MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F10.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F10.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null	2-UNIMOD:1	0.20	61.0	1	1	0
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null	2-UNIMOD:1,17-UNIMOD:35	0.15	58.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	2-UNIMOD:1	0.05	57.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1	0.16	51.0	2	1	0
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	50.0	4	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1	0.04	47.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46.0	null	2-UNIMOD:1	0.06	46.0	2	1	0
PRT	sp|Q5VTL8-2|PR38B_HUMAN	Isoform 2 of Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1,29-UNIMOD:4	0.22	45.0	2	1	0
PRT	sp|Q9HBT8|Z286A_HUMAN	Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.05	45.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1	0.18	45.0	5	1	0
PRT	sp|A0A2Z4LIS9|FXO3B_HUMAN	Forkhead box protein O3B OS=Homo sapiens OX=9606 GN=FOXO3B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.09	44.0	1	1	1
PRT	sp|Q6PCB5|RSBNL_HUMAN	Lysine-specific demethylase RSBN1L OS=Homo sapiens OX=9606 GN=RSBN1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	43.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.08	43.0	1	1	1
PRT	sp|P49354-2|FNTA_HUMAN	Isoform 2 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.11	42.0	3	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	null		0.04	41.0	4	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1	0.16	40.0	3	1	0
PRT	sp|O43516|WIPF1_HUMAN	WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q9UIU6|SIX4_HUMAN	Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,22-UNIMOD:35	0.04	39.0	2	1	0
PRT	sp|P20265|PO3F2_HUMAN	POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,27-UNIMOD:35	0.08	37.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.15	37.0	1	1	1
PRT	sp|Q8IZR5|CKLF4_HUMAN	CKLF-like MARVEL transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=CMTM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35,19-UNIMOD:35	0.16	37.0	1	1	1
PRT	sp|P55735|SEC13_HUMAN	Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,15-UNIMOD:35,21-UNIMOD:35	0.08	35.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.08	34.0	1	1	1
PRT	sp|P08047-3|SP1_HUMAN	Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,8-UNIMOD:35,11-UNIMOD:35	0.02	32.0	3	1	0
PRT	sp|Q9P2K5-4|MYEF2_HUMAN	Isoform 4 of Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.23	31.0	2	1	0
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,16-UNIMOD:4	0.08	31.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.08	28.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.03	27.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.07	26.0	1	1	1
PRT	sp|O14979-2|HNRDL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.16	24.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:35	0.12	23.0	4	1	0
PRT	sp|Q6NSJ2|PHLB3_HUMAN	Pleckstrin homology-like domain family B member 3 OS=Homo sapiens OX=9606 GN=PHLDB3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,19-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q8TF74|WIPF2_HUMAN	WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,37-UNIMOD:35	0.10	20.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q709F0|ACD11_HUMAN	Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	18.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	3-UNIMOD:35	0.10	18.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.07	18.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|A6NHY2|AKD1B_HUMAN	Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKDD1B PE=4 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.02	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	1	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	1-UNIMOD:1	ms_run[2]:scan=6493	29.741	3	3477.5808	3477.5808	M	K	2	33
PSM	ADVLDLHEAGGEDFAMDEDGDESIH	2	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=6603	30.196	3	2744.1032	2744.1032	M	K	2	27
PSM	SHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKG	3	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	1-UNIMOD:1	ms_run[2]:scan=6631	30.289	3	3515.6401	3515.6401	M	R	2	37
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	4	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	51	1-UNIMOD:1	ms_run[1]:scan=6338	29.0065703128	3	3820.7508	3820.7434	M	K	2	36
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	5	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5507	24.996	3	2911.1825	2911.1825	-	R	1	26
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	6	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5426	24.6	3	2911.1825	2911.1825	-	R	1	26
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	7	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=5673	25.831	3	2428.1102	2428.1102	M	R	2	32
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	8	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5594	25.43	3	2911.1825	2911.1825	-	R	1	26
PSM	AAPEEHDSPTEASQPIVEEEETKTF	9	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46	1-UNIMOD:1	ms_run[1]:scan=6306	28.8548817272	3	2812.2624	2812.2558	M	K	2	27
PSM	ANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSG	10	sp|Q5VTL8-2|PR38B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,28-UNIMOD:4	ms_run[2]:scan=5185	23.422	4	3870.8052	3870.8052	M	K	2	42
PSM	METDLAEMPEKGALSSQDSPHFQE	11	sp|Q9HBT8|Z286A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6045	27.625	3	2750.1687	2750.1687	-	K	1	25
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	12	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=6217	28.44	3	2633.3085	2633.3085	M	R	2	27
PSM	ANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSG	13	sp|Q5VTL8-2|PR38B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,28-UNIMOD:4	ms_run[2]:scan=5271	23.834	4	3870.8052	3870.8052	M	K	2	42
PSM	METDLAEMPEKGVLSSQDSPHFQE	14	sp|A0A2Z4LIS9|FXO3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6215	28.433	3	2778.2	2778.2000	-	K	1	25
PSM	AEPPSPVHCVAAAAPTATVSEKEPFG	15	sp|Q6PCB5|RSBNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=6397	29.284	3	2661.2745	2661.2745	M	K	2	28
PSM	SKQQPTQFINPETPGYVGFANLPNQVH	16	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=6614	30.239	3	3052.5043	3052.5043	M	R	2	29
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	17	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=5171	23.352	4	3428.6134	3428.6134	M	K	2	36
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	18	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=6137	28.071	3	2633.3085	2633.3085	M	R	2	27
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	19	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=6034	27.57	3	2895.1876	2895.1876	-	R	1	26
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	20	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41		ms_run[1]:scan=5817	26.533949106933335	3	2832.4243	2832.4176	M	K	2	30
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	21	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=5255	23.757	4	3428.6134	3428.6134	M	K	2	36
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	22	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:1	ms_run[1]:scan=6405	29.321205929333335	3	3478.5752	3477.5802	M	K	2	33
PSM	PVPPPPAPPPPPTFALANTEKPTLN	23	sp|O43516|WIPF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40		ms_run[1]:scan=6587	30.1231649824	3	2560.3802	2559.3732	M	K	2	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	24	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6063	27.714	3	2633.3085	2633.3085	M	R	2	27
PSM	AAPEEHDSPTEASQPIVEEEETKTF	25	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=6228	28.492494589066666	3	2812.2624	2812.2558	M	K	2	27
PSM	SSSSPTGQIASAADIKQENGMESASEGQEAH	26	sp|Q9UIU6|SIX4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1,21-UNIMOD:35	ms_run[1]:scan=5407	24.509554444800003	3	3161.3707	3161.3686	M	R	2	33
PSM	ATAASNHYSLLTSSASIVHAEPPGGMQQGAGGY	27	sp|P20265|PO3F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,26-UNIMOD:35	ms_run[2]:scan=6565	30.027	3	3287.5153	3287.5153	M	R	2	35
PSM	SDAAVDTSSEITTKDL	28	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=5904	26.951	2	1693.7894	1693.7894	M	K	2	18
PSM	SSSSPTGQIASAADIKQENGMESASEGQEAH	29	sp|Q9UIU6|SIX4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1,21-UNIMOD:35	ms_run[1]:scan=5497	24.9499513496	3	3161.3707	3161.3686	M	R	2	33
PSM	MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQR	30	sp|Q8IZR5|CKLF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:1,1-UNIMOD:35,19-UNIMOD:35	ms_run[1]:scan=6187	28.303839586133332	4	3978.742046	3978.737137	-	R	1	38
PSM	VSVINTVDTSHEDMIHDAQMDYYGT	31	sp|P55735|SEC13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,14-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=6590	30.136	3	2914.2273	2914.2273	M	R	2	27
PSM	AGVEEVAASGSHLNGDLDPDDREEGAASTAEEAA	32	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=6363	29.117	3	3381.4717	3381.4717	M	K	2	36
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	33	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5348	24.213	4	3428.6134	3428.6134	M	K	2	36
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	34	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=6296	28.809	3	2633.3085	2633.3085	M	R	2	27
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	35	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=5898	26.9212945488	3	2832.4243	2832.4176	M	K	2	30
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	36	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6256	28.624	4	3820.7439	3820.7439	M	K	2	36
PSM	SDQDHSMDEMTAVVKIE	37	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5596	25.441	3	2007.8401	2007.8401	M	K	2	19
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	38	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6056	27.68	3	2633.3085	2633.3085	M	R	2	27
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEP	39	sp|Q9P2K5-4|MYEF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5806	26.481	3	2750.2784	2750.2784	M	R	2	30
PSM	SDQDHSMDEMTAVVKIE	40	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5511	25.015	3	2007.8401	2007.8401	M	K	2	19
PSM	SGGGVIRGPAGNNDC	41	sp|Q07955-3|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=4954	22.309	2	1471.6474	1471.6474	M	R	2	17
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	42	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5730	26.107997857066668	3	2832.4243	2832.4176	M	K	2	30
PSM	SETAPAAPAAAPPAE	43	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=5103	23.020289151733333	2	1391.6584	1391.6564	M	K	2	17
PSM	METEQPEETFPNTETNGEFGK	44	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5786	26.38770437413333	3	2472.023137	2472.027481	-	R	1	22
PSM	SFDPNLLHNNGHNGYPNGTSAAL	45	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=6609	30.219945880266668	3	2453.0972	2451.1202	M	R	2	25
PSM	SETAPLAPTIPAPAE	46	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6373	29.167	2	1505.7613	1505.7613	M	K	2	17
PSM	MEDMNEYSNIEEFAEGS	47	sp|O14979-2|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=6672	30.424234064533334	2	2069.752360	2067.756134	-	K	1	18
PSM	MDVAESPERDPHSPEDEEQPQGLSDDDIL	48	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6435	29.468	3	3307.3947	3307.3947	-	R	1	30
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	49	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=6812	30.8025272008	3	3478.5802	3477.5802	M	K	2	33
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	50	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=5977	27.297079618666665	3	2832.4243	2832.4176	M	K	2	30
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	51	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=5849	26.688065007200002	4	4385.0632	4385.0522	M	K	2	52
PSM	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHV	52	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:35	ms_run[1]:scan=5881	26.83755759146667	5	5618.7230	5618.7133	-	R	1	58
PSM	GTRSSPEEGTPPPLVPECDVEVQPQGHPEES	53	sp|Q6NSJ2|PHLB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,18-UNIMOD:4	ms_run[1]:scan=6083	27.8131407384	3	3382.5352	3382.5252	M	R	2	33
PSM	ADKEAAFDDAVEE	54	sp|Q09028-3|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5624	25.58	2	1450.61	1450.6100	M	R	2	15
PSM	MDGIVPDIAVGTK	55	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6220	28.453	2	1372.6908	1372.6908	-	R	1	14
PSM	PIPPPPPPPPGPPPPPTFHQANTEQP	56	sp|Q8TF74|WIPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6385	29.223	4	2700.37	2700.3700	M	K	2	28
PSM	SDQDHSMDEMTAVVKIE	57	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5464	24.788	2	2007.8401	2007.8401	M	K	2	19
PSM	ADEELEALR	58	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6084	27.818	2	1086.5193	1086.5193	M	R	2	11
PSM	ADSELQLVEQ	59	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6438	29.484	2	1172.5561	1172.5561	M	R	2	12
PSM	MDDREDLVYQA	60	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5581	25.365	2	1411.5926	1411.5926	-	K	1	12
PSM	PYQYPALTPEQ	61	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=5776	26.338627594666665	2	1305.6362	1305.6232	M	K	2	13
PSM	METILEQQR	62	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5421	24.573357980533334	2	1204.585480	1204.575788	-	R	1	10
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGK	63	sp|P45985|MP2K4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,36-UNIMOD:35	ms_run[2]:scan=4965	22.365	3	3300.5065	3300.5065	M	R	2	41
PSM	AAQGEPQVQF	64	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6246	28.578	2	1115.5247	1115.5247	M	K	2	12
PSM	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHV	65	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:35	ms_run[1]:scan=5969	27.257538129333334	5	5618.7230	5618.7133	-	R	1	58
PSM	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHV	66	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:35	ms_run[1]:scan=5847	26.67735865386667	5	5618.7230	5618.7133	-	R	1	58
PSM	MKPGATGESDLAEVLPQH	67	sp|Q709F0|ACD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6297	28.81428616506667	2	1936.928117	1936.920043	-	K	1	19
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEP	68	sp|Q9P2K5-4|MYEF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5900	26.93	3	2750.2784	2750.2784	M	R	2	30
PSM	ADKPDMGEIASFD	69	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5694	25.933	2	1452.6079	1452.6079	M	K	2	15
PSM	PMFIVNTNVP	70	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6177	28.254	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	71	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6258	28.635	2	1146.5743	1146.5743	M	R	2	12
PSM	ADHSFSDGVPSDSVEAAKNASNTE	72	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5552	25.2198495992	3	2477.0492	2476.0622	M	K	2	26
PSM	ATAEVLNIGK	73	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6069	27.743	2	1056.5815	1056.5815	M	K	2	12
PSM	RQITQNTDY	74	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4593	20.561	2	1137.5415	1137.5415	K	R	924	933
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	75	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=6879	31.0119820648	3	3477.6102	3477.5802	M	K	2	33
PSM	MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHV	76	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:35	ms_run[1]:scan=5994	27.380929269333333	5	5618.7230	5618.7133	-	R	1	58
PSM	KDLNQPDE	77	sp|A6NHY2|AKD1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=5235	23.65809116986667	2	957.422727	957.440340	L	K	193	201
PSM	ASLSLAPVNIF	78	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=6765	30.631	2	1172.6441	1172.6441	M	K	2	13