MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.03	60.0	2	1	0
PRT	sp|O75582-2|KS6A5_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	54.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1,17-UNIMOD:35	0.15	51.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	50.0	null	2-UNIMOD:1	0.07	50.0	2	1	0
PRT	sp|Q9UBF6-3|RBX2_HUMAN	Isoform 3 of RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1,11-UNIMOD:4	0.30	49.0	1	1	1
PRT	sp|Q7Z6I8-2|CE024_HUMAN	Isoform 2 of UPF0461 protein C5orf24 OS=Homo sapiens OX=9606 GN=C5orf24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35,2-UNIMOD:35,2-UNIMOD:1	0.17	47.0	4	2	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.18	46.0	4	1	0
PRT	sp|Q75N03-2|HAKAI_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	45.0	2	1	0
PRT	sp|Q86XR8-3|CEP57_HUMAN	Isoform 3 of Centrosomal protein of 57 kDa OS=Homo sapiens OX=9606 GN=CEP57	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1,28-UNIMOD:35	0.11	44.0	1	1	1
PRT	sp|Q86YI8|PHF13_HUMAN	PHD finger protein 13 OS=Homo sapiens OX=9606 GN=PHF13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,19-UNIMOD:4	0.07	43.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	42.0	3	1	0
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.03	41.0	1	1	1
PRT	sp|O95772|STR3N_HUMAN	STARD3 N-terminal-like protein OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.10	41.0	2	1	0
PRT	sp|P08047-3|SP1_HUMAN	Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,11-UNIMOD:35,8-UNIMOD:35	0.02	41.0	4	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	41.0	2	1	0
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.16	41.0	3	2	1
PRT	sp|Q96L92-3|SNX27_HUMAN	Isoform 2 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.03	40.0	2	1	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.05	40.0	1	1	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,37-UNIMOD:35	0.10	39.0	2	1	0
PRT	sp|Q8TCF1-4|ZFAN1_HUMAN	Isoform 4 of AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,10-UNIMOD:4,15-UNIMOD:4	0.07	39.0	1	1	1
PRT	sp|P02808|STAT_HUMAN	Statherin OS=Homo sapiens OX=9606 GN=STATH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.56	38.0	1	1	1
PRT	sp|Q9H334-5|FOXP1_HUMAN	Isoform 5 of Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,2-UNIMOD:35,29-UNIMOD:4,1-UNIMOD:1,1-UNIMOD:35	0.29	37.0	2	2	2
PRT	sp|P26367|PAX6_HUMAN	Paired box protein Pax-6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	37.0	1	1	1
PRT	sp|Q96L92|SNX27_HUMAN	Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.03	37.0	1	1	0
PRT	sp|Q92600-3|CNOT9_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	36.0	2	1	0
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.02	36.0	1	1	1
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	15-UNIMOD:4	0.03	35.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.15	35.0	1	1	1
PRT	sp|P53701|CCHL_HUMAN	Cytochrome c-type heme lyase OS=Homo sapiens OX=9606 GN=HCCS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	25-UNIMOD:4,27-UNIMOD:35	0.11	33.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,12-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|Q00796-2|DHSO_HUMAN	Isoform 2 of Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.20	31.0	1	1	0
PRT	sp|Q00994-2|BEX3_HUMAN	Isoform 2 of Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.26	31.0	4	1	0
PRT	sp|P52739-2|ZN131_HUMAN	Isoform 2 of Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	30.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,5-UNIMOD:35	0.06	29.0	3	1	0
PRT	sp|Q9P1F3|ABRAL_HUMAN	Costars family protein ABRACL OS=Homo sapiens OX=9606 GN=ABRACL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.20	29.0	1	1	1
PRT	sp|Q13098-7|CSN1_HUMAN	Isoform 2 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,19-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.08	27.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	26.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.07	26.0	1	1	1
PRT	sp|Q9UJA5-3|TRM6_HUMAN	Isoform 3 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	25.0	2	1	0
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.10	25.0	1	1	1
PRT	sp|Q9H1I8-3|ASCC2_HUMAN	Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q00796|DHSO_HUMAN	Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.06	24.0	1	1	0
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.08	23.0	2	1	0
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.08	22.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|P55197|AF10_HUMAN	Protein AF-10 OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,18-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|O15530-2|PDPK1_HUMAN	Isoform 2 of 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	21.0	1	1	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|P54687|BCAT1_HUMAN	Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9Y666-2|S12A7_HUMAN	Isoform 2 of Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	0.24	19.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	3-UNIMOD:35	0.10	18.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.16	18.0	1	1	1
PRT	sp|Q8IXK0-2|PHC2_HUMAN	Isoform 2 of Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.12	16.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,9-UNIMOD:35,13-UNIMOD:4	0.06	16.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	2-UNIMOD:1	0.01	15.0	1	1	1
PRT	sp|Q53HL2|BOREA_HUMAN	Borealin OS=Homo sapiens OX=9606 GN=CDCA8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	15.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1499-UNIMOD:35,1501-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9H2F5|EPC1_HUMAN	Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	283-UNIMOD:35,287-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	14.0	null	2-UNIMOD:1	0.05	14.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	14.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.05	14.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1	0.07	14.0	2	1	0
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q9UHV5|RPGFL_HUMAN	Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens OX=9606 GN=RAPGEFL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	14.0	null	555-UNIMOD:4	0.02	14.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHP	1	sp|Q96JN8-2|NEUL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=5295	23.201	3	3413.4853	3413.4853	M	R	2	47
PSM	MEEEGGSSGGAAGTSADGGDGGEQLLTVKHEL	2	sp|O75582-2|KS6A5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6038	26.459	3	3103.3524	3103.3524	-	R	1	33
PSM	ADVLDLHEAGGEDFAMDEDGDESIH	3	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=6637	28.903	3	2744.1032	2744.1032	M	K	2	27
PSM	ADHSFSDGVPSDSVEAAKNASNTE	4	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	50	1-UNIMOD:1	ms_run[1]:scan=5417	23.759093194666665	3	2477.0672	2476.0622	M	K	2	26
PSM	ADHSFSDGVPSDSVEAAKNASNTE	5	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	50	1-UNIMOD:1	ms_run[1]:scan=5496	24.119855599199997	3	2477.0672	2476.0622	M	K	2	26
PSM	ADVEDGEETCALASHSGSSGSKSGGD	6	sp|Q9UBF6-3|RBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=5183	22.688	3	2551.0252	2551.0252	M	K	2	28
PSM	MMHPVASSNPAFCGPGKPSCLNEDAM	7	sp|Q7Z6I8-2|CE024_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=5660	24.837	3	2878.1853	2878.1853	-	R	1	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	8	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=5842	25.631	3	2633.3085	2633.3085	M	R	2	27
PSM	MDHTDNELQGTNSSGSLGGLDVR	9	sp|Q75N03-2|HAKAI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5722	25.103	3	2460.0823	2460.0823	-	R	1	24
PSM	MDHTDNELQGTNSSGSLGGLDVR	10	sp|Q75N03-2|HAKAI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=5991	26.264	3	2444.0874	2444.0874	-	R	1	24
PSM	AAASVSAASGSHLSNSFAEPSRSNGSMV	11	sp|Q86XR8-3|CEP57_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,27-UNIMOD:35	ms_run[2]:scan=5737	25.167	3	2736.2409	2736.2409	M	R	2	30
PSM	MDSDSCAAAFHPEEYSPSCK	12	sp|Q86YI8|PHF13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5513	24.192	3	2345.8875	2345.8875	-	R	1	21
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	13	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=6364	27.792	3	2507.1598	2507.1598	-	K	1	25
PSM	ARPDDEEGAAVAPGHPLA	14	sp|Q9Y5Y0|FLVC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=5264	23.057	2	1813.8595	1813.8595	M	K	2	20
PSM	MNHLPEDMENALTGSQSSHASL	15	sp|O95772|STR3N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5653	24.804	3	2442.0428	2442.0428	-	R	1	23
PSM	SDQDHSMDEMTAVVKIE	16	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=5552	24.36	2	1991.8452	1991.8452	M	K	2	19
PSM	SKGPAVGIDLGTTYSCVGVFQHG	17	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=6789	29.53	3	2391.1529	2391.1529	M	K	2	25
PSM	TEADVNPKAYPLADAHLT	18	sp|P55769|NH2L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=6147	26.902	2	1966.9636	1966.9636	M	K	2	20
PSM	ADEDGEGIHPSAPH	19	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=4777	20.913	2	1472.6168	1472.6168	M	R	2	16
PSM	MMHPVASSNPAFCGPGKPSCLNEDAM	20	sp|Q7Z6I8-2|CE024_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=5410	23.728	3	2894.1802	2894.1802	-	R	1	27
PSM	SHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKG	21	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=6950	30.193	3	3515.6401	3515.6401	M	R	2	37
PSM	SKGPAVGIDLGTTYSCVGVFQHG	22	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=6943	30.163	3	2391.1529	2391.1529	M	K	2	25
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	23	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=5764	25.295	3	2633.3085	2633.3085	M	R	2	27
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGK	24	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=5104	22.335	3	3284.5116	3284.5116	M	R	2	41
PSM	AELDIGQHCQVEHC	25	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5539	24.301	2	1736.7247	1736.7247	M	R	2	16
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGK	26	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,36-UNIMOD:35	ms_run[2]:scan=4835	21.166	3	3300.5065	3300.5065	M	R	2	41
PSM	ADEDGEGIHPSAPH	27	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=4693	20.57	2	1472.6168	1472.6168	M	R	2	16
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	28	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5827	25.568	3	2523.1547	2523.1547	-	K	1	25
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	29	sp|P02808|STAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6949	30.189	4	4124.985	4124.9850	R	-	29	63
PSM	MQESGTETKSNGSAIQNGSGGSNHLLECGGL	30	sp|Q9H334-5|FOXP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35,28-UNIMOD:4	ms_run[2]:scan=5808	25.483	3	3177.3939	3177.3939	M	R	2	33
PSM	MQNSHSGVNQLGGVFVNGRPLPDST	31	sp|P26367|PAX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6299	27.528	3	2668.2664	2668.2664	-	R	1	26
PSM	SDQDHSMDEMTAVVKIE	32	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5282	23.137	3	2007.8401	2007.8401	M	K	2	19
PSM	ADEDGEGIHPSAPH	33	sp|Q96L92|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=4686	20.539058542133333	2	1472.6181	1472.6163	M	R	2	16
PSM	MHSLATAAPVPTTLAQVDRE	34	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6109	26.754	3	2165.0787	2165.0787	-	K	1	21
PSM	MHSLATAAPVPTTLAQVDRE	35	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6482	28.271	3	2149.0838	2149.0838	-	K	1	21
PSM	MMHPVASSNPAFCGPGKPSCLNEDAM	36	sp|Q7Z6I8-2|CE024_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=5768	25.316	3	2878.1853	2878.1853	-	R	1	27
PSM	SNPFAHLAEPLDPVQPGK	37	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6915	30.047	3	1957.9898	1957.9898	M	K	2	20
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	38	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5681	24.93	3	2633.3085	2633.3085	M	R	2	27
PSM	PSETPQAEVGPTGCPH	39	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=4607	20.205	2	1662.7308	1662.7308	M	R	2	18
PSM	SDAAVDTSSEITTKDL	40	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6076	26.618	2	1693.7894	1693.7894	M	K	2	18
PSM	SDQDHSMDEMTAVVKIE	41	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=5914	25.938	2	1991.8452	1991.8452	M	K	2	19
PSM	GLSPSAPAVAVQASNASASPPSGCPMHEG	42	sp|P53701|CCHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	24-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=5381	23.598	3	2749.2436	2749.2436	M	K	2	31
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	43	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5926	25.995	3	2633.3085	2633.3085	M	R	2	27
PSM	TDGILGKAATMEIPIHGNGEA	44	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=6354	27.747	3	2152.047	2152.0470	M	R	2	23
PSM	MMQESGTETKSNGSAIQNGSGGSNHLLECGGL	45	sp|Q9H334-5|FOXP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,29-UNIMOD:4	ms_run[2]:scan=5804	25.465	3	3324.4293	3324.4293	-	R	1	33
PSM	SDQDHSMDEMTAVVKIE	46	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6375	27.837	2	1975.8503	1975.8503	M	K	2	19
PSM	AAAAKPNNLSLVVHGPGDL	47	sp|Q00796-2|DHSO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6458	28.173	3	1885.0058	1885.0058	M	R	2	21
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	48	sp|Q00994-2|BEX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4670	20.474	3	2708.1191	2708.1191	-	R	1	26
PSM	MHPVASSNPAFCGPGKPSCLNEDAM	49	sp|Q7Z6I8-2|CE024_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4,19-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=5421	23.777	3	2747.1448	2747.1448	M	R	2	27
PSM	MNHLPEDMENALTGSQSSHASL	50	sp|O95772|STR3N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=6056	26.531	3	2426.0478	2426.0478	-	R	1	23
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	51	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5918	25.96	3	2523.1547	2523.1547	-	K	1	25
PSM	MEAEETMECLQEFPEHH	52	sp|P52739-2|ZN131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5895	25.851	3	2219.8446	2219.8446	-	K	1	18
PSM	MKPPGGESSNLFGSPEEATPSSRPN	53	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5620	24.659441446933332	3	2630.198182	2630.191861	-	R	1	26
PSM	AEAMDLGKDPNGPTHSSTLFV	54	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=6694	29.144	3	2228.0419	2228.0419	M	R	2	23
PSM	MNVDHEVNLLVEEIH	55	sp|Q9P1F3|ABRAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6842	29.742	3	1847.8724	1847.8724	-	R	1	16
PSM	MRDSSAPSSASSSVTDLYCTPHSS	56	sp|Q13098-7|CSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=5507	24.168	3	2587.0803	2587.0803	-	R	1	25
PSM	MTEADVNPKAYPLADAHLT	57	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6104	26.734	3	2113.999	2113.9990	-	K	1	20
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	58	sp|Q00994-2|BEX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=5069	22.188057679733333	3	2692.128693	2692.124192	-	R	1	26
PSM	SETAPAAPAAAPPAE	59	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=5124	22.425412469866668	2	1391.6581	1391.6564	M	K	2	17
PSM	ADKPDMGEIASFD	60	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5829	25.575	2	1452.6079	1452.6079	M	K	2	15
PSM	SETAPAAPAAPAPAEKTPV	61	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4974	21.796	2	1774.9101	1774.9101	M	K	2	21
PSM	SETAPLAPTIPAPAE	62	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6649	28.952	2	1505.7613	1505.7613	M	K	2	17
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	63	sp|Q00994-2|BEX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4978	21.81404145813333	3	2692.125971	2692.124192	-	R	1	26
PSM	AEAMDLGKDPNGPTHSSTLFV	64	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6259	27.362	3	2244.0369	2244.0369	M	R	2	23
PSM	MEGSGEQPGPQPQHPGDH	65	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4024	17.72	3	1941.7912	1941.7912	-	R	1	19
PSM	PSETPQAEVGPTGCPH	66	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=4613	20.23	3	1662.7308	1662.7308	M	R	2	18
PSM	SDEFSLADALPEHSPAKTSAVSNT	67	sp|Q8NDC0|MISSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6503	28.357	3	2515.1714	2515.1714	M	K	2	26
PSM	PALPLDQLQITH	68	sp|Q9H1I8-3|ASCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6485	28.283	2	1344.7402	1344.7402	M	K	2	14
PSM	AAAAKPNNLSLVVHGPGDL	69	sp|Q00796|DHSO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=6587	28.701983836533334	3	1885.9902	1885.0052	M	R	2	21
PSM	ADSELQLVEQ	70	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6729	29.29	2	1172.5561	1172.5561	M	R	2	12
PSM	ADEELEALR	71	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6266	27.391	2	1086.5193	1086.5193	M	R	2	11
PSM	ADSELQLVEQ	72	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6726	29.278	2	1172.5561	1172.5561	M	R	2	12
PSM	MDGIVPDIAVGTK	73	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6444	28.117	2	1372.6908	1372.6908	-	R	1	14
PSM	VSSDRPVSLEDEVSHSM	74	sp|P55197|AF10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=5703	25.024564267466666	3	1930.8586	1930.8573	M	K	2	19
PSM	AGDSEQTLQNHQQPNGGEPFLIGVSGGTASG	75	sp|Q9BZX2|UCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6302	27.53930158213333	3	3053.4032	3052.4122	M	K	2	33
PSM	MDGTAAEPRPGAGSLQHAQPPPQP	76	sp|O15530-2|PDPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5148	22.53	3	2467.155	2467.1550	-	R	1	25
PSM	MNDTVTIRT	77	sp|P62847-2|RS24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5230	22.895	2	1107.523	1107.5230	-	R	1	10
PSM	AATTGSGVKVP	78	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=5358	23.490265839733336	2	1028.5523	1028.5497	M	R	2	13
PSM	MKDCSNGCSAECTGEGGSKEVVGTF	79	sp|P54687|BCAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=5472	24.01052696	3	2725.063962	2724.077168	-	K	1	26
PSM	AAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHP	80	sp|Q96JN8-2|NEUL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5324	23.334	3	3413.4853	3413.4853	M	R	2	47
PSM	ADKEAAFDDAVEE	81	sp|Q09028-3|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5752	25.235	2	1450.61	1450.6100	M	R	2	15
PSM	ATAEVLNIGK	82	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6265	27.385	2	1056.5815	1056.5815	M	K	2	12
PSM	MEGSGEQPGPQPQHPGDH	83	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4656	20.413	3	1925.7962	1925.7962	-	R	1	19
PSM	PTNFTVVPVEAHADGGGDETAE	84	sp|Q9Y666-2|S12A7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5791	25.413	3	2211.992	2211.9920	M	R	2	24
PSM	METEQPEETFPNTETNGEFGK	85	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5584	24.5124965256	3	2472.025546	2472.027481	-	R	1	22
PSM	MTEADVNPKAYPLADAHLT	86	sp|P55769|NH2L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=6507	28.373	3	2098.0041	2098.0041	-	K	1	20
PSM	AEAMDLGKDPNGPTHSSTLFV	87	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[1]:scan=6337	27.679671616533334	3	2244.0390	2244.0363	M	R	2	23
PSM	MMCGAPSATQPATAETQHIADQV	88	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=5391	23.644512780266666	3	2488.068674	2488.066861	-	R	1	24
PSM	PMFIVNTNVP	89	sp|P14174|MIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6362	27.782	2	1146.5743	1146.5743	M	R	2	12
PSM	SGALDVLQM	90	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6889	29.941	2	990.4692	990.4692	M	K	2	11
PSM	SGVRPPIMNGPLHP	91	sp|Q13363-2|CTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=5637	24.732	2	1528.782	1528.7820	M	R	2	16
PSM	SKSFQQSSLS	92	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5112	22.372	2	1139.5459	1139.5459	M	R	2	12
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	93	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=6574	28.6491609296	4	3477.5873	3477.5803	M	K	2	33
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	94	sp|Q00994-2|BEX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=4746	20.7871567232	3	2708.120957	2708.119107	-	R	1	26
PSM	TSGNGNSASSIAGTAPQNGENKPPQAIV	95	sp|Q8IXK0-2|PHC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=5396	23.664264628	3	2667.2732	2666.2892	M	K	2	30
PSM	ATNFLAHE	96	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6280	27.45	2	943.43995	943.4399	M	K	2	10
PSM	GVQVETISPGDG	97	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5269	23.079	2	1157.5564	1157.5564	M	R	2	14
PSM	SNGYEDHMAEDCRGDIG	98	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4876	21.354557211466666	2	1983.7232	1982.7362	M	R	2	19
PSM	AESSDKLY	99	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1	ms_run[2]:scan=5329	23.357	2	953.43419	953.4342	M	R	2	10
PSM	KDFDREVEI	100	sp|Q53HL2|BOREA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5879	25.78	2	1149.5666	1149.5666	L	R	26	35
PSM	MEKTELIQ	101	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5257	23.023	2	1048.5111	1048.5111	-	K	1	9
PSM	SNGYEDHMAEDCRGDIG	102	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	15	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4788	20.957957546933336	2	1983.7202	1982.7362	M	R	2	19
PSM	KEDFASGTAAALAGGITMVCAMPNT	103	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	18-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=5830	25.580524914399998	3	2499.178339	2499.144382	H	R	1482	1507
PSM	KEADESLNFEEQILEAA	104	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5731	25.142115440533335	2	1936.887420	1934.910917	P	K	2333	2350
PSM	KRYNLGDYNGEIMSEVMAQ	105	sp|Q9H2F5|EPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	13-UNIMOD:35,17-UNIMOD:35	ms_run[1]:scan=5249	22.98702536	3	2251.007524	2249.009269	E	R	271	290
PSM	AAQGEPQVQF	106	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:1	ms_run[2]:scan=6494	28.32	2	1115.5247	1115.5247	M	K	2	12
PSM	MEDSMDMDMSPL	107	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5540	24.307	2	1506.487	1506.4870	-	R	1	13
PSM	AKVEQVLSLEPQHEL	108	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=6729	29.28977336666667	3	1760.9318	1760.9303	M	K	2	17
PSM	AKVEQVLSLEPQHEL	109	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:1	ms_run[1]:scan=6726	29.2780400944	3	1760.9318	1760.9303	M	K	2	17
PSM	KTEQELP	110	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	14		ms_run[1]:scan=5423	23.7843849336	2	843.427218	843.433798	T	R	91	98
PSM	KFENLTDPCRNH	111	sp|Q9UHV5|RPGFL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	14	9-UNIMOD:4	ms_run[1]:scan=5746	25.209106675733334	2	1530.720257	1529.704511	R	K	547	559