MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F16.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	52.0	null	716-UNIMOD:35	0.05	52.0	6	2	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.02	52.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	274-UNIMOD:35	0.10	49.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.11	46.0	12	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.30	45.0	2	1	0
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	462-UNIMOD:4	0.05	45.0	1	1	1
PRT	sp|Q8N5L8|RP25L_HUMAN	Ribonuclease P protein subunit p25-like protein OS=Homo sapiens OX=9606 GN=RPP25L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	131-UNIMOD:4,145-UNIMOD:35,150-UNIMOD:4	0.19	45.0	1	1	1
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.08	45.0	1	1	1
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.08	44.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|Q13112|CAF1B_HUMAN	Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null		0.02	41.0	2	2	2
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	99-UNIMOD:35,110-UNIMOD:35,111-UNIMOD:35	0.09	41.0	3	1	0
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41.0	null		0.14	41.0	3	2	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.01	40.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	110-UNIMOD:35,125-UNIMOD:35,144-UNIMOD:35	0.08	40.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	311-UNIMOD:35	0.03	40.0	2	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.01	38.0	1	1	1
PRT	sp|O75956|CDKA2_HUMAN	Cyclin-dependent kinase 2-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK2AP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.33	38.0	1	1	1
PRT	sp|Q86SK9-2|SCD5_HUMAN	Isoform 2 of Stearoyl-CoA desaturase 5 OS=Homo sapiens OX=9606 GN=SCD5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	14-UNIMOD:4	0.06	38.0	1	1	1
PRT	sp|Q9H147|TDIF1_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q13190-4|STX5_HUMAN	Isoform 4 of Syntaxin-5 OS=Homo sapiens OX=9606 GN=STX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	55-UNIMOD:35,57-UNIMOD:4	0.12	37.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.08	37.0	1	1	1
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.02	37.0	1	1	1
PRT	sp|Q9Y5N5-2|N6MT1_HUMAN	Isoform 2 of Methyltransferase N6AMT1 OS=Homo sapiens OX=9606 GN=N6AMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.08	36.0	1	1	1
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.28	36.0	1	1	1
PRT	sp|O14744-4|ANM5_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	653-UNIMOD:35,657-UNIMOD:35,658-UNIMOD:35,662-UNIMOD:35	0.05	36.0	2	1	0
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q8N3R9|MPP5_HUMAN	MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	376-UNIMOD:35	0.03	36.0	1	1	0
PRT	sp|Q9BXS9-7|S26A6_HUMAN	Isoform 7 of Solute carrier family 26 member 6 OS=Homo sapiens OX=9606 GN=SLC26A6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	22-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q8IZ40|RCOR2_HUMAN	REST corepressor 2 OS=Homo sapiens OX=9606 GN=RCOR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	5-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	312-UNIMOD:35,330-UNIMOD:35,331-UNIMOD:35	0.10	35.0	2	1	0
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	188-UNIMOD:35	0.08	34.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	2	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.02	34.0	3	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:4	0.04	34.0	4	2	0
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	3-UNIMOD:4	0.09	33.0	1	1	1
PRT	sp|Q7Z7K6-3|CENPV_HUMAN	Isoform 3 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.16	33.0	1	1	1
PRT	sp|Q9NQ48|LZTL1_HUMAN	Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,18-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	1	1	1
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	5	4	3
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	1-UNIMOD:35	0.07	32.0	16	3	1
PRT	sp|Q9Y6B7-2|AP4B1_HUMAN	Isoform 2 of AP-4 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP4B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P04637-5|P53_HUMAN	Isoform 5 of Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	27-UNIMOD:35	0.12	32.0	1	1	1
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NUQ6-2|SPS2L_HUMAN	Isoform 2 of SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.02	31.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,14-UNIMOD:35	0.03	31.0	2	1	0
PRT	sp|O95707|RPP29_HUMAN	Ribonuclease P protein subunit p29 OS=Homo sapiens OX=9606 GN=POP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	5-UNIMOD:35,7-UNIMOD:35	0.01	31.0	3	1	0
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	641-UNIMOD:35,645-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	3	1	0
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	60-UNIMOD:4	0.27	30.0	1	1	1
PRT	sp|B2RUZ4|SMIM1_HUMAN	Small integral membrane protein 1 OS=Homo sapiens OX=9606 GN=SMIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	29.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	1	1	1
PRT	sp|Q15208|STK38_HUMAN	Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,3-UNIMOD:35,9-UNIMOD:4,12-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null		0.02	29.0	5	1	0
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	457-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q06265|EXOS9_HUMAN	Exosome complex component RRP45 OS=Homo sapiens OX=9606 GN=EXOSC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	1	1	1
PRT	sp|O00743-2|PPP6_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	4	1	0
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	0.09	27.0	1	1	1
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P58876|H2B1D_HUMAN	Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	1	0
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.09	27.0	4	2	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	662-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q99942|RNF5_HUMAN	E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|Q99967-2|CITE2_HUMAN	Isoform 2 of Cbp/p300-interacting transactivator 2 OS=Homo sapiens OX=9606 GN=CITED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,5-UNIMOD:35,6-UNIMOD:35,8-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q5T9L3-3|WLS_HUMAN	Isoform 3 of Protein wntless homolog OS=Homo sapiens OX=9606 GN=WLS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	9-UNIMOD:35	0.03	26.0	1	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.20	26.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	41-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|Q96CW1-2|AP2M1_HUMAN	Isoform 2 of AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|Q04637-5|IF4G1_HUMAN	Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q9Y3C4-2|TPRKB_HUMAN	Isoform 2 of EKC/KEOPS complex subunit TPRKB OS=Homo sapiens OX=9606 GN=TPRKB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:35,13-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|O00400|ACATN_HUMAN	Acetyl-coenzyme A transporter 1 OS=Homo sapiens OX=9606 GN=SLC33A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null		0.04	26.0	9	2	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	2	1	0
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9H6R0|DHX33_HUMAN	ATP-dependent RNA helicase DHX33 OS=Homo sapiens OX=9606 GN=DHX33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4	0.05	25.0	1	1	0
PRT	sp|Q9GZT9-3|EGLN1_HUMAN	Isoform 3 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9UQR0|SCML2_HUMAN	Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	10-UNIMOD:35	0.02	25.0	4	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q5T9L3|WLS_HUMAN	Protein wntless homolog OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q8NCE0-5|SEN2_HUMAN	Isoform 5 of tRNA-splicing endonuclease subunit Sen2 OS=Homo sapiens OX=9606 GN=TSEN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|O60237-2|MYPT2_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|P63267-2|ACTH_HUMAN	Isoform 2 of Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	0
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:35	0.13	24.0	9	2	0
PRT	sp|O75663-2|TIPRL_HUMAN	Isoform 2 of TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:35	0.06	24.0	2	1	0
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:35,4-UNIMOD:35,5-UNIMOD:35	0.09	24.0	6	1	0
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O95433|AHSA1_HUMAN	Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	163-UNIMOD:35,168-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	295-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	706-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q9H6L2|TM231_HUMAN	Transmembrane protein 231 OS=Homo sapiens OX=9606 GN=TMEM231 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q13029-3|PRDM2_HUMAN	Isoform 3 of PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,6-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q13642|FHL1_HUMAN	Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4	0.03	22.0	1	1	0
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	33-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q8IXS6-2|PALM2_HUMAN	Isoform 2 of Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|P30304-2|MPIP1_HUMAN	Isoform 2 of M-phase inducer phosphatase 1 OS=Homo sapiens OX=9606 GN=CDC25A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q9BZL1|UBL5_HUMAN	Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:35,6-UNIMOD:4	0.16	21.0	1	1	1
PRT	sp|Q6N069-5|NAA16_HUMAN	Isoform 5 of N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA16	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|A1L390-3|PKHG3_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9UHX1|PUF60_HUMAN	Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	307-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:35,7-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.18	19.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	1	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=6427	28.63	3	3518.5254	3518.5254	I	R	693	727
PSM	KSPEEPSTPGTVVSSPSISTPPIVPDIQ	2	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=6282	27.934	3	2845.4597	2845.4597	N	K	168	196
PSM	KEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGL	3	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	15-UNIMOD:35	ms_run[2]:scan=6184	27.456	3	3541.6254	3541.6254	S	K	260	294
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	4	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=5307	23.500100019199998	3	3724.204998	3722.195067	V	K	157	189
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	5	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5368	23.743	3	2773.4246	2773.4246	G	K	61	94
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	6	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	24-UNIMOD:35	ms_run[2]:scan=6040	26.773	3	3534.5203	3534.5203	I	R	693	727
PSM	KSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASP	7	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	12-UNIMOD:4	ms_run[2]:scan=6254	27.798	4	4371.1792	4371.1792	P	K	451	498
PSM	RDPLDPNECGYQPPGAPPGLGSMPSSSCGP	8	sp|Q8N5L8|RP25L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	9-UNIMOD:4,23-UNIMOD:35,28-UNIMOD:4	ms_run[2]:scan=5916	26.183	3	3112.3325	3112.3325	S	R	123	153
PSM	VGVKPVGSDPDFQPELSGAGS	9	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5698	25.158	2	2041.9956	2041.9956	M	R	2	23
PSM	KAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQT	10	sp|Q9BYJ9|YTHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5831	25.773136645066664	4	4728.450232	4728.441238	P	R	282	327
PSM	KDPDSNPYSLLDTSEPEPPVDSEPGEPPPASA	11	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=6227	27.6660241672	3	3333.512442	3333.504857	L	R	512	544
PSM	KTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPEL	12	sp|Q13112|CAF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6163	27.354	3	3765.7956	3765.7956	L	K	506	543
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=5189	23.0720797792	3	3724.204998	3722.195067	V	K	157	189
PSM	APAEILNGKEISAQI	14	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5995	26.565	2	1552.8461	1552.8461	M	R	2	17
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	15	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	15-UNIMOD:35,26-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=5229	23.221	3	3598.4393	3598.4393	D	K	85	117
PSM	APIKVGDAIPAVEVFEGEPGN	16	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41		ms_run[1]:scan=6688	29.847803035466665	2	2108.0825	2108.0785	M	K	2	23
PSM	AHNAGAAAAAGTHSA	17	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=3952	17.505	2	1318.6014	1318.6014	M	K	2	17
PSM	KAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMT	18	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35,18-UNIMOD:35,37-UNIMOD:35	ms_run[2]:scan=6644	29.655	4	3807.9461	3807.9461	Y	R	108	146
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILT	19	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6560	29.28	3	3287.7289	3287.7289	A	K	489	523
PSM	KTDLNPDNLQGGDDLDPNYVLSS	20	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6261	27.831	3	2489.1558	2489.1558	H	R	107	130
PSM	KVPPPPETPMPPPLPPTPDQVIV	21	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	10-UNIMOD:35	ms_run[2]:scan=6281	27.93	3	2458.3182	2458.3182	Q	R	302	325
PSM	PTGDFDSKPSWADQVEEEGEDD	22	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5874	25.982	3	2451.9826	2451.9826	M	K	2	24
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	23	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6569	29.321	3	3503.6315	3503.6315	I	R	685	719
PSM	PGIDKLPIEETLEDSPQT	24	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6297	28.007	2	1980.9892	1980.9892	M	R	2	20
PSM	AKYGEHEASPDNGQNEFSDII	25	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=6229	27.674	3	2362.0349	2362.0349	M	K	2	23
PSM	KPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPF	26	sp|O75956|CDKA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6090	27.003	3	3651.8421	3651.8421	Y	R	4	45
PSM	PGPATDAGKIPFCDA	27	sp|Q86SK9-2|SCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	13-UNIMOD:4	ms_run[2]:scan=5652	24.952	2	1515.7028	1515.7028	M	K	2	17
PSM	PIKVGDAIPAVEVFEGEPGN	28	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38		ms_run[1]:scan=6671	29.773072647733333	2	2037.0462	2037.0413	A	K	3	23
PSM	GATGDAEQPRGPSGAE	29	sp|Q9H147|TDIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3873	17.108	2	1498.6648	1498.6648	M	R	2	18
PSM	KTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSC	30	sp|Q13190-4|STX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	34-UNIMOD:35,36-UNIMOD:4	ms_run[2]:scan=6517	29.076	4	3630.8161	3630.8161	S	R	22	58
PSM	SSGNAKIGHPAPNF	31	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=5140	22.883	2	1437.7001	1437.7001	M	K	2	16
PSM	ADEGKSYSEHDDE	32	sp|Q9UBU9|NXF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=4050	17.9431452392	2	1522.5700	1522.5691	M	R	2	15
PSM	AGENFATPFHGHVG	33	sp|Q9Y5N5-2|N6MT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5834	25.789	2	1481.6688	1481.6688	M	R	2	16
PSM	AGPESDAQYQFTGIK	34	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5584	24.665	2	1610.7577	1610.7577	M	K	2	17
PSM	KDDGVSIPGEYTSFLAPISSS	35	sp|O14744-4|ANM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6802	30.339	2	2169.0477	2169.0477	L	K	287	308
PSM	KDPAEPETVPDGETPEDENPTEEGADNSSA	36	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4946	22.055	3	3126.2909	3126.2909	E	K	682	712
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	37	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=5899	26.095	3	3230.4029	3230.4029	Q	R	630	663
PSM	KLAEEVPPPPEGLIPAPPVPETTPTPPT	38	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6431	28.652	3	2870.5317	2870.5317	V	K	419	447
PSM	TTSHMNGHVTEESDSEV	39	sp|Q8N3R9|MPP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=4271	19.057	2	1916.7694	1916.7694	M	K	2	19
PSM	KVPPPPETPMPPPLPPTPDQVIV	40	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	10-UNIMOD:35	ms_run[1]:scan=6268	27.8676413296	3	2458.321756	2458.318171	Q	R	367	390
PSM	GLADASGPRDTQALLSATQAMDL	41	sp|Q9BXS9-7|S26A6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	21-UNIMOD:35	ms_run[2]:scan=6321	28.121	3	2317.122	2317.1220	M	R	2	25
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	42	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	24-UNIMOD:35	ms_run[2]:scan=6128	27.185	3	3534.5203	3534.5203	I	R	693	727
PSM	PSVMEKPSAGSGILS	43	sp|Q8IZ40|RCOR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35	ms_run[2]:scan=5006	22.3	2	1474.7337	1474.7337	M	R	2	17
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	44	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35,22-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=5945	26.318	4	3498.6833	3498.6833	N	R	309	345
PSM	KAFLADPSAFVAAAPVAAATTAAPAAAAAPA	45	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6690	29.856	3	2751.4596	2751.4596	V	K	204	235
PSM	KDGDSVMVLPTIPEEEA	46	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35	ms_run[2]:scan=6044	26.791	2	1844.8714	1844.8714	W	K	182	199
PSM	KDGDSVMVLPTIPEEEA	47	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6417	28.58	2	1828.8764	1828.8764	W	K	182	199
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	48	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6897	30.646	3	3722.1951	3722.1951	V	K	157	189
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	49	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6119	27.144	3	3518.5254	3518.5254	I	R	693	727
PSM	MNNHVSSKPSTM	50	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=3462	15.281	2	1405.5966	1405.5966	-	K	1	13
PSM	MVFFTCNACGESVK	51	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5512	24.352	2	1664.6997	1664.6997	-	K	1	15
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	52	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6905	30.677914194133333	3	3724.209287	3722.195067	V	K	157	189
PSM	KDLPPPPPPPQPPAPIQPQSVPPPIQPEAE	53	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6045	26.797	4	3154.6703	3154.6703	K	K	813	843
PSM	MEGHDPKEPEQL	54	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4769	21.255	2	1466.6348	1466.6348	-	R	1	13
PSM	MNNHVSSKPSTM	55	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4029	17.846	2	1389.6017	1389.6017	-	K	1	13
PSM	PCSEETPAISPSK	56	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=4363	19.512	2	1401.6446	1401.6446	M	R	2	15
PSM	RAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQ	57	sp|Q7Z7K6-3|CENPV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6779	30.242	4	4345.1754	4345.1754	P	R	69	112
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	58	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7210	31.7630901264	3	3724.207174	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	59	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7158	31.58228724106667	3	3724.204507	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	60	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7123	31.447344368266666	3	3723.199597	3722.195067	V	K	157	189
PSM	AELGLNEHHQNEVINYM	61	sp|Q9NQ48|LZTL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=5845	25.841805400800002	3	2067.9346	2067.9315	M	R	2	19
PSM	AHQTGIHATEEL	62	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=5105	22.736	2	1347.6419	1347.6419	M	K	2	14
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	63	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=5519	24.384	3	3582.4444	3582.4444	D	K	85	117
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	64	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=6079	26.952	3	3230.4029	3230.4029	Q	R	630	663
PSM	KLAEEVPPPPEGLIPAPPVPETTPTPPT	65	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6447	28.727	3	2870.5317	2870.5317	V	K	419	447
PSM	KTPETVVPAAPELQPSTSTDQPVTPEPTS	66	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5695	25.146	3	3003.4924	3003.4924	V	R	1261	1290
PSM	KTPETVVPTAPELQPSTSTDQPVTPEPTSQAT	67	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5693	25.135	3	3333.6464	3333.6464	V	R	1179	1211
PSM	MVFFTCNACGESVK	68	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5962	26.402	2	1648.7048	1648.7048	-	K	1	15
PSM	PPYTVVYFPVRG	69	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6325	28.138	2	1393.7394	1393.7394	M	R	2	14
PSM	PYLGSEDVVKEL	70	sp|Q9Y6B7-2|AP4B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6125	27.176	2	1347.6922	1347.6922	M	K	2	14
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	71	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6147	27.278	4	3845.8847	3845.8847	E	R	354	390
PSM	RMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQ	72	sp|P04637-5|P53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=6274	27.896	4	3486.7606	3486.7606	P	K	26	62
PSM	TSDQDAKVVAEPQTQ	73	sp|Q92615|LAR4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4234	18.879	2	1615.7689	1615.7689	M	R	2	17
PSM	AELNTHVNVKE	74	sp|Q9NUQ6-2|SPS2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=5060	22.538	2	1294.6517	1294.6517	M	K	2	13
PSM	ALHVPKAPGFAQML	75	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=6234	27.701	2	1536.8123	1536.8123	M	K	2	16
PSM	KTPEPVVPTAPELQPSTSTDQPVTSEPTSQVT	76	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5756	25.418	3	3347.662	3347.6620	V	R	892	924
PSM	KTPEPVVPTAPELQPSTSTDQPVTSEPTYQAT	77	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5820	25.721	3	3395.662	3395.6620	V	R	974	1006
PSM	MKSVIYHALSQ	78	sp|O95707|RPP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5626	24.837	2	1333.67	1333.6700	-	K	1	12
PSM	MPPYTVVYFPVRG	79	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=6342	28.208	2	1540.7748	1540.7748	-	R	1	14
PSM	PAIMTMLADHAA	80	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6381	28.393	2	1240.5944	1240.5944	M	R	2	14
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	81	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6934	30.785994733333332	3	3724.199819	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	82	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7021	31.081146776533334	3	3723.200094	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	83	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7234	31.839173147199997	3	3723.205400	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	84	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7098	31.35687833253333	3	3725.194512	3722.195067	V	K	157	189
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	85	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6597	29.447030749866666	3	3725.205646	3722.195067	V	K	157	189
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	86	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6207	27.575	3	2849.4244	2849.4244	P	R	634	661
PSM	VFFTCNACGESVK	87	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5428	23.993	2	1517.6643	1517.6643	M	K	2	15
PSM	KSYELPDGQVITIGNE	88	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6642	29.647937888266664	2	1762.867346	1761.878495	E	R	240	256
PSM	RPCAPEPAASPAGPEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEA	89	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	3-UNIMOD:4	ms_run[1]:scan=6238	27.718704874933334	4	5236.3785	5236.3686	S	R	58	113
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	90	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	24-UNIMOD:35	ms_run[2]:scan=6243	27.745	3	3534.5203	3534.5203	I	R	693	727
PSM	MQPQESHVHYS	91	sp|B2RUZ4|SMIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4244	18.926	2	1399.5827	1399.5827	-	R	1	12
PSM	PAIMTMLADHAA	92	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4972	22.155	2	1272.5842	1272.5842	M	R	2	14
PSM	PENVAPRSGATAGAAGG	93	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3921	17.353	2	1481.7223	1481.7223	M	R	2	19
PSM	PGVTVKDVNQQEFV	94	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5611	24.773	2	1558.7991	1558.7991	M	R	2	16
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	95	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=6189	27.483	3	3482.6884	3482.6884	N	R	309	345
PSM	SDTWSSIQAHK	96	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5359	23.705	2	1300.6048	1300.6048	M	K	2	13
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	97	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7325	32.18777484693333	3	3723.197765	3722.195067	V	K	157	189
PSM	AMTGSTPCSSMSNHTKE	98	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,2-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=3602	15.905554778133334	2	1898.7474	1898.7439	M	R	2	19
PSM	PAVSLPPKENALF	99	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=6127	27.18314597866667	2	1381.7623	1381.7600	M	K	2	15
PSM	GLLSQGSPLSWEETK	100	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6292	27.983	2	1630.8203	1630.8203	M	R	2	17
PSM	KMPDEPEEPVVAVSSPAVPPPT	101	sp|O60885-2|BRD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=5594	24.707	3	2288.1246	2288.1246	A	K	456	478
PSM	PYANQPTVRITELTDENV	102	sp|P19387|RPB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6070	26.913	3	2059.0222	2059.0222	M	K	2	20
PSM	PAEILNGKEISAQI	103	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5931	26.250318842666665	2	1481.8105	1481.8084	A	R	3	17
PSM	KSYELPDGQVITIGNE	104	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6530	29.138687015733336	2	1761.879369	1761.878495	E	R	240	256
PSM	KSYELPDGQVITIGNE	105	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6608	29.495936636266666	2	1761.879369	1761.878495	E	R	240	256
PSM	MKETPLSNCER	106	sp|Q06265|EXOS9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=4407	19.7281667016	2	1421.631036	1421.627901	-	R	1	12
PSM	AADTQVSETLK	107	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4501	20.154	2	1161.5877	1161.5877	M	R	2	13
PSM	APLDLDKYVEIA	108	sp|O00743-2|PPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6565	29.303	2	1345.7129	1345.7129	M	R	2	14
PSM	ATETVELHKL	109	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5566	24.591	2	1181.6292	1181.6292	M	K	2	12
PSM	MESYHKPDQQ	110	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3775	16.642	2	1319.5452	1319.5452	-	K	1	11
PSM	MESYHKPDQQ	111	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=4452	19.942	2	1303.5503	1303.5503	-	K	1	11
PSM	MHRDSCPLDC	112	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4338	19.386	2	1347.5006	1347.5006	-	K	1	11
PSM	PEPAKSAPAP	113	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3786	16.696	2	963.50255	963.5025	M	K	2	12
PSM	PEPTKSAPAP	114	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3832	16.921	2	993.51311	993.5131	M	K	2	12
PSM	PPYTVVYFPVRG	115	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6414	28.564	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	116	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6493	28.957	2	1393.7394	1393.7394	M	R	2	14
PSM	SEGDSVGESVHG	117	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4008	17.759	2	1158.4789	1158.4789	M	K	2	14
PSM	PDPAKSAPAP	118	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=3923	17.363624125866668	2	949.4866	949.4864	M	K	2	12
PSM	PAIMTMLADHAA	119	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	4-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=4986	22.224356260266667	2	1272.5861	1272.5837	M	R	2	14
PSM	PAVSLPPKENALF	120	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=6223	27.6512157112	2	1381.7623	1381.7600	M	K	2	15
PSM	PAVSLPPKENALF	121	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=6477	28.878201184799998	2	1381.7618	1381.7600	M	K	2	15
PSM	KDDGEDSEMQVEAPSDSSVIAQQ	122	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:35	ms_run[1]:scan=5029	22.407998786933334	3	2480.053314	2480.049673	L	K	654	677
PSM	TTDEGAKNNEESPTATVAEQGEDITS	123	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=5097	22.701638918933334	3	2695.2022	2693.1782	M	K	2	28
PSM	MKIEEVKSTT	124	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4424	19.8042995464	2	1222.612319	1222.611505	-	K	1	11
PSM	AAAEEEDGGPEGPNRE	125	sp|Q99942|RNF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3894	17.219	2	1626.6758	1626.6758	M	R	2	18
PSM	ADHMMAMNHG	126	sp|Q99967-2|CITE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,4-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=3392	14.952	2	1203.4107	1203.4107	M	R	2	12
PSM	AGAIIENMSTK	127	sp|Q5T9L3-3|WLS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=4138	18.376	2	1149.57	1149.5700	M	K	2	13
PSM	GHQQLYWSHP	128	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5603	24.738	2	1293.5891	1293.5891	M	R	2	12
PSM	KAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQP	129	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	39-UNIMOD:35	ms_run[2]:scan=6344	28.219	4	4519.2482	4519.2482	N	R	3	48
PSM	MESYHKPDQQ	130	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3870	17.092	2	1319.5452	1319.5452	-	K	1	11
PSM	MIGGLFIYNH	131	sp|Q96CW1-2|AP2M1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=6259	27.821	2	1179.5747	1179.5747	-	K	1	11
PSM	MNQPPQIAPK	132	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=4241	18.91	2	1138.5805	1138.5805	-	R	1	11
PSM	MPPYTVVYFPVRG	133	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6534	29.157	2	1524.7799	1524.7799	-	R	1	14
PSM	MQLTHQLDLFPEC	134	sp|Q9Y3C4-2|TPRKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6300	28.024	2	1646.7433	1646.7433	-	R	1	14
PSM	MSPTISHKDSS	135	sp|O00400|ACATN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3804	16.783	2	1246.55	1246.5500	-	R	1	12
PSM	PDPSKSAPAP	136	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3865	17.073	2	965.48181	965.4818	M	K	2	12
PSM	PYQYPALTPEQK	137	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5309	23.511	2	1433.7191	1433.7191	M	K	2	14
PSM	SGDHLHNDSQIEADF	138	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5720	25.254	2	1725.7231	1725.7231	M	R	2	17
PSM	TTEVGSVSEVK	139	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4364	19.517	2	1134.5768	1134.5768	M	K	2	13
PSM	PEEAGFPPAK	140	sp|Q9H6R0|DHX33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=4956	22.094242553066668	2	1041.5129	1041.5126	M	R	2	12
PSM	AAAGAAATHLEVA	141	sp|Q96S52|PIGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4917	21.93	2	1151.5935	1151.5935	M	R	2	15
PSM	AEKFDCHYC	142	sp|Q13642-3|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5032	22.424	2	1270.4747	1270.4747	M	R	2	11
PSM	ANDSGGPGGPSPSERD	143	sp|Q9GZT9-3|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3631	16.027	2	1498.6284	1498.6284	M	R	2	18
PSM	GQTVNEDSMDVK	144	sp|Q9UQR0|SCML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4459	19.972	2	1321.582	1321.5820	M	K	2	14
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	145	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7289	32.049	3	3722.1951	3722.1951	V	K	157	189
PSM	MLGTEGGEGFVVKV	146	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35	ms_run[2]:scan=6007	26.616	2	1437.7174	1437.7174	M	R	2	16
PSM	PYQYPALTPEQK	147	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7012	31.056	2	1433.7191	1433.7191	M	K	2	14
PSM	KLGLGIDEDD	148	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=5412	23.930992766133333	2	1073.5239	1073.5235	I	P	693	703
PSM	AGAIIENMSTK	149	sp|Q5T9L3|WLS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=4983	22.208212642933333	2	1133.5753	1133.5745	M	K	2	13
PSM	PAVSLPPKENALF	150	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=6395	28.470635236533333	2	1381.7618	1381.7600	M	K	2	15
PSM	PAVSLPPKENALF	151	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=6307	28.052944434933334	2	1381.7623	1381.7600	M	K	2	15
PSM	VFFTCNACGESVK	152	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=5538	24.4705704144	2	1518.6532	1517.6642	M	K	2	15
PSM	AEAVFHAPK	153	sp|Q8NCE0-5|SEN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5424	23.977	2	1010.5185	1010.5185	M	R	2	11
PSM	AELEHLGGK	154	sp|O60237-2|MYPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5401	23.887	2	994.50836	994.5084	M	R	2	11
PSM	GQTVNEDSMDVK	155	sp|Q9UQR0|SCML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=3756	16.55	2	1337.5769	1337.5769	M	K	2	14
PSM	KSYELPDGQVITIGNE	156	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6766	30.189	2	1761.8785	1761.8785	E	R	196	212
PSM	MAPEVLPKP	157	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=4959	22.109	2	996.5314	996.5314	-	R	1	10
PSM	MAPEVLPKP	158	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=5051	22.504	2	996.5314	996.5314	-	R	1	10
PSM	MIHGFQSSH	159	sp|O75663-2|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4895	21.831	2	1100.4709	1100.4709	M	R	2	11
PSM	MVDMMDLPRS	160	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4446	19.909	2	1241.509	1241.5090	-	R	1	11
PSM	MVDMMDLPRS	161	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4760	21.214	2	1225.5141	1225.5141	-	R	1	11
PSM	MVDMMDLPRS	162	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=5184	23.052	2	1225.5141	1225.5141	-	R	1	11
PSM	PDPAKSAPAP	163	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=4173	18.559	2	991.49746	991.4975	M	K	2	12
PSM	PPYTVVYFPVRG	164	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6883	30.598	2	1393.7394	1393.7394	M	R	2	14
PSM	PQNEYIELH	165	sp|O95478|NSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5258	23.332	2	1141.5404	1141.5404	M	R	2	11
PSM	PYQYPALTPEQK	166	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7369	32.349	2	1433.7191	1433.7191	M	K	2	14
PSM	PPYTVVYFPVRG	167	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=6739	30.07142454	2	1393.7412	1393.7389	M	R	2	14
PSM	PDPAKSAPAP	168	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=3906	17.279587262666666	2	949.4866	949.4864	M	K	2	12
PSM	KTEFTQGMILPTMNGESVDPVGQPAL	169	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=6277	27.912497273333333	3	2792.332292	2791.340833	L	K	156	182
PSM	KTPSTMENDSSNLDPSQAPSLAQPLVFSNS	170	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:35	ms_run[1]:scan=6290	27.97667822773333	3	3178.474366	3177.477203	G	K	290	320
PSM	KEEEGLANGSAAEPAMPNTYGVEPLPQEVL	171	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	16-UNIMOD:35	ms_run[1]:scan=6416	28.574942795466665	3	3156.4872	3155.4962	N	K	691	721
PSM	ALYELFSHPVE	172	sp|Q9H6L2|TM231_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6490	28.944	2	1303.6449	1303.6449	M	R	2	13
PSM	MIGGLFIYNH	173	sp|Q96CW1-2|AP2M1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6524	29.107	2	1163.5798	1163.5798	-	K	1	11
PSM	MIHGFQSSH	174	sp|O75663-2|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5517	24.374	2	1084.476	1084.4760	M	R	2	11
PSM	MPPYTVVYFPVRG	175	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6615	29.527	2	1524.7799	1524.7799	-	R	1	14
PSM	PEEAGFPPAK	176	sp|Q9H6R0|DHX33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4482	20.069	2	1041.5131	1041.5131	M	R	2	12
PSM	PPYTVVYFPVRG	177	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6568	29.315	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	178	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7166	31.612	2	1393.7394	1393.7394	M	R	2	14
PSM	PYQYPALTPEQK	179	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7200	31.727	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	180	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6717	29.973	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	181	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7108	31.392	2	1433.7191	1433.7191	M	K	2	14
PSM	APIKVGDAIPAVEVFEGEPGN	182	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=6611	29.509149088	3	2108.0814	2108.0785	M	K	2	23
PSM	YQYPALTPEQK	183	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=5243	23.272986771466666	2	1336.6671	1336.6658	P	K	3	14
PSM	MNNHVSSKPSTM	184	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=3498	15.454024359733333	2	1406.582600	1405.596600	-	K	1	13
PSM	KAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQP	185	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	39-UNIMOD:35	ms_run[1]:scan=6491	28.9498424408	4	4519.256563	4519.248201	N	R	3	48
PSM	MRDSAEGPKEDEE	186	sp|Q13029-3|PRDM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=3747	16.509484078933333	2	1549.622200	1549.620232	-	K	1	14
PSM	ALHVPKAPGFAQML	187	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6721	29.991	2	1520.8174	1520.8174	M	K	2	16
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	188	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5366	23.737	4	2773.4246	2773.4246	G	K	61	94
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAENV	189	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6380	28.391	3	2891.4917	2891.4917	A	K	489	519
PSM	MAPEVLPKP	190	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5215	23.176	2	980.53649	980.5365	-	R	1	10
PSM	MDVHDLFR	191	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5887	26.035	2	1089.4913	1089.4913	-	R	1	9
PSM	MVDMMDLPRS	192	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=5669	25.028	2	1209.5192	1209.5192	-	R	1	11
PSM	PEPTKSAPAP	193	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3925	17.374	2	993.51311	993.5131	M	K	2	12
PSM	PPYTVVYFPVRG	194	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6646	29.664	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	195	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6867	30.553	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	196	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6979	30.936	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	197	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7074	31.275	2	1393.7394	1393.7394	M	R	2	14
PSM	PYQYPALTPEQK	198	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6916	30.718	2	1433.7191	1433.7191	M	K	2	14
PSM	SHLPMKLL	199	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5687	25.109	2	995.54739	995.5474	M	R	2	10
PSM	PYQYPALTPEQK	200	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6808	30.371561987733333	2	1434.7252	1433.7182	M	K	2	14
PSM	DPSKSAPAP	201	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=3654	16.120780336266666	2	868.4287	868.4285	P	K	3	12
PSM	MESYHKPDQQ	202	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=3914	17.318678664533333	2	1320.531707	1319.545216	-	K	1	11
PSM	AEKFDCHYC	203	sp|Q13642|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5198	23.1029296016	2	1271.4602	1270.4742	M	R	2	11
PSM	GQTVNEDSMDVK	204	sp|Q9UQR0|SCML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	9-UNIMOD:35	ms_run[1]:scan=3576	15.801345012266667	2	1337.5799	1337.5764	M	K	2	14
PSM	KEVLDLCSEHLVL	205	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=6092	27.013282503733333	2	1553.807123	1553.812330	E	R	27	40
PSM	AEAELHKE	206	sp|Q8IXS6-2|PALM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4370	19.543	2	967.46108	967.4611	M	R	2	10
PSM	GQTVNEDSMDVK	207	sp|Q9UQR0|SCML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:35	ms_run[2]:scan=3741	16.48	2	1337.5769	1337.5769	M	K	2	14
PSM	KTPEPVVPTAPELQPSTSTDQPVTSEPTYQAT	208	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5828	25.764	4	3395.662	3395.6620	V	R	974	1006
PSM	MAPEVLPKP	209	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=4934	22.002	2	996.5314	996.5314	-	R	1	10
PSM	MAPEVLPKP	210	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=5150	22.923	2	996.5314	996.5314	-	R	1	10
PSM	MAPEVLPKP	211	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5239	23.258	2	980.53649	980.5365	-	R	1	10
PSM	MELGPEPPHR	212	sp|P30304-2|MPIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4774	21.278	2	1219.5656	1219.5656	-	R	1	11
PSM	MIEVVCNDRLG	213	sp|Q9BZL1|UBL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=5204	23.127	2	1320.6166	1320.6166	-	K	1	12
PSM	PNVLLPPKESNLF	214	sp|Q6N069-5|NAA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6363	28.307	2	1466.8133	1466.8133	M	K	2	15
PSM	TENSTSAPAAKP	215	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3523	15.575	2	1172.5673	1172.5673	M	K	2	14
PSM	PYTVVYFPVRG	216	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=6248	27.768533785600003	2	1296.6880	1296.6861	P	R	3	14
PSM	APEVLPKP	217	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=4995	22.260960576533332	2	849.4958	849.4955	M	R	2	10
PSM	MVDMMDLPRS	218	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=5300	23.477627045866665	2	1209.518991	1209.519201	-	R	1	11
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	219	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6595	29.436	3	3503.6315	3503.6315	I	R	685	719
PSM	MVDMMDLPRS	220	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:35	ms_run[2]:scan=5317	23.545	2	1209.5192	1209.5192	-	R	1	11
PSM	PVSTSLHQDGSQE	221	sp|A1L390-3|PKHG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4141	18.393	2	1383.6266	1383.6266	M	R	2	15
PSM	SGDHLHNDSQIEADF	222	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5812	25.681	2	1725.7231	1725.7231	M	R	2	17
PSM	DPAKSAPAP	223	sp|Q93079|H2B1H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=3716	16.375653986666666	2	852.4339	852.4336	P	K	3	12
PSM	APEVLPKP	224	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=4901	21.857977650933332	2	849.4958	849.4955	M	R	2	10
PSM	KAVTPPMPLLTPATPGGLPPAAAVAAAAATA	225	sp|Q9UHX1|PUF60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:35	ms_run[1]:scan=6801	30.335641374399998	3	2809.546493	2809.541188	G	K	301	332
PSM	KVPPPPETPMPPPLPPTPDQVIV	226	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6450	28.744	3	2442.3233	2442.3233	Q	R	302	325
PSM	MAPEVLPKP	227	sp|P09669|COX6C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5348	23.669	2	980.53649	980.5365	-	R	1	10
PSM	MLLNGDCPESLK	228	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=5232	23.24	2	1391.6425	1391.6425	-	K	1	13
PSM	PAVASVPKELYLSSSL	229	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6402	28.504	2	1659.9083	1659.9083	M	K	2	18
PSM	PPYTVVYFPVRG	230	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=7375	32.37169461573333	2	1394.7442	1393.7392	M	R	2	14
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	231	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:35,27-UNIMOD:35	ms_run[1]:scan=5781	25.54109874	3	3582.449529	3582.444385	D	K	85	117
PSM	KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	232	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5200	23.111987826133333	3	3177.429884	3176.438175	P	K	43	77
PSM	MPEPAKSAPAP	233	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4000	17.726626145333334	2	1095.545157	1094.543031	-	K	1	12