MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F07.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F07.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P02808|STAT_HUMAN	Statherin OS=Homo sapiens OX=9606 GN=STATH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null		0.56	45.0	25	1	0
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,10-UNIMOD:35	0.21	40.0	2	1	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.15	39.0	3	1	0
PRT	sp|P59827-2|BPIB4_HUMAN	Isoform 2 of BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P10163|PRB4_HUMAN	Basic salivary proline-rich protein 4 OS=Homo sapiens OX=9606 GN=PRB4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,16-UNIMOD:4	0.08	28.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.15	27.0	5	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.07	24.0	1	1	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.08	22.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	22.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.11	21.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	21.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q58FF6|H90B4_HUMAN	Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens OX=9606 GN=HSP90AB4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:35	0.08	19.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	3-UNIMOD:35	0.10	18.0	4	1	0
PRT	sp|P33240|CSTF2_HUMAN	Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	1	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=8178	31.098	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	2	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=8396	31.89	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	3	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=7451	28.889302324266666	4	4125.989309	4124.984973	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	4	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7981	30.369	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	5	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=8066	30.688721608799998	3	4125.993468	4124.984973	R	-	29	63
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	6	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1	ms_run[1]:scan=5869	23.105586734666666	4	6474.7716	6474.7677	M	K	2	71
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	7	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=8071	30.707413290133335	3	4127.994767	4124.984973	R	-	29	63
PSM	SDAAVDTSSEITTKDL	8	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=6711	26.082217132	2	1693.7920	1693.7889	M	K	2	18
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	9	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8170	31.068	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	10	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8238	31.308	3	4124.985	4124.9850	R	-	29	63
PSM	SDAAVDTSSEITTKDL	11	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=6724	26.129275085333333	2	1693.7920	1693.7889	M	K	2	18
PSM	KLDGIYQYGHIETNDNTAQLGGKY	12	sp|P59827-2|BPIB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6237	24.305	4	2697.3035	2697.3035	K	R	41	65
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	13	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7748	29.892	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	14	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8085	30.76	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	15	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8303	31.538674366133332	3	4126.993237	4124.984973	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	16	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7772	29.929230905066667	3	4124.989902	4124.984973	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	17	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8379	31.82	3	4124.985	4124.9850	R	-	29	63
PSM	KPQGPPPPPQGGRPPRPAQGQQPPQ	18	sp|P10163|PRB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4165	17.766953115733333	4	2593.370286	2593.362586	G	-	286	311
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	19	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7624	29.48	3	4124.985	4124.9850	R	-	29	63
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	20	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=5691	22.525869688266667	5	6491.7652	6490.7622	M	K	2	71
PSM	SGGGVIRGPAGNNDC	21	sp|Q07955-3|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=5340	21.342	2	1471.6474	1471.6474	M	R	2	17
PSM	DDDIAALVVDNGSGMC	22	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=8334	31.656638333066667	2	1709.6992	1708.6912	M	K	2	18
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	23	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7972	30.323	4	4124.985	4124.9850	R	-	29	63
PSM	SDAAVDTSSEITTKDL	24	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8155	31.014	2	1693.7894	1693.7894	M	K	2	18
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	25	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7580	29.332399646666666	4	4125.989309	4124.984973	R	-	29	63
PSM	SDAAVDTSSEITTKDL	26	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=8062	30.676	2	1693.7894	1693.7894	M	K	2	18
PSM	ATAEVLNIGK	27	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6887	26.753	2	1056.5815	1056.5815	M	K	2	12
PSM	ATVQQLEGRW	28	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7466	28.942	2	1228.62	1228.6200	M	R	2	12
PSM	MDGIVPDIAVGTK	29	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7073	27.493	2	1372.6908	1372.6908	-	R	1	14
PSM	SDAAVDTSSEITTKDL	30	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8263	31.396	2	1693.7894	1693.7894	M	K	2	18
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	31	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8603	32.638102492533335	3	4127.007279	4124.984973	R	-	29	63
PSM	DDDIAALVVDNGSGMC	32	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=8383	31.83755779146667	2	1709.6902	1708.6912	M	K	2	18
PSM	AGITTIEAVK	33	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6717	26.104	2	1043.5863	1043.5863	M	R	2	12
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	34	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7688	29.70911982186667	4	4125.989309	4124.984973	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	35	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8523	32.33999822053333	3	4125.991738	4124.984973	R	-	29	63
PSM	SETAPAAPAAPAPAE	36	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=5692	22.528163540266668	2	1391.6578	1391.6564	M	K	2	17
PSM	PFLELDTNLPAN	37	sp|P30046-2|DOPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7669	29.634	2	1342.6769	1342.6769	M	R	2	14
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	38	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8573	32.526	3	4124.985	4124.9850	R	-	29	63
PSM	SDAAVDTSSEITTKDL	39	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=8357	31.737	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	40	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7969	30.311282478400003	2	1693.8022	1693.7892	M	K	2	18
PSM	ADEELEALR	41	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6901	26.806	2	1086.5193	1086.5193	M	R	2	11
PSM	ADKMDMSLDDII	42	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7366	28.582	2	1439.616	1439.6160	M	K	2	14
PSM	MNDTVTIRT	43	sp|P62847-2|RS24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5653	22.387	2	1107.523	1107.5230	-	R	1	10
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	44	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8528	32.35985009226667	3	4125.991738	4124.984973	R	-	29	63
PSM	AATTGSGVKVP	45	sp|Q13404-8|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5821	22.956	2	1028.5502	1028.5502	M	R	2	13
PSM	ADKPDMGEIASFD	46	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=6463	25.098	2	1452.6079	1452.6079	M	K	2	15
PSM	GVQVETISPGDG	47	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5716	22.61	2	1157.5564	1157.5564	M	R	2	14
PSM	PYQYPALTPEQ	48	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6518	25.319	2	1305.6241	1305.6241	M	K	2	13
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	49	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8671	32.899	3	4124.985	4124.9850	R	-	29	63
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	50	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8695	32.995	3	4124.985	4124.9850	R	-	29	63
PSM	SGALDVLQM	51	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7693	29.723	2	990.4692	990.4692	M	K	2	11
PSM	AAQGEPQVQF	52	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7245	28.129	2	1115.5247	1115.5247	M	K	2	12
PSM	AESSDKLY	53	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5781	22.82	2	953.43419	953.4342	M	R	2	10
PSM	MSLIINTFYSN	54	sp|Q58FF6|H90B4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=7526	29.151	2	1317.6275	1317.6275	-	K	1	12
PSM	PLENLEEEGLP	55	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7117	27.662	2	1238.603	1238.6030	M	K	2	13
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	56	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8077	30.729	4	4124.985	4124.9850	R	-	29	63
PSM	SDAAVDTSSEITTKDL	57	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8450	32.097	2	1693.7894	1693.7894	M	K	2	18
PSM	ATNFLAHE	58	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6893	26.773	2	943.43995	943.4399	M	K	2	10
PSM	MDDREDLVYQA	59	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6296	24.522	2	1411.5926	1411.5926	-	K	1	12
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	60	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8708	33.047	3	4124.985	4124.9850	R	-	29	63
PSM	SYGRPPPDVEGMTSL	61	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=6444	25.03	2	1662.7559	1662.7559	M	K	2	17
PSM	AVTLDKDAYY	62	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6916	26.868	2	1199.571	1199.5710	M	R	2	12
PSM	PMFIVNTNVP	63	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6955	27.023	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	64	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=7055	27.413	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	65	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=7162	27.83	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	66	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7486	29.011	2	1130.5794	1130.5794	M	R	2	12
PSM	AGLTVRDPAVD	67	sp|P33240|CSTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=6378	24.7988087944	2	1154.5953	1154.5926	M	R	2	13
PSM	MEKTELIQ	68	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5689	22.519424145333335	2	1048.511879	1048.511063	-	K	1	9