MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F17.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F17.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56.0	null		0.18	56.0	2	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	61-UNIMOD:4	0.39	51.0	1	1	1
PRT	sp|Q8N5L8|RP25L_HUMAN	Ribonuclease P protein subunit p25-like protein OS=Homo sapiens OX=9606 GN=RPP25L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	131-UNIMOD:4,145-UNIMOD:35,150-UNIMOD:4	0.19	51.0	1	1	1
PRT	sp|Q96K37|S35E1_HUMAN	Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.06	50.0	1	1	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.03	49.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.30	48.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	716-UNIMOD:35	0.05	47.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	99-UNIMOD:35,110-UNIMOD:35,111-UNIMOD:35	0.09	46.0	2	1	0
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.07	46.0	2	1	0
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.11	44.0	4	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|O43149-2|ZZEF1_HUMAN	Isoform 2 of Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	424-UNIMOD:4	0.04	43.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	653-UNIMOD:35,657-UNIMOD:35,658-UNIMOD:35,662-UNIMOD:35	0.05	43.0	3	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	239-UNIMOD:35,254-UNIMOD:4	0.06	42.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null	617-UNIMOD:35,621-UNIMOD:35	0.09	42.0	2	2	2
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	2	2
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	311-UNIMOD:35	0.03	39.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9H147|TDIF1_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	457-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P63267-2|ACTH_HUMAN	Isoform 2 of Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	7	1	0
PRT	sp|Q9UKY7-3|CDV3_HUMAN	Isoform 3 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	62-UNIMOD:35	0.25	38.0	1	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.08	38.0	1	1	1
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	144-UNIMOD:35,147-UNIMOD:35	0.11	37.0	2	1	0
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.02	37.0	1	1	1
PRT	sp|Q96IK1|BOD1_HUMAN	Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.14	36.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9UHD8-3|SEPT9_HUMAN	Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|A1L390-3|PKHG3_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	415-UNIMOD:35,432-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	3	1	0
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	662-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	188-UNIMOD:35	0.08	34.0	1	1	1
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9Y5N5-2|N6MT1_HUMAN	Isoform 2 of Methyltransferase N6AMT1 OS=Homo sapiens OX=9606 GN=N6AMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.08	33.0	2	1	0
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	110-UNIMOD:35,125-UNIMOD:35,144-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	1-UNIMOD:35	0.11	33.0	7	2	1
PRT	sp|Q9GZT9|EGLN1_HUMAN	Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	364-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	1	1	1
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	2	2	2
PRT	sp|Q68DK2|ZFY26_HUMAN	Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|P43307|SSRA_HUMAN	Translocon-associated protein subunit alpha OS=Homo sapiens OX=9606 GN=SSR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	4	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	6-UNIMOD:4,9-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|O00743-2|PPP6_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O95707|RPP29_HUMAN	Ribonuclease P protein subunit p29 OS=Homo sapiens OX=9606 GN=POP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1	0.05	30.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	312-UNIMOD:35,330-UNIMOD:35,331-UNIMOD:35	0.10	30.0	1	1	1
PRT	sp|P36957-2|ODO2_HUMAN	Isoform 2 of Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	98-UNIMOD:35	0.09	29.0	1	1	1
PRT	sp|O43776|SYNC_HUMAN	Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	2	1	0
PRT	sp|Q9P0W2-3|HM20B_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.06	29.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q96CJ1|EAF2_HUMAN	ELL-associated factor 2 OS=Homo sapiens OX=9606 GN=EAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|Q7Z7A3|CTU1_HUMAN	Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens OX=9606 GN=CTU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	6-UNIMOD:4,9-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O14569|C56D2_HUMAN	Cytochrome b561 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CYB561D2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	3206-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	3	1	0
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	0.09	27.0	1	1	1
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:35	0.10	27.0	3	2	1
PRT	sp|P58876|H2B1D_HUMAN	Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	4	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null		0.06	27.0	2	2	2
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null		0.07	27.0	3	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	288-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.09	26.0	5	1	0
PRT	sp|Q13283-2|G3BP1_HUMAN	Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	3-UNIMOD:35	0.10	26.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	2	1	0
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.09	26.0	8	1	0
PRT	sp|P50443|S26A2_HUMAN	Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC26A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	2	1	0
PRT	sp|Q8NCE0-5|SEN2_HUMAN	Isoform 5 of tRNA-splicing endonuclease subunit Sen2 OS=Homo sapiens OX=9606 GN=TSEN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4	0.05	25.0	2	1	0
PRT	sp|Q9NX05-2|F120C_HUMAN	Isoform 2 of Constitutive coactivator of PPAR-gamma-like protein 2 OS=Homo sapiens OX=9606 GN=FAM120C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9Y3C4-2|TPRKB_HUMAN	Isoform 2 of EKC/KEOPS complex subunit TPRKB OS=Homo sapiens OX=9606 GN=TPRKB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:35,13-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|B2RUZ4|SMIM1_HUMAN	Small integral membrane protein 1 OS=Homo sapiens OX=9606 GN=SMIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	25.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null		0.09	25.0	2	2	2
PRT	sp|Q99879|H2B1M_HUMAN	Histone H2B type 1-M OS=Homo sapiens OX=9606 GN=H2BC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q9Y3A3-3|PHOCN_HUMAN	Isoform 3 of MOB-like protein phocein OS=Homo sapiens OX=9606 GN=MOB4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	3-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q9UKY7|CDV3_HUMAN	Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	164-UNIMOD:35	0.11	25.0	1	1	0
PRT	sp|Q8IYS1|P20D2_HUMAN	Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q9UQR0|SCML2_HUMAN	Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	10-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q13907|IDI1_HUMAN	Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	305-UNIMOD:35	0.06	24.0	1	1	1
PRT	sp|Q9HC77|CENPJ_HUMAN	Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|Q14596-2|NBR1_HUMAN	Isoform 2 of Next to BRCA1 gene 1 protein OS=Homo sapiens OX=9606 GN=NBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	141-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|O95139-2|NDUB6_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q13642|FHL1_HUMAN	Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|Q9Y2F5|ICE1_HUMAN	Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q8IXS6-2|PALM2_HUMAN	Isoform 2 of Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	247-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:35	0.09	22.0	1	1	1
PRT	sp|P11441|UBL4A_HUMAN	Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,6-UNIMOD:35	0.01	22.0	2	1	0
PRT	sp|P62308|RUXG_HUMAN	Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.12	22.0	1	1	1
PRT	sp|O95782|AP2A1_HUMAN	AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	10-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O75970-5|MPDZ_HUMAN	Isoform 4 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:35	0.00	21.0	1	1	1
PRT	sp|Q04637-5|IF4G1_HUMAN	Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.13	21.0	1	1	1
PRT	sp|O75165|DJC13_HUMAN	DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	1	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56		ms_run[1]:scan=5193	22.9621128424	3	3177.426242	3176.438175	P	K	43	77
PSM	KALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEE	2	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	13-UNIMOD:4	ms_run[2]:scan=6620	29.214	4	3807.9214	3807.9214	A	K	49	92
PSM	RDPLDPNECGYQPPGAPPGLGSMPSSSCGP	3	sp|Q8N5L8|RP25L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	9-UNIMOD:4,23-UNIMOD:35,28-UNIMOD:4	ms_run[2]:scan=5945	26.005	3	3112.3325	3112.3325	S	R	123	153
PSM	AAAAVGAGHGAGGPGAASSSGGA	4	sp|Q96K37|S35E1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=3909	17.236	2	1707.7925	1707.7925	M	R	2	25
PSM	RSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPAT	5	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5369	23.592	3	4169.8785	4169.8785	Q	K	10	54
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	6	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5390	23.668	3	2773.4246	2773.4246	G	K	61	94
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	7	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	24-UNIMOD:35	ms_run[2]:scan=6133	26.884	3	3534.5203	3534.5203	I	R	693	727
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	8	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	15-UNIMOD:35,26-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=5262	23.199	3	3598.4393	3598.4393	D	K	85	117
PSM	KGEADDEDDDEDGQDNQGTVTEGSSPAYL	9	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5484	24.037	3	3056.2127	3056.2127	Q	K	154	183
PSM	KGVVPLAGTDGETTTQGLDGLSE	10	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5878	25.696	3	2244.1121	2244.1121	D	R	111	134
PSM	KGVVPLAGTDGETTTQGLDGLSE	11	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6029	26.392	3	2244.1121	2244.1121	D	R	111	134
PSM	KAAEAAPPTQEAQGETEPTEQAPDALEQAADTS	12	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5476	24.001	3	3351.5226	3351.5226	Q	R	446	479
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5246	23.148930516266667	3	3723.201041	3722.195067	V	K	157	189
PSM	KDATNVGDEGGFAPNILEN	14	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6187	27.153	2	1959.9174	1959.9174	G	K	202	221
PSM	KDPSCQTQISDSPADASPPTGLPDAEDSEVSSQ	15	sp|O43149-2|ZZEF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:4	ms_run[2]:scan=5567	24.37	3	3415.4845	3415.4845	S	K	420	453
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	16	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=5929	25.93	3	3230.4029	3230.4029	Q	R	630	663
PSM	PENVAPRSGATAGAAGG	17	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=3915	17.262	2	1481.7223	1481.7223	M	R	2	19
PSM	KEMFPYEASTPTGISASC	18	sp|P42167-2|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=5682	24.835	2	1990.8652	1990.8652	L	R	237	255
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	19	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=5788	25.2785223048	3	3505.584058	3505.576600	T	-	609	647
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	20	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=6126	26.85	3	3230.4029	3230.4029	Q	R	630	663
PSM	KNPESTVPIAPELPPSTSTEQPVTPEPTS	21	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5848	25.557	3	3029.5081	3029.5081	V	R	1097	1126
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	22	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=5557	24.325	3	3582.4444	3582.4444	D	K	85	117
PSM	KTPETVVPTAPELQASASTDQPVTSEPTS	23	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5727	25.034	3	2967.4561	2967.4561	V	R	1220	1249
PSM	KVPPPPETPMPPPLPPTPDQVIV	24	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	10-UNIMOD:35	ms_run[2]:scan=6328	27.846	3	2458.3182	2458.3182	Q	R	302	325
PSM	PGIDKLPIEETLEDSPQT	25	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6357	27.991	2	1980.9892	1980.9892	M	R	2	20
PSM	GATGDAEQPRGPSGAE	26	sp|Q9H147|TDIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3878	17.096	2	1498.6648	1498.6648	M	R	2	18
PSM	KIGNPVPYNEGLGQPQVAPPAPAASPAASS	27	sp|P27694|RFA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5741	25.086	3	2884.4719	2884.4719	V	R	111	141
PSM	KMPDEPEEPVVAVSSPAVPPPT	28	sp|O60885-2|BRD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:35	ms_run[2]:scan=5611	24.554	3	2288.1246	2288.1246	A	K	456	478
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAENV	29	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6416	28.279	3	2891.4917	2891.4917	A	K	489	519
PSM	KSYELPDGQVITIGNE	30	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6606	29.144	2	1761.8785	1761.8785	E	R	196	212
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	31	sp|Q9UKY7-3|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	22-UNIMOD:35	ms_run[2]:scan=6016	26.328	3	2766.415	2766.4150	N	R	41	68
PSM	SSGNAKIGHPAPNF	32	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=5170	22.864	2	1437.7001	1437.7001	M	K	2	16
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	33	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=5539	24.248	3	2730.3833	2730.3833	K	R	123	152
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	34	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7194	31.457349526399998	3	3724.205386	3722.195067	V	K	157	189
PSM	ASGEHSPGSGAAR	35	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=3476	15.342703535733333	2	1224.5483	1224.5478	M	R	2	15
PSM	KAAVPAPPPEPEGQDPPAPSQDTS	36	sp|Q96IK1|BOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4835	21.476	3	2382.1339	2382.1339	K	-	162	186
PSM	KIEEPPIPPLEQPVAPED	37	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6130	26.868	2	1997.0357	1997.0357	P	K	754	772
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	38	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6625	29.237	3	3503.6315	3503.6315	I	R	685	719
PSM	KPAEAPTAPSPAQTLENSEPAPVSQLQS	39	sp|Q9UHD8-3|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5913	25.857	3	2844.4141	2844.4141	P	R	30	58
PSM	PVSTSLHQDGSQE	40	sp|A1L390-3|PKHG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4156	18.29	2	1383.6266	1383.6266	M	R	2	15
PSM	KEGTLTQVPLAPPPPGAPPSPAPA	41	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5920	25.89	3	2289.2369	2289.2369	P	R	1128	1152
PSM	KMPDEPVEAPALPAPAAPMVS	42	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5755	25.137	3	2149.0435	2149.0435	A	K	414	435
PSM	KSYELPDGQVITIGNE	43	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6715	29.627680650133335	2	1762.878509	1761.878495	E	R	240	256
PSM	KDDGEDSEMQVEAPSDSSVIAQQ	44	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=5050	22.36	3	2480.0497	2480.0497	L	K	654	677
PSM	KDGDSVMVLPTIPEEEA	45	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35	ms_run[2]:scan=6073	26.601	2	1844.8714	1844.8714	W	K	182	199
PSM	KSYELPDGQVITIGNE	46	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6684	29.497	2	1761.8785	1761.8785	E	R	196	212
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	47	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	22-UNIMOD:35,25-UNIMOD:35	ms_run[1]:scan=5514	24.163111023733332	3	2730.388068	2730.383307	K	R	123	152
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	48	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=6034	26.41853339813333	3	3230.407094	3230.402859	Q	R	630	663
PSM	AAAGAAATHLEVA	49	sp|Q96S52|PIGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4937	21.906	2	1151.5935	1151.5935	M	R	2	15
PSM	AGENFATPFHGHVG	50	sp|Q9Y5N5-2|N6MT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5868	25.654	2	1481.6688	1481.6688	M	R	2	16
PSM	KAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMT	51	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35,18-UNIMOD:35,37-UNIMOD:35	ms_run[2]:scan=6698	29.562	4	3807.9461	3807.9461	Y	R	108	146
PSM	MPGVTVKDVNQQEFV	52	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:35	ms_run[2]:scan=5622	24.593	2	1705.8345	1705.8345	-	R	1	16
PSM	ANDSGGPGGPSPSERD	53	sp|Q9GZT9|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=3624	16.03640942346667	2	1498.6301	1498.6279	M	R	2	18
PSM	KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	54	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5223	23.07438927253333	3	3177.426242	3176.438175	P	K	43	77
PSM	KPLESPGGTMAPQQPEGAKPQAQAALAAP	55	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:35	ms_run[1]:scan=5438	23.843425675466666	3	2857.395743	2856.443993	M	K	355	384
PSM	AGENFATPFHGHVG	56	sp|Q9Y5N5-2|N6MT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=5873	25.673	2	1481.6688	1481.6688	M	R	2	16
PSM	AHQTGIHATEEL	57	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=5136	22.721	2	1347.6419	1347.6419	M	K	2	14
PSM	KDPAEPETVPDGETPEDENPTEEGADNSSA	58	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4984	22.089	3	3126.2909	3126.2909	E	K	682	712
PSM	KEEDGSLSLDGADSTGVVA	59	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5524	24.198	2	1848.8589	1848.8589	L	K	594	613
PSM	KTDLNPDNLQGGDDLDPNYVLSS	60	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6180	27.115	3	2489.1558	2489.1558	H	R	107	130
PSM	MNHPFGKEEAASQ	61	sp|Q68DK2|ZFY26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4498	19.9945890568	2	1502.648596	1502.645993	-	K	1	14
PSM	KEEEDVSGEPEASPSADTTILFV	62	sp|P43307|SSRA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6596	29.097	3	2449.1384	2449.1384	D	K	68	91
PSM	KSYELPDGQVITIGNE	63	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6846	30.183	2	1761.8785	1761.8785	E	R	196	212
PSM	PYQYPALTPEQK	64	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5403	23.708	2	1433.7191	1433.7191	M	K	2	14
PSM	VFFTCNACGESVK	65	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5469	23.969	2	1517.6643	1517.6643	M	K	2	15
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	66	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7202	31.484470252266664	3	3723.202575	3722.195067	V	K	157	189
PSM	APLDLDKYVEIA	67	sp|O00743-2|PPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6621	29.219	2	1345.7129	1345.7129	M	R	2	14
PSM	KEAPAGPLEEDDLEPLTLAPAPAP	68	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6636	29.283	3	2440.2373	2440.2373	A	R	1109	1133
PSM	MKSVIYHALSQ	69	sp|O95707|RPP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6512	28.724	2	1317.6751	1317.6751	-	K	1	12
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	70	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6195	27.192	4	3845.8847	3845.8847	E	R	354	390
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	71	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,22-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=5968	26.109	4	3498.6833	3498.6833	N	R	309	345
PSM	KSYELPDGQVITIGNE	72	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6766	29.841937655466666	2	1762.878509	1761.878495	E	R	240	256
PSM	KAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSG	73	sp|P36957-2|ODO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	20-UNIMOD:35	ms_run[2]:scan=5683	24.84	3	3100.5903	3100.5903	P	K	79	111
PSM	KEDGTFYEFGEDIPEAPE	74	sp|O43776|SYNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6489	28.619	2	2071.8898	2071.8898	K	R	407	425
PSM	PGVTVKDVNQQEFV	75	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5617	24.577	2	1558.7991	1558.7991	M	R	2	16
PSM	SGDHLHNDSQIEADF	76	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5855	25.59	2	1725.7231	1725.7231	M	R	2	17
PSM	SHGPKQPGAAAAPAGG	77	sp|Q9P0W2-3|HM20B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=3875	17.084	2	1414.6953	1414.6953	M	K	2	18
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	78	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6979	30.707550445600003	3	3724.203361	3722.195067	V	K	157	189
PSM	KGIPLATGDTSPEPELLPGAPLPPP	79	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6616	29.199	3	2463.3261	2463.3261	L	K	32	57
PSM	MNSAAGFSHLDR	80	sp|Q96CJ1|EAF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5191	22.954	2	1362.5986	1362.5986	-	R	1	13
PSM	PAPPCASCHAA	81	sp|Q7Z7A3|CTU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=3873	17.074	2	1137.4695	1137.4695	M	R	2	13
PSM	PGVTVKDVNQQEFV	82	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5726	25.029059367733332	2	1559.7832	1558.7982	M	R	2	16
PSM	AGGEDRGDGEPVSVVTV	83	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5461	23.941	2	1642.7798	1642.7798	M	R	2	19
PSM	ALSAETESHIY	84	sp|O14569|C56D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5179	22.906	2	1219.5721	1219.5721	M	R	2	13
PSM	ATETVELHKL	85	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=5620	24.586	2	1181.6292	1181.6292	M	K	2	12
PSM	KLTPLPEDNSMNVDQDGDPSD	86	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=5143	22.749	3	2301.9907	2301.9907	E	R	3196	3217
PSM	KSYELPDGQVITIGNE	87	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7035	30.896	2	1761.8785	1761.8785	E	R	196	212
PSM	MESYHKPDQQ	88	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3812	16.839	2	1319.5452	1319.5452	-	K	1	11
PSM	MHRDSCPLDC	89	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4411	19.565	2	1347.5006	1347.5006	-	K	1	11
PSM	PEPAKSAPAP	90	sp|Q16778|H2B2E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3767	16.706	2	963.50255	963.5025	M	K	2	12
PSM	PEPTKSAPAP	91	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3806	16.827	2	993.51311	993.5131	M	K	2	12
PSM	PPYTVVYFPVRG	92	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6391	28.159	2	1393.7394	1393.7394	M	R	2	14
PSM	SEGDSVGESVHG	93	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4013	17.676	2	1158.4789	1158.4789	M	K	2	14
PSM	SEGDSVGESVHG	94	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=4011	17.67013182133333	2	1158.4785	1158.4784	M	K	2	14
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSD	95	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4875	21.642961357599997	3	3366.446336	3365.451593	Q	K	798	832
PSM	KTPSTMENDSSNLDPSQAPSLAQPLVFSNS	96	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=6303	27.72	3	3177.4772	3177.4772	G	K	283	313
PSM	MESYHKPDQQ	97	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3721	16.485	2	1319.5452	1319.5452	-	K	1	11
PSM	MESYHKPDQQ	98	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=4491	19.961	2	1303.5503	1303.5503	-	K	1	11
PSM	PDPAKSAPAP	99	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3905	17.216	2	949.4869	949.4869	M	K	2	12
PSM	PDPAKSAPAP	100	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3991	17.596	2	949.4869	949.4869	M	K	2	12
PSM	PGVTVKDVNQQEFV	101	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6732	29.701	2	1558.7991	1558.7991	M	R	2	16
PSM	VMEKPSPLLVG	102	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=5424	23.799	2	1184.6475	1184.6475	M	R	2	13
PSM	AADTQVSETLK	103	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=4534	20.171615050133333	2	1162.5882	1161.5872	M	R	2	13
PSM	PEPAKSAPAP	104	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=4478	19.89519174986667	2	963.4966	963.5020	M	K	2	12
PSM	PEPAKSAPAP	105	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=4224	18.645062780266667	2	963.4966	963.5020	M	K	2	12
PSM	SSESKEQHNVSP	106	sp|P50443|S26A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=3817	16.862670493866666	2	1369.6102	1369.6105	M	R	2	14
PSM	KTVTNAVVTVPAYFNDSQ	107	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6143	26.934480085066664	2	1953.970243	1952.984357	G	R	137	155
PSM	AEAVFHAPK	108	sp|Q8NCE0-5|SEN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=5454	23.914	2	1010.5185	1010.5185	M	R	2	11
PSM	AEKFDCHYC	109	sp|Q13642-3|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5069	22.441	2	1270.4747	1270.4747	M	R	2	11
PSM	GVQGFQEFLEK	110	sp|Q9NX05-2|F120C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6326	27.835	2	1280.6401	1280.6401	M	R	2	13
PSM	KDLFDPIIED	111	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6563	28.939	2	1203.6023	1203.6023	F	R	86	96
PSM	KSYELPDGQVITIGNE	112	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7146	31.283	2	1761.8785	1761.8785	E	R	196	212
PSM	MQLTHQLDLFPEC	113	sp|Q9Y3C4-2|TPRKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6336	27.885	2	1646.7433	1646.7433	-	R	1	14
PSM	MQPQESHVHYS	114	sp|B2RUZ4|SMIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4270	18.871	2	1399.5827	1399.5827	-	R	1	12
PSM	PDPAKSAPAP	115	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4172	18.371	2	949.4869	949.4869	M	K	2	12
PSM	PDPSKSAPAP	116	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3859	17.024	2	965.48181	965.4818	M	K	2	12
PSM	PEPVKSAPVP	117	sp|Q99879|H2B1M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4655	20.706	2	1019.5651	1019.5651	M	K	2	12
PSM	VMAEGTAVLR	118	sp|Q9Y3A3-3|PHOCN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=4654	20.702	2	1061.5539	1061.5539	M	R	2	12
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	119	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	22-UNIMOD:35	ms_run[1]:scan=5991	26.217420286133333	3	2766.4208	2766.4145	N	R	143	170
PSM	PEPAKSAPAP	120	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=4291	18.9715231048	2	963.4966	963.5020	M	K	2	12
PSM	PEPAKSAPAP	121	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=4581	20.376488524266666	2	963.4966	963.5020	M	K	2	12
PSM	MRPGGERPVEGGACNG	122	sp|Q8IYS1|P20D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=4073	17.93233409546667	2	1700.738221	1700.735888	-	R	1	17
PSM	AEKFDCHYC	123	sp|Q13642-3|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5210	23.031	2	1270.4747	1270.4747	M	R	2	11
PSM	GQTVNEDSMDVK	124	sp|Q9UQR0|SCML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=3718	16.468	2	1337.5769	1337.5769	M	K	2	14
PSM	KSYELPDGQVITIGNE	125	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6522	28.768	2	1761.8785	1761.8785	E	R	196	212
PSM	MPEPAKSAPAP	126	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=3961	17.469	2	1110.5379	1110.5379	-	K	1	12
PSM	PDPAKSAPAP	127	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4297	19.004	2	949.4869	949.4869	M	K	2	12
PSM	PEINTNHLD	128	sp|Q13907|IDI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4706	20.913	2	1051.4934	1051.4934	M	K	2	11
PSM	PELAKSAPAP	129	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4480	19.906	2	979.53385	979.5338	M	K	2	12
PSM	PEPTKSAPAP	130	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3903	17.212	2	993.51311	993.5131	M	K	2	12
PSM	PQNEYIELH	131	sp|O95478|NSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5300	23.348	2	1141.5404	1141.5404	M	R	2	11
PSM	PYQYPALTPEQK	132	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7027	30.869	2	1433.7191	1433.7191	M	K	2	14
PSM	SGDHLHNDSQIEADF	133	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5752	25.128	2	1725.7231	1725.7231	M	R	2	17
PSM	SSESKEQHNVSP	134	sp|P50443|S26A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=3828	16.91	2	1369.611	1369.6110	M	R	2	14
PSM	KSYELPDGQVITIGNE	135	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7080	31.050710629866668	2	1762.878857	1761.878495	E	R	240	256
PSM	KDLYANTVLSGGTTMYPGIAD	136	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:35	ms_run[1]:scan=6127	26.854884550666668	3	2203.038417	2202.051451	R	R	291	312
PSM	PEPAKSAPAP	137	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=4211	18.567750982666666	2	963.4966	963.5020	M	K	2	12
PSM	PEPAKSAPAP	138	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=4378	19.40828263386667	2	963.4966	963.5020	M	K	2	12
PSM	KQQIADLREDL	139	sp|Q9HC77|CENPJ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6171	27.070939378666665	2	1327.725868	1327.709579	L	K	1000	1011
PSM	AADTQVSETLK	140	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4545	20.22	2	1161.5877	1161.5877	M	R	2	13
PSM	KAFLADPSAFVAAAPVAAATTAAPAAAAAPA	141	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6750	29.774	3	2751.4596	2751.4596	V	K	204	235
PSM	KSYELPDGQVITIGNE	142	sp|P63267-2|ACTH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6939	30.556	2	1761.8785	1761.8785	E	R	196	212
PSM	KTPEDPAVQSFPLVPCDTDQPQD	143	sp|Q14596-2|NBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:4	ms_run[2]:scan=6200	27.218	3	2583.1799	2583.1799	M	K	126	149
PSM	PEPAKSAPAP	144	sp|Q16778|H2B2E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3914	17.259	2	963.50255	963.5025	M	K	2	12
PSM	PEPTKSAPAP	145	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4492	19.967	2	993.51311	993.5131	M	K	2	12
PSM	PGVTVKDVNQQEFV	146	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6924	30.5	2	1558.7991	1558.7991	M	R	2	16
PSM	PYQYPALTPEQK	147	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6928	30.516	2	1433.7191	1433.7191	M	K	2	14
PSM	TGYTPDEKL	148	sp|O95139-2|NDUB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4973	22.06	2	1022.492	1022.4920	M	R	2	11
PSM	VMEKPSPLLVG	149	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5679	24.822	2	1168.6526	1168.6526	M	R	2	13
PSM	PYTVVYFPVRG	150	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=6284	27.624700244533337	2	1296.6886	1296.6861	P	R	3	14
PSM	AEKFDCHYC	151	sp|Q13642|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5252	23.170942684266667	2	1271.4652	1270.4742	M	R	2	11
PSM	PEPAKSAPAP	152	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=5811	25.378952824	2	963.5023	963.5020	M	K	2	12
PSM	PGETHSAAPGTAADLS	153	sp|Q9Y2F5|ICE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=4483	19.921970974666667	2	1480.6810	1480.6789	M	R	3	19
PSM	TENSTSAPAAKP	154	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=3547	15.679972077066667	2	1172.5680	1172.5668	M	K	2	14
PSM	SEGDSVGESVHG	155	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=4000	17.621727876799998	2	1158.4785	1158.4784	M	K	2	14
PSM	AEAELHKE	156	sp|Q8IXS6-2|PALM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=4401	19.517	2	967.46108	967.4611	M	R	2	10
PSM	KAVTPPMPLLTPATPGGLPPAAAVAAAAATA	157	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=6864	30.265	3	2809.5412	2809.5412	G	K	241	272
PSM	KSPEEPSTPGTVVSSPSISTPPIVPDIQ	158	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6344	27.925	3	2845.4597	2845.4597	N	K	168	196
PSM	MDVHDLFR	159	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5928	25.927	2	1089.4913	1089.4913	-	R	1	9
PSM	MQIFVKTLTG	160	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=5674	24.802	2	1152.6213	1152.6213	-	K	1	11
PSM	MQLTVKALQG	161	sp|P11441|UBL4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=5272	23.225	2	1103.6009	1103.6009	-	R	1	11
PSM	PEPTKSAPAP	162	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4352	19.28	2	993.51311	993.5131	M	K	2	12
PSM	PGVTVKDVNQQEFV	163	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7126	31.216	2	1558.7991	1558.7991	M	R	2	16
PSM	REPPPAYEPPAPAPLPPPSAPSLQPS	164	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5946	26.01	3	2659.3646	2659.3646	T	R	47	73
PSM	SHLPMKLL	165	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5719	25.004	2	995.54739	995.5474	M	R	2	10
PSM	SKAHPPEL	166	sp|P62308|RUXG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=4871	21.633	2	919.47633	919.4763	M	K	2	10
PSM	AEKFDCHYC	167	sp|Q13642|FHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5192	22.957667249866667	2	1270.4736	1270.4742	M	R	2	11
PSM	PEPAKSAPAP	168	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6432	28.3579287704	2	963.5023	963.5020	M	K	2	12
PSM	PAVSKGDGM	169	sp|O95782|AP2A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	9-UNIMOD:35	ms_run[1]:scan=3393	14.951429242666668	2	876.4014	876.4006	M	R	2	11
PSM	SLTDPSKLDSG	170	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=4844	21.51360799253333	2	1118.5458	1118.5450	E	K	3	14
PSM	APVEHVVADAGAFL	171	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6422	28.311	2	1394.7194	1394.7194	M	R	2	16
PSM	MLEAIDKN	172	sp|O75970-5|MPDZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=4244	18.741	2	948.45863	948.4586	-	R	1	9
PSM	NQPPQIAPK	173	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4146	18.257	2	991.54508	991.5451	M	R	2	11
PSM	PDPAKSAPAP	174	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4587	20.405	2	991.49746	991.4975	M	K	2	12
PSM	PYQYPALTPEQK	175	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7123	31.207	2	1433.7191	1433.7191	M	K	2	14
PSM	SHLPMKLL	176	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6301	27.709	2	979.55247	979.5525	M	R	2	10
PSM	DPSKSAPAP	177	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=3672	16.253024708266665	2	868.4287	868.4285	P	K	3	12
PSM	APEVLPKP	178	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=4981	22.082691690133334	2	849.4959	849.4955	M	R	2	10
PSM	PGVTVKDVNQQEFV	179	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=7243	31.631104585333333	2	1559.8052	1558.7982	M	R	2	16
PSM	PIKVGDAIPAVEVFEGEPGN	180	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=6743	29.7431755416	3	2037.0451	2037.0413	A	K	3	23
PSM	KMQELALSEGALP	181	sp|O75165|DJC13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5608	24.54410016426667	2	1387.755344	1385.722452	T	R	599	612