MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F08.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F08.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UER7-5|DAXX_HUMAN	Isoform gamma of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.07	46.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1	0.04	45.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.15	35.0	4	1	0
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,10-UNIMOD:35	0.21	34.0	1	1	1
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,16-UNIMOD:4	0.08	31.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.07	29.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.15	28.0	2	1	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.08	27.0	2	1	0
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.25	25.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.08	23.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P02808|STAT_HUMAN	Statherin OS=Homo sapiens OX=9606 GN=STATH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.56	23.0	4	1	0
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	23.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.08	22.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.19	20.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.17	19.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.11	18.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	18.0	1	1	1
PRT	sp|Q9Y5J9|TIM8B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 B OS=Homo sapiens OX=9606 GN=TIMM8B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.16	18.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.00	18.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	18.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	3-UNIMOD:35	0.10	18.0	3	1	0
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.12	17.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGA	1	sp|Q9UER7-5|DAXX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=6856	29.278	4	4517.0379	4517.0379	M	R	2	48
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	2	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=5820	25.035	3	2428.1102	2428.1102	M	R	2	32
PSM	SDAAVDTSSEITTKDL	3	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6044	25.953	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	4	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6133	26.303	2	1693.7894	1693.7894	M	K	2	18
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	5	sp|Q99729-2|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=5476	23.646779105333334	4	6490.7703	6490.7627	M	K	2	71
PSM	SGGGVIRGPAGNNDC	6	sp|Q07955-3|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=4889	21.169	2	1471.6474	1471.6474	M	R	2	17
PSM	SETAPLAPTIPAPAE	7	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6674	28.525	2	1505.7613	1505.7613	M	K	2	17
PSM	METEQPEETFPNTETNGEFGK	8	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5891	25.322	3	2472.0275	2472.0275	-	R	1	22
PSM	SDAAVDTSSEITTKDL	9	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=6144	26.347232015466666	2	1693.7921	1693.7889	M	K	2	18
PSM	SETAPAAPAAAPPAE	10	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5136	22.202	2	1391.6569	1391.6569	M	K	2	17
PSM	PGLVDSNPAPPESQE	11	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5182	22.394	2	1535.7104	1535.7104	M	K	2	17
PSM	SDAAVDTSSEITTKDL	12	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7226	30.687	2	1693.7894	1693.7894	M	K	2	18
PSM	ADSELQLVEQ	13	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6766	28.911	2	1172.5561	1172.5561	M	R	2	12
PSM	ATAEVLNIGK	14	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6298	26.959	2	1056.5815	1056.5815	M	K	2	12
PSM	MQDAENVAVPEAAEE	15	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5754	24.764	2	1659.6934	1659.6934	-	R	1	16
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	16	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7142	30.39	4	4124.985	4124.9850	R	-	29	63
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	17	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5799	24.947089313333333	3	2498.101245	2498.096623	-	R	1	28
PSM	ADEELEALR	18	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6299	26.964	2	1086.5193	1086.5193	M	R	2	11
PSM	ADKEAAFDDAVEE	19	sp|Q09028-3|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5720	24.626	2	1450.61	1450.6100	M	R	2	15
PSM	MDGIVPDIAVGTK	20	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6473	27.691	2	1372.6908	1372.6908	-	R	1	14
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	21	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6973	29.754	4	4124.985	4124.9850	R	-	29	63
PSM	SDAAVDTSSEITTKDL	22	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7129	30.341	2	1693.7894	1693.7894	M	K	2	18
PSM	SETAPAAPAAAPPAE	23	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5219	22.547	2	1391.6569	1391.6569	M	K	2	17
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	24	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7138	30.375	4	4124.985	4124.9850	R	-	29	63
PSM	STDTGVSLPSYEEDQGS	25	sp|Q9Y241|HIG1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6217	26.635	2	1812.7537	1812.7537	M	K	2	19
PSM	AAQGEPQVQF	26	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6524	27.902	2	1115.5247	1115.5247	M	K	2	12
PSM	MEKTELIQ	27	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5170	22.343	2	1048.5111	1048.5111	-	K	1	9
PSM	SDAAVDTSSEITTKDL	28	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=7488	31.634440961333333	2	1693.7992	1693.7892	M	K	2	18
PSM	MEGGFGSDFGGSGSG	29	sp|Q9Y5L4|TIM13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6313	27.0214004536	2	1405.498340	1405.509225	-	K	1	16
PSM	AATTGSGVKVP	30	sp|Q13404-8|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5290	22.849	2	1028.5502	1028.5502	M	R	2	13
PSM	ADKPDMGEIASFD	31	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5804	24.966	2	1452.6079	1452.6079	M	K	2	15
PSM	AELGEADEAELQ	32	sp|Q9Y5J9|TIM8B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6397	27.375	2	1315.578	1315.5780	M	R	2	14
PSM	AESSDKLY	33	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5244	22.657	2	953.43419	953.4342	M	R	2	10
PSM	ASKEMFEDTVEE	34	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5450	23.536	2	1471.6025	1471.6025	M	R	2	14
PSM	MEEVVIAGMSG	35	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5899	25.356	2	1195.5101	1195.5101	-	K	1	12
PSM	MNDTVTIRT	36	sp|P62847-2|RS24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5149	22.254	2	1107.523	1107.5230	-	R	1	10
PSM	SGALDVLQM	37	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6955	29.671	2	990.4692	990.4692	M	K	2	11
PSM	PMFIVNTNVP	38	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=6493	27.773962177066668	2	1146.5744	1146.5738	M	R	2	12
PSM	PMFIVNTNVP	39	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=6574	28.108924661066666	2	1146.5744	1146.5738	M	R	2	12
PSM	PMFIVNTNVP	40	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=6412	27.437101939199998	2	1146.5744	1146.5738	M	R	2	12
PSM	ASSGAGDPLDSK	41	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4906	21.246	2	1145.52	1145.5200	M	R	2	14
PSM	MDDREDLVYQA	42	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5656	24.374	2	1411.5926	1411.5926	-	K	1	12
PSM	SKSFQQSSLS	43	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5021	21.718	2	1139.5459	1139.5459	M	R	2	12
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	44	sp|P02808|STAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7222	30.672424295466666	3	4128.001974	4124.984973	R	-	29	63