MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F13.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F13.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1	0.07	51.0	1	1	1
PRT	sp|Q9UBF6-3|RBX2_HUMAN	Isoform 3 of RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	2-UNIMOD:1,11-UNIMOD:4	0.30	50.0	1	1	1
PRT	sp|P54687|BCAT1_HUMAN	Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	0.07	48.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	47.0	1	1	1
PRT	sp|Q9NWK9-2|BCD1_HUMAN	Isoform 2 of Box C/D snoRNA protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	46.0	1	1	1
PRT	sp|Q9NRI5-11|DISC1_HUMAN	Isoform 11 of Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.10	45.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.27	45.0	2	1	0
PRT	sp|Q75N03-2|HAKAI_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	44.0	1	1	1
PRT	sp|Q8IXK0-2|PHC2_HUMAN	Isoform 2 of Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44.0	null		0.09	44.0	2	1	0
PRT	sp|Q5VWJ9|SNX30_HUMAN	Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.04	43.0	1	1	1
PRT	sp|Q9BT23|LIMD2_HUMAN	LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35	0.20	43.0	1	1	1
PRT	sp|Q15714-4|T22D1_HUMAN	Isoform 4 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	42.0	1	1	1
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	15-UNIMOD:4	0.03	41.0	4	1	0
PRT	sp|Q7L266|ASGL1_HUMAN	Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	40.0	2	1	0
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.16	40.0	1	1	1
PRT	sp|Q96L92-3|SNX27_HUMAN	Isoform 2 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.03	39.0	2	1	0
PRT	sp|Q13492-3|PICAL_HUMAN	Isoform 3 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.04	39.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|Q9NSK0-2|KLC4_HUMAN	Isoform 2 of Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.11	37.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,9-UNIMOD:35,13-UNIMOD:4	0.06	37.0	5	1	0
PRT	sp|Q8IUX1-3|T126B_HUMAN	Isoform 3 of Complex I assembly factor TMEM126B, mitochondrial OS=Homo sapiens OX=9606 GN=TMEM126B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,5-UNIMOD:35	0.16	36.0	1	1	1
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,9-UNIMOD:4	0.10	36.0	1	1	1
PRT	sp|O75897-2|ST1C4_HUMAN	Isoform 2 of Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,6-UNIMOD:35	0.07	35.0	1	1	1
PRT	sp|Q9NZL9-4|MAT2B_HUMAN	Isoform 4 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	8-UNIMOD:35,4-UNIMOD:35	0.06	35.0	4	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.15	35.0	2	1	0
PRT	sp|Q6NSI4-2|RADX_HUMAN	Isoform 2 of RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.04	35.0	2	1	0
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.12	34.0	1	1	1
PRT	sp|Q9UJA5-3|TRM6_HUMAN	Isoform 3 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	33.0	4	2	1
PRT	sp|Q00994-2|BEX3_HUMAN	Isoform 2 of Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.26	33.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null		0.14	33.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,5-UNIMOD:35	0.06	32.0	1	1	1
PRT	sp|P11171-7|EPB41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|P02808|STAT_HUMAN	Statherin OS=Homo sapiens OX=9606 GN=STATH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.56	32.0	1	1	1
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	15-UNIMOD:4	0.03	32.0	4	2	1
PRT	sp|Q96L92|SNX27_HUMAN	Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.03	32.0	1	1	0
PRT	sp|Q7Z3B3|KANL1_HUMAN	KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q4VC44-2|FWCH1_HUMAN	Isoform 2 of FLYWCH-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=FLYWCH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.09	31.0	2	2	2
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.03	30.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.18	30.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	4	1	0
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	1	1	1
PRT	sp|O75663-2|TIPRL_HUMAN	Isoform 2 of TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,9-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.12	28.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1.10 OS=Homo sapiens OX=9606 GN=H1-10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	17-UNIMOD:35	0.09	28.0	1	1	1
PRT	sp|Q8TCF1-4|ZFAN1_HUMAN	Isoform 4 of AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,10-UNIMOD:4,15-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|Q9NVZ3-3|NECP2_HUMAN	Isoform 3 of Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	0.12	27.0	1	1	1
PRT	sp|Q9BXW6|OSBL1_HUMAN	Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|Q9H1I8-3|ASCC2_HUMAN	Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9BZF3-6|OSBL6_HUMAN	Isoform 6 of Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	1
PRT	sp|O43776-2|SYNC_HUMAN	Isoform 2 of Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:35	0.22	27.0	3	2	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	3-UNIMOD:4	0.22	27.0	2	1	0
PRT	sp|Q03154-2|ACY1_HUMAN	Isoform 2 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.05	26.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q8NI77|KI18A_HUMAN	Kinesin-like protein KIF18A OS=Homo sapiens OX=9606 GN=KIF18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,9-UNIMOD:4,12-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|O95292-2|VAPB_HUMAN	Isoform 2 of Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.16	24.0	1	1	1
PRT	sp|Q00796-2|DHSO_HUMAN	Isoform 2 of Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.20	22.0	1	1	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1
PRT	sp|Q96AC1|FERM2_HUMAN	Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	421-UNIMOD:35,426-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q9Y2J2-3|E41L3_HUMAN	Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:35	0.36	19.0	2	2	2
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P23443-3|KS6B1_HUMAN	Isoform 2 of Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35,16-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q9Y666-2|S12A7_HUMAN	Isoform 2 of Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	3-UNIMOD:35	0.10	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ADHSFSDGVPSDSVEAAKNASNTE	1	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1	ms_run[2]:scan=5499	24.384	3	2476.0626	2476.0626	M	K	2	26
PSM	ADVEDGEETCALASHSGSSGSKSGGD	2	sp|Q9UBF6-3|RBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=5235	23.094	3	2551.0252	2551.0252	M	K	2	28
PSM	MKDCSNGCSAECTGEGGSKEVVGTF	3	sp|P54687|BCAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=5434	24.071021513599998	3	2724.080303	2724.077168	-	K	1	26
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	4	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5842	25.936	3	2523.1547	2523.1547	-	K	1	25
PSM	MEFAAENEGKSGGGLHSVAEGV	5	sp|Q9NWK9-2|BCD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5812	25.814	3	2232.9957	2232.9957	-	R	1	23
PSM	PGGGPQGAPAAAGGGGVSH	6	sp|Q9NRI5-11|DISC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4144	18.289	2	1500.707	1500.7070	M	R	2	21
PSM	PGLVDSNPAPPESQEK	7	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4963	21.86	2	1663.8053	1663.8053	M	K	2	18
PSM	MDHTDNELQGTNSSGSLGGLDVR	8	sp|Q75N03-2|HAKAI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5731	25.46	3	2460.0823	2460.0823	-	R	1	24
PSM	TSGNGNSASSIAGTAPQNGENKPPQAIV	9	sp|Q8IXK0-2|PHC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	44		ms_run[1]:scan=5372	23.770317287199997	3	2667.2822	2666.2892	M	K	2	30
PSM	AGGPPKALPSTGPHSL	10	sp|Q5VWJ9|SNX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=5481	24.295	2	1527.8045	1527.8045	M	R	2	18
PSM	MFQAAGAAQATPSHDAKGGGSSTVQ	11	sp|Q9BT23|LIMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5057	22.288	3	2432.1027	2432.1027	-	R	1	26
PSM	MHQPPESTAAAAAAADISAR	12	sp|Q15714-4|T22D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5682	25.253	3	2022.9429	2022.9429	-	K	1	21
PSM	PSETPQAEVGPTGCPH	13	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	14-UNIMOD:4	ms_run[2]:scan=4709	20.682	2	1662.7308	1662.7308	M	R	2	18
PSM	MNPIVVVHGGGAGPISKD	14	sp|Q7L266|ASGL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5666	25.185	2	1804.9142	1804.9142	-	R	1	19
PSM	PLPEPSEQEGESVKASQEPSP	15	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5208	22.963	3	2221.0386	2221.0386	M	K	2	23
PSM	ADEDGEGIHPSAPH	16	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=4800	21.097	2	1472.6168	1472.6168	M	R	2	16
PSM	ADEDGEGIHPSAPH	17	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=4875	21.444	2	1472.6168	1472.6168	M	R	2	16
PSM	SGQSLTDRITAAQHSVTGSAVS	18	sp|Q13492-3|PICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6258	27.664	3	2214.0877	2214.0877	M	K	2	24
PSM	SKGPAVGIDLGTTYSCVGVFQHG	19	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=6764	29.772	3	2391.1529	2391.1529	M	K	2	25
PSM	SETAPAAPAAPAPAEKTPV	20	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38		ms_run[1]:scan=5044	22.227812761066666	2	1774.9138	1774.9096	M	K	2	21
PSM	MNPIVVVHGGGAGPISKD	21	sp|Q7L266|ASGL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=6275	27.736	2	1788.9193	1788.9193	-	R	1	19
PSM	SGLVLGQRDEPAGH	22	sp|Q9NSK0-2|KLC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=5539	24.574	2	1476.7321	1476.7321	M	R	2	16
PSM	SNGYEDHMAEDCRGDIG	23	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4849	21.322	2	1982.7371	1982.7371	M	R	2	19
PSM	AASMHGQPSPSLEDAKL	24	sp|Q8IUX1-3|T126B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=5603	24.893	2	1795.8411	1795.8411	M	R	2	19
PSM	ASAGGEDCESPAPEADRPHQ	25	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=4555	20.028	3	2121.8658	2121.8658	M	R	2	22
PSM	ALHDMEDFTFDGTK	26	sp|O75897-2|ST1C4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5999	26.59	2	1683.7087	1683.7087	M	R	2	16
PSM	PEMPEDMEQEEVNIPNR	27	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35	ms_run[2]:scan=5360	23.708	3	2071.8827	2071.8827	M	R	2	19
PSM	PSETPQAEVGPTGCPH	28	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=4789	21.045	2	1662.7308	1662.7308	M	R	2	18
PSM	SDAAVDTSSEITTKDL	29	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=6084	26.943	2	1693.7894	1693.7894	M	K	2	18
PSM	SGESGQPEAGPSHAGLDWPNPERN	30	sp|Q6NSI4-2|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=5810	25.807	3	2530.1109	2530.1109	M	R	2	26
PSM	AGDSEQTLQNHQQPNGGEPFLIGVSGGTASG	31	sp|Q9BZX2|UCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6250	27.628	3	3052.4122	3052.4122	M	K	2	33
PSM	PEMPEDMEQEEVNIPNR	32	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=5139	22.643	3	2087.8776	2087.8776	M	R	2	19
PSM	MEGSGEQPGPQPQHPGDH	33	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=4761	20.918	3	1925.7962	1925.7962	-	R	1	19
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	34	sp|Q00994-2|BEX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4780	21.003	3	2708.1191	2708.1191	-	R	1	26
PSM	PSETPQAEVGPTGCPH	35	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:4	ms_run[2]:scan=4736	20.798	3	1662.7308	1662.7308	M	R	2	18
PSM	DAAVDTSSEITTKDL	36	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=5616	24.952921901066667	2	1564.7492	1564.7463	S	K	3	18
PSM	AEAMDLGKDPNGPTHSSTLFV	37	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=6256	27.657	3	2244.0369	2244.0369	M	R	2	23
PSM	MTTEKSLVTEAENSQHQQ	38	sp|P11171-7|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5593	24.845	3	2117.9535	2117.9535	-	K	1	19
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	39	sp|P02808|STAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6927	30.445	4	4124.985	4124.9850	R	-	29	63
PSM	SETPQAEVGPTGCPH	40	sp|P0DN79|CBSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	13-UNIMOD:4	ms_run[1]:scan=4660	20.4784493216	2	1565.6800	1565.6775	P	R	3	18
PSM	ADEDGEGIHPSAPH	41	sp|Q96L92|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=4776	20.985489700533332	2	1472.6174	1472.6163	M	R	2	16
PSM	AAMAPALTDAAAEAHHI	42	sp|Q7Z3B3|KANL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6078	26.92	2	1717.8094	1717.8094	M	R	2	19
PSM	PEMPEDMEQEEVNIPNR	43	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=5442	24.11	3	2071.8827	2071.8827	M	R	2	19
PSM	PLPEPSEQEGESVKAGQEPSP	44	sp|Q4VC44-2|FWCH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5244	23.139	3	2191.0281	2191.0281	M	K	2	23
PSM	SETAPAAPAAAPPAEKAPV	45	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5051	22.259	2	1744.8996	1744.8996	M	K	2	21
PSM	PEFLEDPSVLTKD	46	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31		ms_run[1]:scan=6285	27.77777607413333	2	1488.7360	1488.7343	M	K	2	15
PSM	APSVPAAEPEYPKGI	47	sp|P54819-3|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5637	25.053	2	1524.7824	1524.7824	M	R	2	17
PSM	ARPDDEEGAAVAPGHPLA	48	sp|Q9Y5Y0|FLVC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5299	23.414	2	1813.8595	1813.8595	M	K	2	20
PSM	PGLVDSNPAPPESQEK	49	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5013	22.099	2	1663.8053	1663.8053	M	K	2	18
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	50	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5802	25.771	3	2633.3085	2633.3085	M	R	2	27
PSM	PSVPAAEPEYPKGI	51	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=5600	24.878278649600002	2	1453.7463	1453.7448	A	R	3	17
PSM	PEMPEDMEQEEVNIPNR	52	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=5344	23.63	2	2071.8827	2071.8827	M	R	2	19
PSM	GVQVETISPGDGRTFP	53	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=5866	26.040393800266667	2	1658.8293	1658.8259	M	K	2	18
PSM	GVQVETISPGDGRTFP	54	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=5967	26.4558286368	2	1658.8293	1658.8259	M	K	2	18
PSM	ATEGMILTNHDHQI	55	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=5656	25.141914294666666	2	1637.7412	1636.7512	M	R	2	16
PSM	ADEGKSYSEHDDE	56	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=4158	18.353	2	1522.5696	1522.5696	M	R	2	15
PSM	MMIHGFQSSH	57	sp|O75663-2|TIPRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=5037	22.198	2	1247.5063	1247.5063	-	R	1	11
PSM	SDAAVDTSSEITTKDL	58	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6112	27.059	2	1693.7894	1693.7894	M	K	2	18
PSM	SGVRPPIMNGPLHP	59	sp|Q13363-2|CTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=5624	24.992	2	1528.782	1528.7820	M	R	2	16
PSM	SHTILLVQPTK	60	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5711	25.382	2	1277.7343	1277.7343	M	R	2	13
PSM	SVELEEALPVTTAEGMAK	61	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:35	ms_run[2]:scan=5992	26.56	2	1889.9292	1889.9292	M	K	2	20
PSM	GVQVETISPGDGRTFP	62	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=6048	26.794949194666668	2	1658.8293	1658.8259	M	K	2	18
PSM	AELDIGQHCQVEHC	63	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5569	24.726	2	1736.7247	1736.7247	M	R	2	16
PSM	GVQVETISPGDGRTFP	64	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6129	27.13	2	1658.8264	1658.8264	M	K	2	18
PSM	MEESGYESVLCVKPDVHVY	65	sp|Q9NVZ3-3|NECP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6605	29.118	3	2298.0184	2298.0184	-	R	1	20
PSM	MNTEAEQQLLHHA	66	sp|Q9BXW6|OSBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5667	25.19	2	1578.7097	1578.7097	-	R	1	14
PSM	PALPLDQLQITH	67	sp|Q9H1I8-3|ASCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6437	28.426	2	1344.7402	1344.7402	M	K	2	14
PSM	SSDEKGISPAH	68	sp|Q9BZF3-6|OSBL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=4079	17.996	2	1168.536	1168.5360	M	K	2	13
PSM	VLAELYVSDREGSDATGDGT	69	sp|O43776-2|SYNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5737	25.491	2	2053.944	2053.9440	M	K	2	22
PSM	VPPVQVSPLIKLG	70	sp|P56385|ATP5I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6608	29.13	2	1345.8333	1345.8333	M	R	2	15
PSM	CGAPSATQPATAETQHIADQV	71	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:4	ms_run[1]:scan=5479	24.287511729333335	3	2151.9891	2151.9850	M	R	3	24
PSM	TSGNGNSASSIAGTAPQNGENKPPQAIV	72	sp|Q8IXK0-2|PHC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=5422	24.014450947466667	3	2667.2822	2666.2892	M	K	2	30
PSM	TSKGPEEEHPSVTLF	73	sp|Q03154-2|ACY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6242	27.595	2	1698.8101	1698.8101	M	R	2	17
PSM	PSETPQAEVGPTGCPH	74	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	14-UNIMOD:4	ms_run[1]:scan=4816	21.176082252799997	2	1662.7307	1662.7303	M	R	2	18
PSM	CGAPSATQPATAETQHIADQV	75	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:4	ms_run[1]:scan=5483	24.305615764	3	2151.9891	2151.9850	M	R	3	24
PSM	PYQYPALTPEQK	76	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=5483	24.305615764	2	1433.7209	1433.7186	M	K	2	14
PSM	PGETEEPRPPEQQDQEGGEAA	77	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4618	20.294	3	2249.9673	2249.9673	M	K	2	23
PSM	SGESGQPEAGPSHAGLDWPNPERN	78	sp|Q6NSI4-2|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5892	26.143	3	2530.1109	2530.1109	M	R	2	26
PSM	SVTEEDLCHHM	79	sp|Q8NI77|KI18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=5118	22.55	2	1414.5493	1414.5493	M	K	2	13
PSM	SNGYEDHMAEDCRGDIG	80	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=5315	23.488994041599998	2	1967.7292	1966.7412	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	81	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4918	21.6388875192	2	1983.7222	1982.7362	M	R	2	19
PSM	AAVKEPLEFHA	82	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5989	26.547	2	1252.6452	1252.6452	M	K	2	13
PSM	AKVEQVLSLEPQHEL	83	sp|O95292-2|VAPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6687	29.456	3	1760.9309	1760.9309	M	K	2	17
PSM	EGSGEQPGPQPQHPGDH	84	sp|Q9UJA5-3|TRM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4178	18.442	2	1752.7452	1752.7452	M	R	2	19
PSM	MVPPVQVSPLIKLG	85	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=6653	29.32	3	1492.8687	1492.8687	-	R	1	15
PSM	PYQYPALTPEQK	86	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5479	24.288	2	1433.7191	1433.7191	M	K	2	14
PSM	SETAPAAPAAAPPAE	87	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5215	23.001	2	1391.6569	1391.6569	M	K	2	17
PSM	SNGYEDHMAEDCRGDIG	88	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=4877	21.451376278133335	2	1983.7222	1982.7362	M	R	2	19
PSM	MEGSGEQPGPQPQHPGDH	89	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4141	18.276	3	1941.7912	1941.7912	-	R	1	19
PSM	MEGSGEQPGPQPQHPGDH	90	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4218	18.624	3	1941.7912	1941.7912	-	R	1	19
PSM	AAAAKPNNLSLVVHGPGDL	91	sp|Q00796-2|DHSO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6438	28.431	3	1885.0058	1885.0058	M	R	2	21
PSM	TSIHFVVHPLPGTEDQLND	92	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6640	29.266	3	2160.0487	2160.0487	M	R	2	21
PSM	MVPPVQVSPLIKLG	93	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=6634	29.238	2	1492.8687	1492.8687	-	R	1	15
PSM	MNNHVSSKPSTM	94	sp|O95573|ACSL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=3529	15.6117357952	2	1406.578847	1405.596600	-	K	1	13
PSM	SSGNAKIGHPAPNF	95	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=5395	23.883389336533334	2	1438.6832	1437.6992	M	K	2	16
PSM	KEESSGTPAHQMNLRGCEVTPDVNISGQ	96	sp|Q96AC1|FERM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=5423	24.0189113808	3	3056.389692	3056.392762	S	K	410	438
PSM	TTESGSDSESKPDQEAEPQEAAGAQG	97	sp|Q9Y2J2-3|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4230	18.676	3	2605.09	2605.0900	M	R	2	28
PSM	ADKPDMGEIASFD	98	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5832	25.899	2	1452.6079	1452.6079	M	K	2	15
PSM	ETEQPEETFPNTETNGEFGK	99	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5504	24.411	3	2282.9815	2282.9815	M	R	2	22
PSM	MDHGGVGPYELGMEHCE	100	sp|P23443-3|KS6B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=5487	24.327	3	1990.7495	1990.7495	-	K	1	18
PSM	PSETPQAEVGPTGCPH	101	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	14-UNIMOD:4	ms_run[2]:scan=4538	19.956	3	1662.7308	1662.7308	M	R	2	18
PSM	PTNFTVVPVEAHADGGGDETAE	102	sp|Q9Y666-2|S12A7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5781	25.675	3	2211.992	2211.9920	M	R	2	24
PSM	SNGYEDHMAEDCRGDIG	103	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4829	21.236	2	1982.7371	1982.7371	M	R	2	19
PSM	PSETPQAEVGPTGCPH	104	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	14-UNIMOD:4	ms_run[1]:scan=4836	21.263346335466668	3	1663.7132	1662.7302	M	R	2	18
PSM	KPDMGEIASFDKA	105	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=5160	22.738332334933332	3	1423.665538	1423.665331	D	K	4	17
PSM	SFDPNLLHNNGHNGYPNGTSAAL	106	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=6442	28.448417430933333	3	2451.1231	2451.1198	M	R	2	25
PSM	PMFIVNTNVP	107	sp|P14174|MIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=6354	28.078	2	1146.5743	1146.5743	M	R	2	12
PSM	PSETPQAEVGPTGCPH	108	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	14-UNIMOD:4	ms_run[1]:scan=4382	19.298944596266665	3	1662.7312	1662.7303	M	R	2	18