280C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6874	28.842	2	1149.4648	1149.4648	-	K	1	10
PSM	MDNLSSEEIQQ	712	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8110	32.222	2	1334.566	1334.5660	-	R	1	12
PSM	MDSLEEPQK	713	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6057	25.936	2	1133.4911	1133.4911	-	K	1	10
PSM	MECPHLSSSVCIAPDSA	714	sp|Q9Y6I4-2|UBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7498	30.615	2	1917.7907	1917.7907	-	K	1	18
PSM	MEDSMDMDMSPL	715	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7885	31.624	2	1490.4921	1490.4921	-	R	1	13
PSM	MEDYTKIE	716	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6730	28.378	2	1085.4587	1085.4587	-	K	1	9
PSM	MEGPLSVFGD	717	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9065	34.699	2	1092.4798	1092.4798	-	R	1	11
PSM	MEPAPGLVEQP	718	sp|Q96EY9|ADAT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7867	31.575	2	1224.5696	1224.5696	-	K	1	12
PSM	MEQPGQDPTSDDVMDSFLE	719	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=8901	34.342	2	2213.8617	2213.8617	-	K	1	20
PSM	MEQVNELKE	720	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6458	27.441	2	1176.5333	1176.5333	-	K	1	10
PSM	MESAIAEGGAS	721	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7861	31.565	2	1063.4492	1063.4492	-	R	1	12
PSM	METESEQNSNSTNGSSSSGGSS	722	sp|P78364|PHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5087	21.709	2	2220.8197	2220.8197	-	R	1	23
PSM	METILEQQR	723	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8611	33.565	2	1188.5809	1188.5809	-	R	1	10
PSM	MHFSIPETES	724	sp|Q15036-2|SNX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7495	30.604	2	1234.5176	1234.5176	-	R	1	11
PSM	MKETIMNQE	725	sp|P20290-2|BTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=5655	24.208	2	1196.5053	1196.5053	-	K	1	10
PSM	MLEELECGAPGA	726	sp|Q13111-2|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=8770	34.01	2	1333.553	1333.5530	-	R	1	13
PSM	MLGTEGGEGFVV	727	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=8289	32.678	2	1210.554	1210.5540	M	K	2	14
PSM	MMTSVSSDHC	728	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=5438	23.163	2	1227.4206	1227.4206	-	R	1	11
PSM	MNDTVTIRT	729	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6565	27.779	2	1107.523	1107.5230	-	R	1	10
PSM	MNGEADCPTDLEMAAP	730	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=7584	30.827	2	1794.6747	1794.6747	-	K	1	17
PSM	MQGGEPVSTM	731	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5799	24.86	2	1109.4369	1109.4369	-	K	1	11
PSM	MTMDKSELVQ	732	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6687	28.205	2	1238.5523	1238.5523	-	K	1	11
PSM	MVDMMDLPRS	733	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=6529	27.669	2	1283.5196	1283.5196	-	R	1	11
PSM	PDPAKSAPAP	734	sp|Q93079|H2B1H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5949	25.509	2	991.49746	991.4975	M	K	2	12
PSM	PEFLEDPSVLT	735	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8798	34.096	2	1245.6129	1245.6129	M	K	2	13
PSM	PLPEPSEQEGESV	736	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6746	28.43	2	1396.6358	1396.6358	M	K	2	15
PSM	PYQYPALTPEQ	737	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7410	30.375	2	1305.6241	1305.6241	M	K	2	13
PSM	PYQYPALTPEQ	738	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7555	30.756	2	1305.6241	1305.6241	M	K	2	13
PSM	SDLQAAEGPGSWSPTA	739	sp|Q6PL24|TMED8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8735	33.907	2	1614.7162	1614.7162	M	R	2	18
PSM	SDSGEQNYGE	740	sp|P62995|TRA2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5915	25.379	2	1126.4051	1126.4051	M	R	2	12
PSM	SDTAVADTR	741	sp|Q9UMY4-3|SNX12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5738	24.594	2	976.44615	976.4462	M	R	2	11
PSM	SEKENNFPPLP	742	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8241	32.555	2	1312.6299	1312.6299	M	K	2	13
PSM	SGSSSVAAMK	743	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=5152	21.988	2	981.44371	981.4437	M	K	2	12
PSM	TSALTQGLE	744	sp|Q0VGL1|LTOR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8578	33.487	2	960.47639	960.4764	M	R	2	11
PSM	VFFTCNACGESV	745	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7975	31.875	2	1389.5693	1389.5693	M	K	2	14
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	746	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=6979	29.155046152	3	2681.2162	2680.1802	M	R	2	29
PSM	AENGESSGPPRPS	747	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=5717	24.496866974933333	2	1326.5742	1325.5842	M	R	2	15
PSM	MNDTVTIRT	748	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6557	27.757676534933335	2	1107.522975	1107.523024	-	R	1	10
PSM	AEDMETKI	749	sp|P14854|CX6B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,4-UNIMOD:35	ms_run[1]:scan=6228	26.609273536	2	993.4323	993.4320	M	K	2	10
PSM	AGLNSLEAVK	750	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=7852	31.54508437946667	2	1043.5852	1042.5652	M	R	2	12
PSM	SGELPPNINIKEP	751	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=8477	33.211756646666664	2	1448.7527	1448.7506	M	R	2	15
PSM	SLVIRNLQ	752	sp|P58557|YBEY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=8494	33.2579771208	2	983.5764	983.5759	M	R	2	10
PSM	SAADEVDGLGVA	753	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=8581	33.494357007733335	2	1144.5252	1144.5243	M	R	2	14
PSM	AAAAAAAPSGGGGGGEEE	754	sp|P51608-2|MECP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6148	26.306	2	1470.6223	1470.6223	M	R	2	20
PSM	AAAAVSSAK	755	sp|P49914|MTHFS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5862	25.136	2	816.43413	816.4341	M	R	2	11
PSM	AAEAAGGKY	756	sp|Q96A65-2|EXOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6132	26.245	2	878.4134	878.4134	M	R	2	11
PSM	AALVLEDGSVL	757	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=9029	34.587	2	1127.6074	1127.6074	M	R	2	13
PSM	AAVLQQVLE	758	sp|P12270-2|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=9009	34.526	2	1011.5601	1011.5601	M	R	2	11
PSM	AAVTMSVPGR	759	sp|Q7Z406-5|MYH14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=6367	27.096	2	1045.5226	1045.5226	M	K	2	12
PSM	ADAAPQLGK	760	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6268	26.741	2	911.47125	911.4712	M	R	2	11
PSM	ADGQVAELLL	761	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=9006	34.522	2	1069.5655	1069.5655	M	R	2	12
PSM	ADNLSDTLK	762	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7106	29.556	2	1017.4979	1017.4979	M	K	2	11
PSM	AEAEEDCHSDTV	763	sp|Q9UK97-2|FBX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=6069	25.987	2	1403.5147	1403.5147	M	R	2	14
PSM	AENSVLTSTTG	764	sp|Q9H8V3-2|ECT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7379	30.287	2	1120.5248	1120.5248	M	R	2	13
PSM	AGAQPGVHALQL	765	sp|Q9NQ66-2|PLCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8234	32.538	2	1202.6408	1202.6408	M	K	2	14
PSM	AGNAEPPPAGAACPQD	766	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=6286	26.797	2	1563.6624	1563.6624	M	R	2	18
PSM	AGPGPGAVLESP	767	sp|Q5T447|HECD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8395	32.96	2	1092.5451	1092.5451	M	R	2	14
PSM	AKPLTDQE	768	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5991	25.672	2	942.46583	942.4658	M	K	2	10
PSM	ALDPADQHL	769	sp|Q7Z7K0|COXM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7698	31.148	2	1020.4876	1020.4876	M	R	2	11
PSM	AMTGSTPCSSMSNHT	770	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=5442	23.181	2	1641.6069	1641.6069	M	K	2	17
PSM	ATSGANGPGSATASASNP	771	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6014	25.761	2	1558.6859	1558.6859	M	R	2	20
PSM	AVPPTYADLGKSA	772	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7728	31.222	2	1330.6769	1330.6769	M	R	2	15
PSM	GNRGMEELIPLVN	773	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=8658	33.694	2	1498.745	1498.7450	M	K	2	15
PSM	MDEVEQDQHEA	774	sp|Q8N4C6-6|NIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5885	25.235	2	1387.5198	1387.5198	-	R	1	12
PSM	MDGGDDGNLIIK	775	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7251	29.946	2	1304.5918	1304.5918	-	K	1	13
PSM	MDNLSDTLK	776	sp|P52306-2|GDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6895	28.911	2	1093.4961	1093.4961	-	K	1	10
PSM	MDPLFQQTH	777	sp|O14653-3|GOSR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8817	34.144	2	1157.5175	1157.5175	-	K	1	10
PSM	MDSNTAPLGPSCPQPPPAPQPQA	778	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7459	30.501	3	2415.0835	2415.0835	-	R	1	24
PSM	MDSTLTASEI	779	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8178	32.395	2	1124.4907	1124.4907	-	R	1	11
PSM	MDVTSSSGGGGDP	780	sp|Q8IY22|CMIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5864	25.145	2	1223.4612	1223.4612	-	R	1	14
PSM	MEDYTKIE	781	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7768	31.318	2	1069.4638	1069.4638	-	K	1	9
PSM	MEGPLSVFGD	782	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8988	34.486	2	1108.4747	1108.4747	-	R	1	11
PSM	MEPAMEPETLEA	783	sp|Q9UJY5-5|GGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=7406	30.361	2	1420.5738	1420.5738	-	R	1	13
PSM	METILEQQ	784	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7742	31.259	2	1048.4747	1048.4747	-	R	1	9
PSM	MLGSGFKAE	785	sp|P53990-2|IST1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7133	29.623	2	996.45863	996.4586	-	R	1	10
PSM	MTQQGAALQNYNNELV	786	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8576	33.481	2	1850.8469	1850.8469	-	K	1	17
PSM	PLENLEEEGLP	787	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8468	33.184	2	1238.603	1238.6030	M	K	2	13
PSM	SAEVETSEGVDESE	788	sp|P30519|HMOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6682	28.186	2	1508.6002	1508.6002	M	K	2	16
PSM	SGASSSEQNNNSYET	789	sp|O60825-2|F262_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5827	24.989	2	1615.6234	1615.6234	M	K	2	17
PSM	SGSMATAEASGSDG	790	sp|O43169|CYB5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=5504	23.473	2	1284.4776	1284.4776	M	K	2	16
PSM	SGSSSVAAMK	791	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=5148	21.971	2	981.44371	981.4437	M	K	2	12
PSM	SHTILLVQPT	792	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8182	32.405	2	1149.6394	1149.6394	M	K	2	12
PSM	SQERPTFY	793	sp|Q16539-5|MK14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7359	30.241	2	1068.4876	1068.4876	M	R	2	10
PSM	SQPPLLPASAET	794	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8373	32.887	2	1251.6347	1251.6347	M	R	2	14
PSM	SSGASASALQ	795	sp|P50151|GBG10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6226	26.604	2	919.42469	919.4247	M	R	2	12
PSM	STADALDDENTF	796	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8622	33.594	2	1339.5416	1339.5416	M	K	2	14
PSM	STGGDFGNPLR	797	sp|P20340-3|RAB6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7450	30.477	2	1161.5415	1161.5415	M	K	2	13
PSM	SYIPGQPVTAVVQ	798	sp|O14907|TX1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8905	34.353	2	1399.7347	1399.7347	M	R	2	15
PSM	TLEAIRYS	799	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7986	31.907	2	993.51311	993.5131	M	R	2	10
PSM	TMDKSELVQ	800	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=6136	26.258	2	1107.5118	1107.5118	M	K	2	11
PSM	TTETFVKDI	801	sp|Q9BQ15|SOSB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8507	33.296	2	1094.5496	1094.5496	M	K	2	11
PSM	TTPNKTPPGADP	802	sp|Q9UM13|APC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5820	24.959	2	1236.5986	1236.5986	M	K	2	14
PSM	VDHLANTEINSQ	803	sp|Q96S99|PKHF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7221	29.876	2	1381.6474	1381.6474	M	R	2	14
PSM	VMEKPSPLLVG	804	sp|Q13283-2|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=8140	32.294	2	1226.6581	1226.6581	M	R	2	13
PSM	DDDIAALVVDNGSGMC	805	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=9607	36.4937745376	2	1692.6979	1692.6966	M	K	2	18
PSM	AAQIPIVATTSTPGIVRNS	806	sp|Q6PI98|IN80C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=8514	33.31995205973333	2	1937.0611	1937.0577	M	K	2	21
PSM	MDETVAEFIK	807	sp|Q96H22|CENPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8617	33.5804187176	2	1239.570705	1239.569306	-	R	1	11
PSM	MEESVNQMQPLNE	808	sp|P10155|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=6698	28.243517097599998	2	1623.664078	1621.659989	-	K	1	14
PSM	AAAAEGVLAT	809	sp|Q6QNY1|BL1S2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8428	33.068	2	914.47091	914.4709	M	R	2	12
PSM	AAEEPQQQ	810	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5534	23.62	2	941.40904	941.4090	M	K	2	10
PSM	AAMAVGGAGGS	811	sp|O14744-5|ANM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=5958	25.551	2	905.39128	905.3913	M	R	2	13
PSM	AAPSDGFKP	812	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6859	28.799	2	930.4447	930.4447	M	R	2	11
PSM	AAPVDLELK	813	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8050	32.066	2	996.54916	996.5492	M	K	2	11
PSM	ADQGEKENPM	814	sp|P62913-2|RL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=5145	21.959	2	1175.4765	1175.4765	M	R	2	12
PSM	AESSDKLY	815	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6720	28.338	2	953.43419	953.4342	M	R	2	10
PSM	AGITTIEAVK	816	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7852	31.545	2	1043.5863	1043.5863	M	R	2	12
PSM	AGMVDFQDEEQV	817	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=8317	32.746	2	1424.5766	1424.5766	M	K	2	14
PSM	ARPLVPSSQ	818	sp|P49427|UB2R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6500	27.594	2	995.53999	995.5400	M	K	2	11
PSM	ASESETLNPSA	819	sp|O75164|KDM4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6780	28.541	2	1146.5041	1146.5041	M	R	2	13
PSM	ASGVAVSDGVI	820	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8732	33.899	2	1015.5186	1015.5186	M	K	2	13
PSM	ASSSGNDDDLTIP	821	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8561	33.431	2	1332.5681	1332.5681	M	R	2	15
PSM	ASSSGNDDDLTIP	822	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8706	33.824	2	1332.5681	1332.5681	M	R	2	15
PSM	ASVTLSEAE	823	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7633	30.964	2	947.44476	947.4448	M	K	2	11
PSM	ATATPVPPRMGS	824	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=5965	25.567	2	1241.6074	1241.6074	M	R	2	14
PSM	ATETVELH	825	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6642	28.057	2	940.45018	940.4502	M	K	2	10
PSM	ATKAVCVL	826	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=7562	30.77	2	902.48954	902.4895	M	K	2	10
PSM	ATSLGSNTYN	827	sp|Q9NW64-2|RBM22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6950	29.069	2	1068.4724	1068.4724	M	R	2	12
PSM	CNTPTYCDLGKAA	828	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7115	29.589	2	1511.6385	1511.6385	M	K	2	15
PSM	MEAYEQVQ	829	sp|Q9Y421-2|FA32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6777	28.533	2	1054.4277	1054.4277	-	K	1	9
PSM	MEDEVVRFA	830	sp|P23193-2|TCEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8084	32.148	2	1152.5121	1152.5121	-	K	1	10
PSM	MEDSMDMDMSPL	831	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7170	29.738	2	1506.487	1506.4870	-	R	1	13
PSM	MEDSMDMDMSPL	832	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=8171	32.383	2	1490.4921	1490.4921	-	R	1	13
PSM	MEDSMDMDMSPL	833	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=8843	34.205	2	1474.4972	1474.4972	-	R	1	13
PSM	MEEASEGGGND	834	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5269	22.457	2	1152.3877	1152.3877	-	R	1	12
PSM	MEEVVIAGMSG	835	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=9007	34.523	2	1163.5202	1163.5202	-	K	1	12
PSM	MESGPRAELGAGAPPAVVA	836	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7570	30.792	2	1836.904	1836.9040	-	R	1	20
PSM	METEQPEETFPNTETNGEFG	837	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8526	33.351	2	2343.9325	2343.9325	-	K	1	21
PSM	MEYMAESTD	838	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6137	26.26	2	1149.3842	1149.3842	-	R	1	10
PSM	MFPAAPSP	839	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8172	32.385	1	874.38949	874.3895	-	R	1	9
PSM	MIVADSEC	840	sp|P58004|SESN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6978	29.151	2	981.37833	981.3783	-	R	1	9
PSM	MLAAGVGGQGE	841	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8604	33.551	2	1030.4753	1030.4753	-	R	1	12
PSM	MMPSRTNLATGIPSS	842	sp|Q96A57|TM230_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=6893	28.905	2	1635.7596	1635.7596	-	K	1	16
PSM	MMQICDTYNQ	843	sp|Q9NPA3|M1IP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6799	28.604	2	1376.5047	1376.5047	-	K	1	11
PSM	MNYQQQLANSAAI	844	sp|Q9UPQ3-3|AGAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8510	33.309	2	1508.6929	1508.6929	-	R	1	14
PSM	MTLEAIRYS	845	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7833	31.486	2	1140.5485	1140.5485	-	R	1	10
PSM	PLENLEEEGLP	846	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8337	32.806	2	1238.603	1238.6030	M	K	2	13
PSM	SDAAVDTSSEITTKDL	847	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7645	30.992	2	1693.7894	1693.7894	M	K	2	18
PSM	SDTWSSIQAH	848	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7463	30.515	2	1172.5098	1172.5098	M	K	2	12
PSM	SETAPAAPAAAPPAE	849	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8364	32.861	2	1391.6569	1391.6569	M	K	2	17
PSM	STPAVPQDLQLPPSQ	850	sp|Q8WWK9-5|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8530	33.358	2	1618.8203	1618.8203	M	R	2	17
PSM	STVHEILC	851	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=7533	30.698	2	999.46953	999.4695	M	K	2	10
PSM	SVPGPSSPDGALT	852	sp|Q9UL45-2|BL1S6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7583	30.824	2	1225.5826	1225.5826	M	R	2	15
PSM	SYNYVVTAQ	853	sp|Q16531-2|DDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7995	31.934	2	1085.5029	1085.5029	M	K	2	11
PSM	TAVHAGNINF	854	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7962	31.842	2	1084.5302	1084.5302	M	K	2	12
PSM	TENSTSAPAA	855	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5684	24.352	2	989.43017	989.4302	M	K	2	12
PSM	TGYTPDEKL	856	sp|O95139-2|NDUB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7093	29.502	2	1064.5026	1064.5026	M	R	2	11
PSM	TSLAQQLQ	857	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8226	32.517	2	929.48181	929.4818	M	R	2	10
PSM	TTSASSHLN	858	sp|P15104|GLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5672	24.289	2	958.43559	958.4356	M	K	2	11
PSM	VEKEEAGGGISEEEAAQYD	859	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7107	29.56	2	2051.8807	2051.8807	M	R	2	21
PSM	MEQEPQNGEPAEIKII	860	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8461	33.160753116	2	1883.886582	1882.898245	-	R	1	17
PSM	SDNGELEDKPPAPPV	861	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=7373	30.272396996266664	2	1606.7402	1605.7522	M	R	2	17
PSM	MEKPSPLLVG	862	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7701	31.153422597333336	2	1127.5894	1127.5891	V	R	3	13
PSM	AEGTAEAPLENGGGGDSGAGALE	863	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=7915	31.6998584864	2	2071.8852	2070.8972	M	R	2	25
PSM	MELVQVLK	864	sp|Q9UI09|NDUAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8777	34.0335387608	2	1016.558326	1016.557619	-	R	1	9
PSM	AECGASGSGSSGDSLD	865	sp|Q9NVE7|PANK4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=6269	26.7431270112	2	1497.5752	1497.5522	M	K	2	18
PSM	AEQSDEAVKYYTLEEIQ	866	sp|P00167|CYB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=8760	33.981680638933334	2	2057.9552	2056.9472	M	K	2	19
PSM	ASVAVDPQPSVVT	867	sp|Q99541|PLIN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=7871	31.585432069333333	2	1310.6734	1310.6713	M	R	2	15
PSM	MEDSMDMDMSPL	868	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=7887	31.627988760533334	2	1507.519010	1506.487035	-	R	1	13
PSM	MEDSMDMDMSPL	869	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=8859	34.24196432506667	2	1491.525211	1490.492120	-	R	1	13
PSM	PLENLEEEGLP	870	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=8326	32.771768404	2	1238.6040	1238.6025	M	K	2	13
PSM	AATTGSGVKVP	871	sp|Q13404|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=6797	28.600777165066667	2	1028.5498	1028.5497	M	R	2	13
PSM	MEDCLHTSSENLS	872	sp|Q8N8K9|K1958_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	ms_run[1]:scan=6515	27.62695438213333	2	1579.615157	1579.613038	-	K	1	14
PSM	AAAAGGPCV	873	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=6832	28.717	2	814.36434	814.3643	M	R	2	11
PSM	AAAGAAATHLEVA	874	sp|Q96S52|PIGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7453	30.485	2	1193.6041	1193.6041	M	R	2	15
PSM	AAAVAMETDDAGN	875	sp|Q9Y3C7|MED31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=6909	28.953	2	1292.5191	1292.5191	M	R	2	15
PSM	AADKPADQGAE	876	sp|Q9H9A5-4|CNO10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5320	22.67	2	1113.4938	1113.4938	M	K	2	13
PSM	AASQAVEEM	877	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7793	31.387	2	976.41716	976.4172	M	R	2	11
PSM	ADAAATAGAGGSGT	878	sp|Q7Z7C8|TAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5959	25.553	2	1118.484	1118.4840	M	R	2	16
PSM	ADPHQLFDDTSSAQS	879	sp|Q5BJH7-2|YIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7771	31.325	2	1659.7013	1659.7013	M	R	2	17
PSM	AELDQLPDESSSA	880	sp|Q5TKA1-3|LIN9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8392	32.954	2	1402.61	1402.6100	M	K	2	15
PSM	AENGDNEKMAALEA	881	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6274	26.758	2	1519.6461	1519.6461	M	K	2	16
PSM	AENPSLENH	882	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5980	25.627	2	1051.4571	1051.4571	M	R	2	11
PSM	AETVADTR	883	sp|O60493-3|SNX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5926	25.418	2	903.42977	903.4298	M	R	2	10
PSM	AEVEETLK	884	sp|Q9NP97-2|DLRB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7083	29.471	2	959.48114	959.4811	M	R	2	10
PSM	AGLSDLELR	885	sp|Q8NC56|LEMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8601	33.542	2	1014.5346	1014.5346	M	R	2	11
PSM	AKPQVVVAPVLMS	886	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=7953	31.82	2	1395.7796	1395.7796	M	K	2	15
PSM	ALKDYALE	887	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7985	31.904	2	963.49131	963.4913	M	K	2	10
PSM	AQVAMSTLPVEDEESSES	888	sp|P78347-5|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=7825	31.46	2	1965.8361	1965.8361	M	R	2	20
PSM	ASGVTVNDEVI	889	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8678	33.753	2	1144.5612	1144.5612	M	K	2	13
PSM	ASPSLERPE	890	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6378	27.142	2	1026.4982	1026.4982	M	K	2	11
PSM	ATAATSPALK	891	sp|Q8WTW3|COG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6173	26.395	2	971.52876	971.5288	M	R	2	12
PSM	ATATIALGTDSIKMENGQSTAA	892	sp|Q9UHX1-6|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=7945	31.799	3	2208.058	2208.0580	M	K	2	24
PSM	ATNFLAHE	893	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8040	32.043	2	943.43995	943.4399	M	K	2	10
PSM	GAVTDDEVIR	894	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6906	28.947	2	1115.5459	1115.5459	M	K	2	12
PSM	GDEMDAMIPE	895	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6940	29.034	2	1180.4264	1180.4264	M	R	2	12
PSM	GVQVETISPGDG	896	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7715	31.191	2	1199.567	1199.5670	M	R	2	14
PSM	MDDIFTQC	897	sp|Q13418-2|ILK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8656	33.69	2	1086.3998	1086.3998	-	R	1	9
PSM	MDEMATTQIS	898	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6303	26.865	2	1199.4686	1199.4686	-	K	1	11
PSM	MDKNELVQ	899	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6863	28.813	2	1017.4801	1017.4801	-	K	1	9
PSM	MDKSELVQ	900	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6843	28.746	2	990.4692	990.4692	-	K	1	9
PSM	MDQVMQFVEPS	901	sp|P60059|SC61G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8118	32.244	2	1383.5687	1383.5687	-	R	1	12
PSM	MDTLDRVV	902	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7743	31.262	2	1005.4801	1005.4801	-	K	1	9
PSM	MEETQPPPQP	903	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6270	26.745	2	1210.5176	1210.5176	-	K	1	11
PSM	MEGCVSNLMVCNLAYSG	904	sp|O75832-2|PSD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=8829	34.175	2	1977.7941	1977.7941	-	K	1	18
PSM	MEKTELIQ	905	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6609	27.947	2	1048.5111	1048.5111	-	K	1	9
PSM	MEKTELIQ	906	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7412	30.38	2	1032.5161	1032.5161	-	K	1	9
PSM	MELPSGPGPE	907	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7227	29.89	2	1070.459	1070.4590	-	R	1	11
PSM	MELVQVLK	908	sp|Q9UI09-2|NDUAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8787	34.069	2	1016.5576	1016.5576	-	R	1	9
PSM	MEQEPQNGEPAEI	909	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7287	30.052	2	1528.6352	1528.6352	-	K	1	14
PSM	MESEMETQSA	910	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=5524	23.573	2	1215.4271	1215.4271	-	R	1	11
PSM	MEVDAPGVDG	911	sp|Q8WVX3|CD003_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6788	28.567	2	1046.4226	1046.4226	-	R	1	11
PSM	MVADPPRDS	912	sp|Q15758|AAAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5750	24.651	2	1044.4546	1044.4546	-	K	1	10
PSM	MVGFGAN	913	sp|Q6P4E1-3|GOLM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7520	30.673	1	752.31633	752.3163	-	R	1	8
PSM	PMFIVNTNVP	914	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8831	34.182	2	1130.5794	1130.5794	M	R	2	12
PSM	SAPAGSSHPAASA	915	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5502	23.465	2	1151.5207	1151.5207	M	R	2	15
PSM	SASSLLEQ	916	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8229	32.522	2	875.42363	875.4236	M	R	2	10
PSM	SDKPDLSEVE	917	sp|P0CG35|TB15B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6763	28.482	2	1159.5245	1159.5245	M	K	2	12
PSM	SDQDHSMDEMTAVV	918	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=6272	26.751	2	1637.6185	1637.6185	M	K	2	16
PSM	SETAPAAPAAAPPAE	919	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=9232	35.239	2	1391.6569	1391.6569	M	K	2	17
PSM	SGALDVLQM	920	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8987	34.485	2	974.47428	974.4743	M	K	2	11
PSM	SGELPPNINIKEP	921	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8196	32.436	2	1448.7511	1448.7511	M	R	2	15
PSM	SLEQEEETQPG	922	sp|Q6P4A7-2|SFXN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6787	28.564	2	1287.5467	1287.5467	M	R	2	13
PSM	SSVQQQPPPP	923	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6169	26.385	2	1105.5404	1105.5404	M	R	2	12
PSM	STRESFNPESYELD	924	sp|P49903-2|SPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8230	32.524	2	1714.7322	1714.7322	M	K	2	16
PSM	SYGRPPPDVEGMTSL	925	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8382	32.921	2	1646.761	1646.7610	M	K	2	17
PSM	THSLVCPETVS	926	sp|Q86WQ0|NR2CA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6997	29.212	2	1270.5864	1270.5864	M	R	2	13
PSM	VDMMDLPRS	927	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6655	28.083	2	1136.4842	1136.4842	M	R	2	11
PSM	VDMMDLPRS	928	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=7644	30.99	2	1120.4893	1120.4893	M	R	2	11
PSM	VDMMDLPRS	929	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7834	31.488	2	1120.4893	1120.4893	M	R	2	11
PSM	VDYYEVLGVQ	930	sp|O75190-2|DNJB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8836	34.191	2	1183.5761	1183.5761	M	R	2	12
PSM	VEEENIRVV	931	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7872	31.588	2	1127.5823	1127.5823	M	R	2	11
PSM	PSVPAAEPEYP	932	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=6913	28.960045347733335	2	1155.5451	1155.5443	A	K	3	14
PSM	AFAETYPAASSLPNGDCGRP	933	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,17-UNIMOD:4	ms_run[1]:scan=8615	33.575600001333335	2	2122.9312	2121.9422	M	R	2	22
PSM	TAEVLNIGK	934	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=8019	31.995021150933333	2	943.5331	943.5333	A	K	3	12
PSM	MADEELEALR	935	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7967	31.854611736	2	1233.557385	1233.554719	-	R	1	11
PSM	ADTTPNGPQGAGAVQFMMTN	936	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=7409	30.371765130933333	3	2080.8828	2080.8825	M	K	2	22
PSM	MESRDPAQPMSPGEATQSGA	937	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=5933	25.444223031466667	2	2120.886082	2119.878649	-	R	1	21
PSM	ASPAASSVRPP	938	sp|Q9H875|PKRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=6488	27.549583961066666	2	1080.5560	1080.5558	M	R	2	13
PSM	ASVGECPAPVPVKD	939	sp|P56134|ATPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=6786	28.562323232	2	1466.7089	1466.7070	M	K	2	16
PSM	AAQGEPQVQF	940	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=8701	33.814271471733335	2	1115.5252	1115.5242	M	K	2	12
PSM	PLENLEEEGLP	941	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=8315	32.74048715146667	2	1238.6040	1238.6025	M	K	2	13
PSM	MESMFSSPAEAALQ	942	sp|Q9BQC3|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=8388	32.94138974933333	2	1571.649613	1571.648361	-	R	1	15
PSM	MNGTLDHPDQPDLDAI	943	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8290	32.682103887733334	2	1809.775738	1808.788694	-	K	1	17
PSM	AAESGSDFQQ	944	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6488	27.55	2	1080.436	1080.4360	M	R	2	12
PSM	AAGELEGG	945	sp|Q8N668-2|COMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6811	28.639	1	744.329	744.3290	M	K	2	10
PSM	AAGVDCGDGVGA	946	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6721	28.339	2	1089.4397	1089.4397	M	R	2	14
PSM	AAIYGGVEGGGT	947	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8205	32.458	2	1092.5088	1092.5088	M	R	2	14
PSM	AAKVFESIG	948	sp|P35232-2|PHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8763	33.993	2	962.5073	962.5073	M	K	2	11
PSM	AANSSGQGFQN	949	sp|Q9NRY2-2|SOSSC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6090	26.065	2	1121.4738	1121.4738	M	K	2	13
PSM	AAPRPPPA	950	sp|Q9UBB4-2|ATX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5938	25.461	2	817.44464	817.4446	M	R	2	10
PSM	AAQGEPQVQF	951	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8644	33.662	2	1115.5247	1115.5247	M	K	2	12
PSM	AATLILEPAG	952	sp|Q86TX2|ACOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7930	31.749	2	954.5386	954.5386	M	R	2	12
PSM	AGSSEEAPDYG	953	sp|Q9NRG1-3|PRDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6459	27.444	2	1123.4306	1123.4306	M	R	2	13
PSM	AGSSTGGGGVGET	954	sp|O14641|DVL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5763	24.703	2	1077.4574	1077.4574	M	K	2	15
PSM	AGVSFSGH	955	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6800	28.606	2	802.36097	802.3610	M	R	2	10
PSM	AKPQVVVAPVLMS	956	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8733	33.902	2	1379.7847	1379.7847	M	K	2	15
PSM	ANEVIKC	957	sp|P11766|ADHX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=6455	27.434	2	874.42185	874.4219	M	K	2	9
PSM	ASAGVAAG	958	sp|Q9NWA0|MED9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5838	25.037	1	644.31295	644.3130	M	R	2	10
PSM	ASSGAGDPLDS	959	sp|Q9Y2R0|COA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6964	29.103	2	1017.4251	1017.4251	M	K	2	13
PSM	ASVAVDPQPSVVT	960	sp|Q99541|PLIN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7889	31.631	2	1310.6718	1310.6718	M	R	2	15
PSM	ATEAQSEGEVPA	961	sp|Q14CB8-5|RHG19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6523	27.652	2	1229.5412	1229.5412	M	R	2	14
PSM	ATYTCITC	962	sp|Q969S3|ZN622_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7630	30.959	1	1030.41	1030.4100	M	R	2	10
PSM	AVSTGVKVP	963	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7270	30.017	2	898.51238	898.5124	M	R	2	11
PSM	MAPSVPAAEPEYP	964	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8102	32.205	2	1415.6279	1415.6279	-	K	1	14
PSM	MDGSFVQHSV	965	sp|P10074|TZAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7044	29.36	2	1163.4917	1163.4917	-	R	1	11
PSM	MDKNELVQ	966	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6125	26.22	2	1033.475	1033.4750	-	K	1	9
PSM	MDKSELVQ	967	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6080	26.028	2	1006.4641	1006.4641	-	K	1	9
PSM	MDMGNQHPSIS	968	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=5838	25.037	2	1289.5016	1289.5016	-	R	1	12
PSM	MDPLFQQTH	969	sp|O14653-3|GOSR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7745	31.265	2	1173.5125	1173.5125	-	K	1	10
PSM	MDRGEQGLL	970	sp|P55327-2|TPD52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7281	30.042	2	1075.4968	1075.4968	-	R	1	10
PSM	MDVHDLF	971	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8677	33.751	2	933.39022	933.3902	-	R	1	8
PSM	MDVLVSECSA	972	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8018	31.994	2	1167.4788	1167.4788	-	R	1	11
PSM	MEDSMDMDMSPL	973	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7316	30.117	2	1506.487	1506.4870	-	R	1	13
PSM	MENFQKVE	974	sp|P24941-2|CDK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6535	27.687	2	1081.475	1081.4750	-	K	1	9
PSM	MENGAVYSPTTEEDPGPA	975	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7342	30.193	2	1921.7888	1921.7888	-	R	1	19
PSM	MESALTARD	976	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6219	26.579	2	1050.4652	1050.4652	-	R	1	10
PSM	MESEQLFH	977	sp|P51790-4|CLCN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7515	30.658	2	1077.4437	1077.4437	-	R	1	9
PSM	MEVKPPPG	978	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5925	25.416	2	911.44225	911.4423	-	R	1	9
PSM	MGDAPSPEE	979	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5903	25.322	2	989.36479	989.3648	-	K	1	10
PSM	MMLGTEGGEGFVV	980	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=9014	34.539	2	1367.6101	1367.6101	-	K	1	14
PSM	MNVTPEV	981	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7190	29.791	1	846.37932	846.3793	-	K	1	8
PSM	MQAHELF	982	sp|P33121-2|ACSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7943	31.792	2	932.4062	932.4062	-	R	1	8
PSM	MQTNEGEVSEESSS	983	sp|Q9UPQ9-2|TNR6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5805	24.888	2	1570.5941	1570.5941	-	K	1	15
PSM	MVGEEKMSL	984	sp|P35610|SOAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6406	27.253	2	1096.478	1096.4780	-	R	1	10
PSM	PLAQLADPWQ	985	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=8884	34.304	2	1137.5819	1137.5819	M	K	2	12
PSM	PMFIVNTNVP	986	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=8105	32.212	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	987	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=8248	32.574	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	988	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=8391	32.952	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	989	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=8532	33.362	2	1146.5743	1146.5743	M	R	2	12
PSM	SDQDHSMDEMTAVV	990	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8113	32.233	2	1605.6287	1605.6287	M	K	2	16
PSM	SGLSFSEMEGC	991	sp|Q5JPI3-2|CC038_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=8122	32.253	2	1260.4639	1260.4639	M	R	2	13
PSM	SSPQAPEDGQGCGD	992	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5784	24.79	2	1445.5365	1445.5365	M	R	2	16
PSM	SSVQQQPPPPR	993	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5676	24.311	2	1261.6415	1261.6415	M	R	2	13
PSM	TTEVGSVSEV	994	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=7621	30.937	2	1048.4924	1048.4924	M	K	2	12
PSM	AGVEEVAASGSHLNGDLDPDD	995	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=8441	33.1089677272	2	2109.9032	2108.9132	M	R	2	23
PSM	VEAAPPGPGPLR	996	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=7296	30.069698383733332	2	1201.6477	1201.6450	M	R	2	14
PSM	SGGGPSGGGPGGSG	997	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5228	22.2930129032	2	1028.4161	1028.4154	M	R	2	16
PSM	MNGEADCPTDLEMAAP	998	sp|P17480|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=8288	32.6754789928	2	1778.681313	1778.679738	-	K	1	17
PSM	AEAGPQAPPPPGTPS	999	sp|Q16254|E2F4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=6662	28.107709427466666	2	1414.6776	1414.6723	M	R	2	17
PSM	MEPATAPRPDMAPELTPEEEQAT	1000	sp|P43378|PTN9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=7135	29.627851382400003	3	2584.136057	2584.130900	-	K	1	24
PSM	MEVAEPSSPTEEEEEEEEHSAEP	1001	sp|Q9NWV8|BABA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6857	28.790661053333334	3	2658.034090	2658.028663	-	R	1	24
PSM	AAAATAAEGVPS	1002	sp|Q8TBC3-2|SHKB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7056	29.395	2	1056.5088	1056.5088	M	R	2	14
PSM	AADTQVSETL	1003	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7849	31.537	2	1075.5033	1075.5033	M	K	2	12
PSM	AAESGSDFQQR	1004	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6092	26.07	2	1236.5371	1236.5371	M	R	2	13
PSM	ADMQNLVE	1005	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6995	29.206	2	976.41716	976.4172	M	R	2	10
PSM	ADSELQLVEQ	1006	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8634	33.63	2	1172.5561	1172.5561	M	R	2	12
PSM	AKNGSEADIDEGLYS	1007	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7225	29.887	2	1609.7108	1609.7108	M	R	2	17
PSM	AQISSNSGF	1008	sp|O00443-2|P3C2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8044	32.049	2	951.42977	951.4298	M	K	2	11
PSM	ASAVLSSVPTTAS	1009	sp|Q5VSY0-2|GKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8635	33.632	2	1231.6296	1231.6296	M	R	2	15
PSM	ASGVAVSDGVIKVFNDM	1010	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=8952	34.449	2	1765.8557	1765.8557	M	K	2	19
PSM	ATDTSQGELVHP	1011	sp|Q5SSJ5-5|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6747	28.432	2	1295.5994	1295.5994	M	K	2	14
PSM	AVSESQLK	1012	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6216	26.564	2	902.47091	902.4709	M	K	2	10
PSM	CNTPTYCDLG	1013	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7689	31.123	2	1241.4693	1241.4693	M	K	2	12
PSM	MDDEEETY	1014	sp|P19388|RPAB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6521	27.646	2	1088.3492	1088.3492	-	R	1	9
PSM	MDDREDLVYQA	1015	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7283	30.046	2	1411.5926	1411.5926	-	K	1	12
PSM	MDNQCTVQV	1016	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6910	28.955	2	1151.4587	1151.4587	-	R	1	10
PSM	MEEDQELE	1017	sp|P0DPB5|RPC22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6615	27.961	2	1079.3965	1079.3965	-	R	1	9
PSM	MEIPGSLCK	1018	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6931	29.005	2	1091.4991	1091.4991	-	K	1	10
PSM	MEIPPTNYPAS	1019	sp|Q9BS40|LXN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7267	30.009	2	1276.5646	1276.5646	-	R	1	12
PSM	MEVKPPPG	1020	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5743	24.621	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	1021	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5841	25.044	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	1022	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6028	25.819	2	911.44225	911.4423	-	R	1	9
PSM	MLGTEGGEGFVV	1023	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=8739	33.921	2	1194.5591	1194.5591	M	K	2	14
PSM	MMMGCGESEL	1024	sp|Q8TAP8|PPR35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6858	28.795	2	1233.4022	1233.4022	-	K	1	11
PSM	MMQICDTYNQ	1025	sp|Q9NPA3|M1IP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6808	28.632	2	1376.5047	1376.5047	-	K	1	11
PSM	MNGSNMANTSPSV	1026	sp|Q9ULR5|PAI2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6150	26.313	2	1382.5442	1382.5442	-	K	1	14
PSM	MNNSGADEIG	1027	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6246	26.677	2	1064.4081	1064.4081	-	K	1	11
PSM	MTENSTSAPAA	1028	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5707	24.453	2	1136.4656	1136.4656	-	K	1	12
PSM	MTEQAISFA	1029	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8666	33.718	2	1054.4641	1054.4641	-	K	1	10
PSM	MVDMMDLPRS	1030	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8373	32.887	2	1251.5298	1251.5298	-	R	1	11
PSM	MVPPVQVSPLI	1031	sp|P56385|ATP5I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=8739	33.921	2	1194.6682	1194.6682	-	K	1	12
PSM	PMFIVNTNVP	1032	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35	ms_run[2]:scan=9359	35.652	2	1146.5743	1146.5743	M	R	2	12
PSM	VEAAPPGPGPLR	1033	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7304	30.088	2	1201.6455	1201.6455	M	R	2	14
PSM	VYISNGQVLDS	1034	sp|Q9Y6D0|SELK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7119	29.596	2	1193.5928	1193.5928	M	R	2	13
PSM	SETAPAAPAAAPPAE	1035	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=9189	35.10251275013333	2	1391.6584	1391.6564	M	K	2	17
PSM	SETAPAAPAAAPPAE	1036	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=9699	36.88067170666667	2	1391.6583	1391.6564	M	K	2	17
PSM	AETLPGSGDSGPGTASLGPGVAETGT	1037	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=8356	32.84551532613333	3	2327.0816	2327.0760	M	R	2	28
PSM	AFAETYPAASSLPNGDCGRP	1038	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,17-UNIMOD:4	ms_run[1]:scan=8472	33.1961464456	2	2122.9302	2121.9422	M	R	2	22
PSM	ENSESLGTVPEHE	1039	sp|Q8TAG9|EXOC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=7666	31.05801492106667	2	1427.6022	1426.6202	A	R	3	16
PSM	ASSGAGDPLDS	1040	sp|Q9Y2R0|COA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=6934	29.0146679792	2	1017.4254	1017.4246	M	K	2	13
PSM	GITTIEAVK	1041	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=7816	31.4384954912	2	930.5386	930.5381	A	R	3	12
PSM	AAAAMAEQESA	1042	sp|Q7L5D6|GET4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=6261	26.719777219466668	2	1106.4568	1106.4545	A	R	3	14
PSM	AQVAMSTLPVEDEESSES	1043	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=8876	34.28202256506667	2	1966.8702	1965.8352	M	R	2	20
PSM	AQPPPDVEGDDCLPAY	1044	sp|Q9NUI1|DECR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=8715	33.844010928	2	1784.7524	1784.7558	M	R	2	18
PSM	MEAPGLAQAAAAESDS	1045	sp|P51817|PRKX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7946	31.801141110933333	2	1575.675738	1575.672268	-	R	1	17
PSM	MEDSMDMDMSPL	1046	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=8108	32.21801951253333	2	1507.518655	1506.487035	-	R	1	13
PSM	MENQVLTPHVYWAQ	1047	sp|Q9P035|HACD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8779	34.037384443466664	2	1773.799982	1772.819207	-	R	1	15
PSM	MGDDRPFVCNAPGCGQ	1048	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=6944	29.045340648533333	2	1837.712661	1837.718189	-	R	1	17
PSM	AAPPEPGEPEE	1049	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6589	27.881	2	1163.4982	1163.4982	M	R	2	13
PSM	AAVQMDPELA	1050	sp|Q9Y312|AAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=7542	30.722	2	1101.5012	1101.5012	M	K	2	12
PSM	ACLSPSQLQ	1051	sp|Q5SRE7-2|PHYD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=7991	31.919	2	1044.491	1044.4910	M	K	2	11
PSM	ADMQNLVE	1052	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8702	33.815	2	960.42225	960.4222	M	R	2	10
PSM	ADPHQLFDDTSSAQS	1053	sp|Q5BJH7-2|YIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7786	31.368	2	1659.7013	1659.7013	M	R	2	17
PSM	AFMEKPPAG	1054	sp|Q7Z7A4-2|PXK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7704	31.161	2	988.4688	988.4688	M	K	2	11
PSM	ALPQSEDAMTGDTD	1055	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6748	28.437	2	1507.5984	1507.5984	M	K	2	16
PSM	ATATPVPPRMGS	1056	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=6405	27.25	2	1241.6074	1241.6074	M	R	2	14
PSM	ATATPVPPRMGS	1057	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6690	28.218	2	1225.6125	1225.6125	M	R	2	14
PSM	ATLEKLM	1058	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=7247	29.931	2	862.447	862.4470	M	K	2	9
PSM	AVNVYSTSVTSDNLS	1059	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8479	33.216	2	1597.7471	1597.7471	M	R	2	17
PSM	GDAPSPEE	1060	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5815	24.938	2	842.32939	842.3294	M	K	2	10
PSM	MDGVSSEANEENDNIE	1061	sp|Q8NG31-3|KNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6661	28.103	2	1809.6847	1809.6847	-	R	1	17
PSM	MEAERGPE	1062	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5536	23.628	2	975.39676	975.3968	-	R	1	9
PSM	MEGVEEK	1063	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5415	23.063	2	878.36915	878.3691	-	K	1	8
PSM	MELGSCLEGG	1064	sp|O95551-3|TYDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=8002	31.95	2	1109.4369	1109.4369	-	R	1	11
PSM	MELGSCLEGG	1065	sp|O95551-3|TYDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=8009	31.967	2	1109.4369	1109.4369	-	R	1	11
PSM	MENSQLC	1066	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=6082	26.032	2	938.34737	938.3474	-	K	1	8
PSM	MEPLKVE	1067	sp|Q9H7B4|SMYD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6691	28.22	2	902.44192	902.4419	-	K	1	8
PSM	MEQVNEL	1068	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7500	30.621	2	919.3957	919.3957	-	K	1	8
PSM	METEQPEETFPNTETNGEFG	1069	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8937	34.428	2	2327.9376	2327.9376	-	K	1	21
PSM	MEVKPPPG	1070	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6736	28.394	2	895.44734	895.4473	-	R	1	9
PSM	MEYHQPEDPAPG	1071	sp|Q8N5J2|MINY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6199	26.5	2	1427.5663	1427.5663	-	K	1	13
PSM	MFQVPDSEGG	1072	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8029	32.021	2	1123.4492	1123.4492	-	R	1	11
PSM	MPMFIVNTNVP	1073	sp|P14174|MIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=8136	32.286	2	1293.6097	1293.6097	-	R	1	12
PSM	MTDDKDVL	1074	sp|Q9H1Y0|ATG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6722	28.341	2	993.43248	993.4325	-	R	1	9
PSM	MTNEEPLP	1075	sp|Q15007-2|FL2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7458	30.498	2	987.42191	987.4219	-	K	1	9
PSM	MVVSKMN	1076	sp|Q9NPA8|ENY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=5427	23.114	2	881.39867	881.3987	-	K	1	8
PSM	PEPAKSAPAP	1077	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5417	23.074	2	963.50255	963.5025	M	K	2	12
PSM	PGVIPSESNGLS	1078	sp|O94782|UBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7017	29.282	2	1155.5772	1155.5772	M	R	2	14
PSM	PMFIVNTNVP	1079	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:35	ms_run[2]:scan=9362	35.661	2	1146.5743	1146.5743	M	R	2	12
PSM	SCCDLAAAGQLG	1080	sp|Q9UBB6|NCDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=8072	32.109	2	1263.5224	1263.5224	M	K	2	14
PSM	SEKENNFPPLP	1081	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8627	33.609	2	1312.6299	1312.6299	M	K	2	13
PSM	SEQSICQA	1082	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6334	26.993	2	963.39676	963.3968	M	R	2	10
PSM	SETAPAAPAAAPPAE	1083	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7454	30.487	2	1391.6569	1391.6569	M	K	2	17
PSM	SGTNLDGNDEFDEQL	1084	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8865	34.254	2	1694.6908	1694.6908	M	R	2	17
PSM	SNIYIQEPPTNG	1085	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8144	32.303	2	1373.6463	1373.6463	M	K	2	14
PSM	STNENANTPAA	1086	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5628	24.079	2	1130.484	1130.4840	M	R	2	13
PSM	AAAMDVDTPSGTNSGAG	1087	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=7215	29.864139494933333	2	1562.6502	1562.6513	M	K	2	19
PSM	MVDMMDLPRS	1088	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=7550	30.744206402933333	2	1267.523647	1267.524681	-	R	1	11
PSM	MFIVNTNVP	1089	sp|P14174|MIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:35	ms_run[1]:scan=7888	31.629125483733333	2	1049.5206	1049.5210	P	R	3	12
PSM	MDFEDDYTHSAC	1090	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=6888	28.8819854752	2	1547.519146	1547.518075	-	R	1	13
PSM	SYGRPPPDVEGMTSL	1091	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=9271	35.36398811386667	2	1663.7662	1662.7552	M	K	2	17
PSM	MQGGEPVSTM	1092	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=5837	25.035125731999997	2	1109.436353	1109.436912	-	K	1	11
PSM	MEADASVDMFS	1093	sp|O14530|TXND9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=7696	31.143168581599998	2	1275.463654	1275.463521	-	K	1	12
PSM	AAPEGSGLGEDA	1094	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=6906	28.94724574853333	2	1114.4794	1114.4773	M	R	2	14
PSM	SDKPDLSEVE	1095	sp|P0CG34|TB15A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=6812	28.643699596533335	2	1159.5242	1159.5239	M	K	2	12
PSM	MVEEVQ	1096	sp|O43660|PLRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6321	26.944983878933332	1	791.337345	791.337121	-	K	1	7
PSM	MNGPADGEVDY	1097	sp|Q8NBZ0|IN80E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7234	29.90400161253333	2	1224.461089	1224.460484	-	K	1	12
PSM	KCTGGEESKAEAMPSL	1098	sp|Q96GV9|MACIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:4	ms_run[1]:scan=8299	32.70077488826667	2	1693.790431	1693.765122	Q	R	76	92