MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F14.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F14.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9BT23|LIMD2_HUMAN	LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	1-UNIMOD:1,1-UNIMOD:35	0.20	48.0	2	1	0
PRT	sp|Q9NRI5-11|DISC1_HUMAN	Isoform 11 of Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.10	47.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null		0.27	45.0	3	2	1
PRT	sp|Q5VWJ9|SNX30_HUMAN	Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1	0.04	44.0	1	1	1
PRT	sp|P11908|PRPS2_HUMAN	Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.28	41.0	1	1	1
PRT	sp|Q9Y6K1-3|DNM3A_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	4-UNIMOD:35	0.13	40.0	2	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1,9-UNIMOD:35,13-UNIMOD:4	0.06	40.0	6	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40.0	null	2022-UNIMOD:35	0.01	40.0	1	1	1
PRT	sp|Q96EK4|THA11_HUMAN	THAP domain-containing protein 11 OS=Homo sapiens OX=9606 GN=THAP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	6-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.05	39.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	39.0	2	1	0
PRT	sp|Q15788|NCOA1_HUMAN	Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.01	39.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,12-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,15-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|P10071|GLI3_HUMAN	Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	37.0	1	1	1
PRT	sp|Q96JC9|EAF1_HUMAN	ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|Q5RL73|RBM48_HUMAN	RNA-binding protein 48 OS=Homo sapiens OX=9606 GN=RBM48 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.05	36.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.15	36.0	3	1	0
PRT	sp|Q99707|METH_HUMAN	Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q15554-4|TERF2_HUMAN	Isoform 2 of Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.04	35.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|P11171-7|EPB41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	1	1	1
PRT	sp|Q9Y2J2-3|E41L3_HUMAN	Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q6IA86-4|ELP2_HUMAN	Isoform 4 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	13-UNIMOD:4,14-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9NQ48|LZTL1_HUMAN	Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,18-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|Q13627-4|DYR1A_HUMAN	Isoform 3 of Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q8WWZ3-2|EDAD_HUMAN	Isoform B of Ectodysplasin-A receptor-associated adapter protein OS=Homo sapiens OX=9606 GN=EDARADD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,13-UNIMOD:35	0.07	33.0	2	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	33.0	2	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	3-UNIMOD:4	0.09	33.0	2	1	0
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.07	33.0	1	1	1
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	15-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P20290-2|BTF3_HUMAN	Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	1-UNIMOD:35	0.04	33.0	8	2	0
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q6NXT6-2|TAPT1_HUMAN	Isoform 2 of Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,9-UNIMOD:4	0.10	32.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	5-UNIMOD:35,7-UNIMOD:35	0.01	32.0	3	1	0
PRT	sp|O75528-2|TADA3_HUMAN	Isoform 2 of Transcriptional adapter 3 OS=Homo sapiens OX=9606 GN=TADA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,7-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q03154-2|ACY1_HUMAN	Isoform 2 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	0
PRT	sp|Q9BZF3-6|OSBL6_HUMAN	Isoform 6 of Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.02	31.0	2	1	0
PRT	sp|Q8TB52|FBX30_HUMAN	F-box only protein 30 OS=Homo sapiens OX=9606 GN=FBXO30 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q9BXW6|OSBL1_HUMAN	Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1	0.01	30.0	1	1	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	15-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.20	30.0	2	1	0
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.01	29.0	1	1	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.10	29.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.12	29.0	3	1	0
PRT	sp|Q96D09|GASP2_HUMAN	G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null		0.02	29.0	2	2	2
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,13-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	2	1	0
PRT	sp|P30279-2|CCND2_HUMAN	Isoform 2 of G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	0.06	28.0	2	1	0
PRT	sp|O75663-2|TIPRL_HUMAN	Isoform 2 of TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.06	28.0	2	1	0
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:35,5-UNIMOD:35,8-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q8IY67-3|RAVR1_HUMAN	Isoform 3 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.20	27.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q96EF0-2|MTMR8_HUMAN	Isoform 2 of Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|P68402-3|PA1B2_HUMAN	Isoform 3 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.17	27.0	1	1	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	27.0	1	1	0
PRT	sp|Q16254|E2F4_HUMAN	Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.05	26.0	1	1	1
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O43439-5|MTG8R_HUMAN	Isoform 5 of Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.06	24.0	2	1	0
PRT	sp|Q8NI77|KI18A_HUMAN	Kinesin-like protein KIF18A OS=Homo sapiens OX=9606 GN=KIF18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,9-UNIMOD:4,12-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96JB5|CK5P3_HUMAN	CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q96JB3-2|HIC2_HUMAN	Isoform 2 of Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35,5-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q86X83-2|COMD2_HUMAN	Isoform 2 of COMM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=COMMD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35	0.06	23.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P02808|STAT_HUMAN	Statherin OS=Homo sapiens OX=9606 GN=STATH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.56	22.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q2KHM9|MOONR_HUMAN	Protein moonraker OS=Homo sapiens OX=9606 GN=KIAA0753 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:35,10-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.08	21.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	MFQAAGAAQATPSHDAKGGGSSTVQ	1	sp|Q9BT23|LIMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4916	21.817	3	2432.1027	2432.1027	-	R	1	26
PSM	PGGGPQGAPAAAGGGGVSH	2	sp|Q9NRI5-11|DISC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4030	17.728	2	1500.707	1500.7070	M	R	2	21
PSM	MFQAAGAAQATPSHDAKGGGSSTVQ	3	sp|Q9BT23|LIMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=5432	24.319	3	2416.1077	2416.1077	-	R	1	26
PSM	PGLVDSNPAPPESQEK	4	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4817	21.323	2	1663.8053	1663.8053	M	K	2	18
PSM	AGGPPKALPSTGPHSL	5	sp|Q5VWJ9|SNX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=5334	23.85	2	1527.8045	1527.8045	M	R	2	18
PSM	PNIVLFSGSSHQDLSQ	6	sp|P11908|PRPS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5920	26.616	2	1727.8479	1727.8479	M	R	2	18
PSM	AGPESDAQYQFTGIK	7	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5521	24.723	2	1610.7577	1610.7577	M	K	2	17
PSM	PAMPSSGPGDTSSSAAEREED	8	sp|Q9Y6K1-3|DNM3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35	ms_run[2]:scan=4025	17.704	2	2092.8491	2092.8491	M	R	2	23
PSM	SNGYEDHMAEDCRGDIG	9	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4757	21.039	2	1982.7371	1982.7371	M	R	2	19
PSM	PGTETEESMGGGEGNH	10	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40	9-UNIMOD:35	ms_run[1]:scan=3430	15.155431123733333	2	1603.6078	1603.6051	D	R	2014	2030
PSM	PGFTCCVPGCYNNSH	11	sp|Q96EK4|THA11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5324	23.807	2	1768.6756	1768.6756	M	R	2	17
PSM	SHQTGIQASEDVKEIFA	12	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=6210	27.814	2	1900.9167	1900.9167	M	R	2	19
PSM	SKGPAVGIDLGTTYSCVGVFQHG	13	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=6573	29.308	3	2391.1529	2391.1529	M	K	2	25
PSM	SNGYEDHMAEDCRGDIG	14	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5146	22.954	2	1966.7422	1966.7422	M	R	2	19
PSM	SSDASQGVITTPPPPSMPHKE	15	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=4973	22.096	3	2220.0369	2220.0369	M	R	2	23
PSM	SGLGDSSSDPANPDSHK	16	sp|Q15788|NCOA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=4498	19.8226627216	2	1711.7311	1711.7280	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	17	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4675	20.632	2	1982.7371	1982.7371	M	R	2	19
PSM	MKAQGETEESEKLS	18	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4241	18.672670263733334	2	1623.732063	1623.729782	-	K	1	15
PSM	ADSRDPASDQMQHW	19	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=5050	22.475	2	1700.6849	1700.6849	M	K	2	16
PSM	ASASYHISNLLEKMTSSD	20	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=6085	27.293	3	2010.9204	2010.9204	M	K	2	20
PSM	MEAQSHSSTTTEK	21	sp|P10071|GLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3411	15.068	2	1493.6304	1493.6304	-	K	1	14
PSM	MNGTANPLLDREEHCL	22	sp|Q96JC9|EAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=5849	26.301	2	1926.8564	1926.8564	-	R	1	17
PSM	PAMPSSGPGDTSSSAAEREED	23	sp|Q9Y6K1-3|DNM3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4580	20.186	2	2076.8542	2076.8542	M	R	2	23
PSM	ASSGGELGSLFDHHVQ	24	sp|Q5RL73|RBM48_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6377	28.507	2	1681.7696	1681.7696	M	R	2	18
PSM	SDAAVDTSSEITTKDL	25	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5901	26.526	2	1693.7894	1693.7894	M	K	2	18
PSM	PALQDLSQPEGLK	26	sp|Q99707|METH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36		ms_run[1]:scan=5477	24.527477201866667	2	1394.7410	1394.7400	S	K	3	16
PSM	AAGAGTAGPASGPGVVRDPAASQP	27	sp|Q15554-4|TERF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4939	21.931	3	2061.0239	2061.0239	M	R	2	26
PSM	ADEGKSYSEHDDE	28	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=4061	17.877	2	1522.5696	1522.5696	M	R	2	15
PSM	PGETEEPRPPEQQDQEGGEAA	29	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4466	19.676	3	2249.9673	2249.9673	M	K	2	23
PSM	TTEKSLVTEAENSQHQQ	30	sp|P11171-7|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=5433	24.325	3	1970.9181	1970.9181	M	K	2	19
PSM	TTESGSDSESKPDQEAEPQEAAGAQG	31	sp|Q9Y2J2-3|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4117	18.134	3	2605.09	2605.0900	M	R	2	28
PSM	VAPVLETSHVFCCPN	32	sp|Q6IA86-4|ELP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5815	26.148	2	1728.7964	1728.7964	M	R	2	17
PSM	AELGLNEHHQNEVINYM	33	sp|Q9NQ48|LZTL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=5745	25.839	3	2067.932	2067.9320	M	R	2	19
PSM	MHTGGETSACKPSSV	34	sp|Q13627-4|DYR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=4068	17.909	2	1605.6763	1605.6763	-	R	1	16
PSM	SDAAVDTSSEITTKDL	35	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=5415	24.244	2	1693.7894	1693.7894	M	K	2	18
PSM	ASPDDPLRADHMV	36	sp|Q8WWZ3-2|EDAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=5276	23.58	2	1480.6616	1480.6616	M	K	2	15
PSM	MEGHDPKEPEQL	37	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4814	21.31	2	1466.6348	1466.6348	-	R	1	13
PSM	MEGHDPKEPEQL	38	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5191	23.17	2	1450.6398	1450.6398	-	R	1	13
PSM	PCSEETPAISPSK	39	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=4386	19.324	2	1401.6446	1401.6446	M	R	2	15
PSM	TTNAGPLHPYWPQHL	40	sp|Q15125|EBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=6481	28.923	2	1772.8635	1772.8635	M	R	2	17
PSM	SETPQAEVGPTGCPH	41	sp|P0DN79|CBSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	13-UNIMOD:4	ms_run[1]:scan=4512	19.890655907466666	2	1565.6800	1565.6775	P	R	3	18
PSM	MKETIMNQEKLA	42	sp|P20290-2|BTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=4793	21.214057520533334	2	1508.723603	1508.721467	-	K	1	13
PSM	MPYQYPALTPEQK	43	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:35	ms_run[1]:scan=5346	23.905056349333332	2	1581.757815	1580.754481	-	K	1	14
PSM	AGGEAGVTLGQPHLS	44	sp|Q2VIR3-2|IF2GL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5258	23.495	2	1392.6997	1392.6997	M	R	2	17
PSM	AGVGDAAAPGEGGGGGVDGPQRDG	45	sp|Q6NXT6-2|TAPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4571	20.15	2	2022.8991	2022.8991	M	R	2	26
PSM	ASAGGEDCESPAPEADRPHQ	46	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=4421	19.466	3	2121.8658	2121.8658	M	R	2	22
PSM	ASPDDPLRADHMV	47	sp|Q8WWZ3-2|EDAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=5715	25.699	2	1464.6667	1464.6667	M	K	2	15
PSM	MPYQYPALTPEQK	48	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5581	25.029	2	1564.7596	1564.7596	-	K	1	14
PSM	PAIMTMLADHAA	49	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=5004	22.248	2	1272.5842	1272.5842	M	R	2	14
PSM	PYQYPALTPEQK	50	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5322	23.802	2	1433.7191	1433.7191	M	K	2	14
PSM	SELKDCPLQFHDF	51	sp|O75528-2|TADA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=6480	28.918	2	1676.7505	1676.7505	M	K	2	15
PSM	TSKGPEEEHPSVTLF	52	sp|Q03154-2|ACY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=6003	26.956	2	1698.8101	1698.8101	M	R	2	17
PSM	APSVPAAEPEYPKGI	53	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5478	24.532	2	1524.7824	1524.7824	M	R	2	17
PSM	PAIMTMLADHAA	54	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4864	21.559	2	1272.5842	1272.5842	M	R	2	14
PSM	PEFLEDPSVLTKD	55	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6075	27.247	2	1488.7348	1488.7348	M	K	2	15
PSM	PGLVDSNPAPPESQEK	56	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4885	21.662	2	1663.8053	1663.8053	M	K	2	18
PSM	PYQYPALTPEQK	57	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5239	23.41	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	58	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5435	24.336	2	1433.7191	1433.7191	M	K	2	14
PSM	SSDEKGISPAH	59	sp|Q9BZF3-6|OSBL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=4038	17.766	2	1168.536	1168.5360	M	K	2	13
PSM	MEEELQHSHCVNCVS	60	sp|Q8TB52|FBX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4866	21.57	2	1915.7499	1915.7499	-	R	1	16
PSM	MNTEAEQQLLHHA	61	sp|Q9BXW6|OSBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6010	26.983	2	1562.7147	1562.7147	-	R	1	14
PSM	PCSEETPAISPSK	62	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=4474	19.707	2	1401.6446	1401.6446	M	R	2	15
PSM	PLENLEEEGLPKNPDL	63	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6017	27.01	2	1805.9047	1805.9047	M	R	2	18
PSM	PSETPQAEVGPTGCPH	64	sp|P35520|CBS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:4	ms_run[2]:scan=4596	20.254	3	1662.7308	1662.7308	M	R	2	18
PSM	VPPVQVSPLIKLG	65	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=6375	28.50012359866667	2	1345.8345	1345.8328	M	R	2	15
PSM	PAIMTMLADHAA	66	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	4-UNIMOD:35	ms_run[1]:scan=5568	24.966590912266668	2	1256.5895	1256.5888	M	R	2	14
PSM	AAVKEPLEFHA	67	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5777	25.98	2	1252.6452	1252.6452	M	K	2	13
PSM	SEGDSVGESVHGKPSVVY	68	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5261	23.508	2	1873.8694	1873.8694	M	R	2	20
PSM	SHTILLVQPTK	69	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5543	24.84	2	1277.7343	1277.7343	M	R	2	13
PSM	TGAEIEPSAQAKPE	70	sp|Q96D09|GASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4370	19.248	2	1426.694	1426.6940	M	K	2	16
PSM	AADISESSGADCKGD	71	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=4762	21.062562740266667	2	1523.6046	1523.6041	M	P	2	17
PSM	GVQVETISPGDGRTFP	72	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=5692	25.584424369066667	2	1658.8306	1658.8259	M	K	2	18
PSM	ADSRDPASDQMQHW	73	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5463	24.47	2	1684.69	1684.6900	M	K	2	16
PSM	MELLCHEVDPVR	74	sp|P30279-2|CCND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=5894	26.495	2	1554.717	1554.7171	-	R	1	13
PSM	MELLCHEVDPVR	75	sp|P30279-2|CCND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=5900	26.52	2	1554.717	1554.7171	-	R	1	13
PSM	MMIHGFQSSH	76	sp|O75663-2|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=4888	21.678	2	1247.5063	1247.5063	-	R	1	11
PSM	MMIHGFQSSH	77	sp|O75663-2|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=5520	24.721	2	1231.5114	1231.5114	-	R	1	11
PSM	MPYQYPALTPEQK	78	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5587	25.057	2	1564.7596	1564.7596	-	K	1	14
PSM	MYDNMSTMVYIKED	79	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35,5-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5060	22.525	2	1786.71	1786.7100	-	K	1	15
PSM	SSDASQGVITTPPPPSMPHKE	80	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5316	23.774	3	2204.0419	2204.0419	M	R	2	23
PSM	AADVSVTHRPPLSP	81	sp|Q8IY67-3|RAVR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5403	24.184	2	1487.7732	1487.7732	M	K	2	16
PSM	ATEGMILTNHDHQI	82	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5515	24.698	2	1636.7515	1636.7515	M	R	2	16
PSM	MDHITVPKVENV	83	sp|Q96EF0-2|MTMR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5628	25.264	2	1438.7126	1438.7126	-	K	1	13
PSM	SHTILLVQPTK	84	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5631	25.28	2	1277.7343	1277.7343	M	R	2	13
PSM	SNGYEDHMAEDCRGDIG	85	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=5179	23.117	2	1966.7422	1966.7422	M	R	2	19
PSM	SQGDSNPAAIPHAAEDIQGDD	86	sp|P68402-3|PA1B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5225	23.34	3	2106.909	2106.9090	M	R	2	23
PSM	SSDASQGVITTPPPPSMPHKE	87	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=4914	21.810001512533333	3	2220.0386	2220.0363	M	R	2	23
PSM	AEAGPQAPPPPGTPSRHE	88	sp|Q16254|E2F4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=4681	20.665	2	1836.8755	1836.8755	M	K	2	20
PSM	VPPVQVSPLIKLG	89	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=6463	28.8484169712	2	1345.8345	1345.8328	M	R	2	15
PSM	MNNHVSSKPSTM	90	sp|O95573|ACSL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=3463	15.294959312533333	2	1406.582240	1405.596600	-	K	1	13
PSM	APAEILNGKEISAQI	91	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=5862	26.3623023832	2	1553.8312	1552.8452	M	R	2	17
PSM	PGETEEPRPPEQQDQEGGEAA	92	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4376	19.277	3	2249.9673	2249.9673	M	K	2	23
PSM	GLVDSNPAPPESQEK	93	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=4722	20.87003900746667	2	1566.7549	1566.7520	P	K	3	18
PSM	SHTILLVQPTK	94	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=5673	25.489281178133336	2	1278.7202	1277.7342	M	R	2	13
PSM	PYQYPALTPEQK	95	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5389	24.119	2	1433.7191	1433.7191	M	K	2	14
PSM	SNGYEDHMAEDCRGDIG	96	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4723	20.875	2	1982.7371	1982.7371	M	R	2	19
PSM	VGVPGAAAFQLGPEK	97	sp|O43439-5|MTG8R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5961	26.782	2	1439.7773	1439.7773	M	R	2	17
PSM	PSVPAAEPEYPKGI	98	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=5487	24.575893559466667	2	1453.7455	1453.7448	A	R	3	17
PSM	PSVPAAEPEYPKGI	99	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=5404	24.188673164	2	1453.7455	1453.7448	A	R	3	17
PSM	SVTEEDLCHHM	100	sp|Q8NI77|KI18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,8-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=4980	22.13160155386667	2	1414.5482	1414.5488	M	K	2	13
PSM	KPPPGRPQPDSG	101	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4462	19.659	2	1231.6309	1231.6309	V	R	4	16
PSM	MEDHQHVPIDIQTS	102	sp|Q96JB5|CK5P3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5311	23.75	2	1706.757	1706.7570	-	K	1	15
PSM	MGPDMELPSHS	103	sp|Q96JB3-2|HIC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4343	19.137	2	1231.4849	1231.4849	-	K	1	12
PSM	MLLELSEEH	104	sp|Q86X83-2|COMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=5456	24.433	2	1115.5169	1115.5169	-	K	1	10
PSM	GAEIEPSAQAKPE	105	sp|Q96D09|GASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=4299	18.951633333866667	2	1325.6463	1325.6458	T	K	3	16
PSM	GVQVETISPGDGRTFP	106	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5918	26.609	2	1658.8264	1658.8264	M	K	2	18
PSM	MESYHKPDQQ	107	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3857	16.988	2	1319.5452	1319.5452	-	K	1	11
PSM	RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF	108	sp|P02808|STAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6770	30.116	4	4124.985	4124.9850	R	-	29	63
PSM	SNGYEDHMAEDCRGDIG	109	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4812	21.305	2	1982.7371	1982.7371	M	R	2	19
PSM	SSDEKGISPAH	110	sp|Q9BZF3-6|OSBL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=3962	17.427	2	1168.536	1168.5360	M	K	2	13
PSM	PEFLEDPSVLTKD	111	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6116	27.417253754666667	2	1488.7359	1488.7343	M	K	2	15
PSM	APSVPAAEPEYPKGI	112	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5604	25.145	2	1524.7824	1524.7824	M	R	2	17
PSM	ASGADSKGDDLSTAIL	113	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5675	25.5	2	1561.7471	1561.7471	M	K	2	18
PSM	MGPGQPASTCVHLAP	114	sp|Q2KHM9|MOONR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=5171	23.075	2	1537.7017	1537.7017	-	R	1	16
PSM	SDAAVDTSSEITTKDL	115	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5498	24.628	2	1693.7894	1693.7894	M	K	2	18
PSM	PYQYPALTPEQK	116	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=6995	30.99923392266667	2	1434.7212	1433.7182	M	K	2	14
PSM	SSGNAKIGHPAPNF	117	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=5256	23.491292398933336	2	1438.6832	1437.6992	M	K	2	16