MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000422-3 -- main MTD ms_run[1]-location D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F18.maxq.txt MTD ms_run[2]-location D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F18.maxqFin.txt MTD software[1] [MS, MS:1001583, MaxQuant, 1.6.2.10] MTD software[1]-setting Taxon=userFasta.sprot_human_20201019 MTD software[1]-setting enzymes=TrypN MTD software[1]-setting enzymeMode=0 MTD software[1]-setting fixedModifications=Carbamidomethyl (C) MTD software[1]-setting variableModifications=Acetyl (Protein N-term),Oxidation (M) MTD software[1]-setting maxMissedCleavages=1 MTD software[1]-setting lcmsRunType=Standard MTD software[1]-setting firstSearchTol=40 MTD software[1]-setting mainSearchTol=4.5 MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20201019 MTD software[2]-setting CLE=[X]|[RK] MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Acetyl (Protein N-term) MTD software[2]-setting TOL(-)=20 MTD software[2]-setting TOL(+)=20 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=50 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=1 MTD software[3] [MS, MS:1002251, Comet, 2019.01 rev. 5] MTD software[3]-setting Taxon=userFasta.sprot_human_20201019 MTD software[3]-setting search_enzyme_number=11 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Acetyl (Protein N-term),Oxidation (M) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=1 MTD software[3]-setting peptide_mass_tolerance=20 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=1.0005 MTD software[3]-setting fragment_bin_offset=0.4 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:1, Acetyl,] MTD variable_mod[1]-site N-term MTD variable_mod[1]-position Protein N-term MTD variable_mod[2] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[2]-site M MTD variable_mod[2]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P49006|MRP_HUMAN MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 64.0 null 0.38 64.0 3 2 1 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 0.04 53.0 2 1 0 PRT sp|Q9NY27-2|PP4R2_HUMAN Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 343-UNIMOD:35,357-UNIMOD:35 0.08 53.0 1 1 1 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 51.0 null 617-UNIMOD:35,621-UNIMOD:35 0.09 51.0 5 2 1 PRT sp|P05386|RLA1_HUMAN 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 61-UNIMOD:4 0.39 49.0 1 1 1 PRT sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 49.0 null 97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4 0.05 49.0 1 1 1 PRT sp|Q8N163-2|CCAR2_HUMAN Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.06 48.0 2 2 2 PRT sp|P29966|MARCS_HUMAN Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 48.0 null 0.14 48.0 2 2 2 PRT sp|Q86U86-6|PB1_HUMAN Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.04 48.0 1 1 1 PRT sp|Q9NWA0|MED9_HUMAN Mediator of RNA polymerase II transcription subunit 9 OS=Homo sapiens OX=9606 GN=MED9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.16 48.0 1 1 1 PRT sp|P42167|LAP2B_HUMAN Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48.0 null 363-UNIMOD:4 0.04 48.0 1 1 0 PRT sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 48.0 null 0.30 48.0 30 1 0 PRT sp|Q9UHD8-3|SEPT9_HUMAN Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 0.07 47.0 1 1 1 PRT sp|P42167-2|LAP2B_HUMAN Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 239-UNIMOD:35,254-UNIMOD:4 0.06 46.0 2 1 0 PRT sp|O15511|ARPC5_HUMAN Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 45-UNIMOD:4 0.17 46.0 1 1 1 PRT sp|Q14157-4|UBP2L_HUMAN Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 288-UNIMOD:35 0.03 46.0 1 1 1 PRT sp|P06748|NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 46.0 null 0.11 46.0 1 1 1 PRT sp|Q6ZSZ5-2|ARHGI_HUMAN Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.03 45.0 1 1 1 PRT sp|Q9BSV6|SEN34_HUMAN tRNA-splicing endonuclease subunit Sen34 OS=Homo sapiens OX=9606 GN=TSEN34 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 0.11 44.0 2 1 0 PRT sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.02 44.0 2 1 0 PRT sp|P23246|SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 653-UNIMOD:35,657-UNIMOD:35,658-UNIMOD:35,662-UNIMOD:35 0.05 44.0 3 1 0 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 44.0 null 0.10 44.0 7 2 0 PRT sp|P50991-2|TCPD_HUMAN Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.04 44.0 1 1 1 PRT sp|Q96IK1|BOD1_HUMAN Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 0.14 43.0 2 2 2 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 2-UNIMOD:1 0.06 43.0 3 2 1 PRT sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 358-UNIMOD:35 0.06 43.0 1 1 1 PRT sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.05 43.0 1 1 1 PRT sp|P78527-2|PRKDC_HUMAN Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 3206-UNIMOD:35 0.01 43.0 1 1 0 PRT sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.09 42.0 2 2 2 PRT sp|Q92734-4|TFG_HUMAN Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 182-UNIMOD:35 0.09 42.0 1 1 1 PRT sp|Q92686|NEUG_HUMAN Neurogranin OS=Homo sapiens OX=9606 GN=NRGN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.28 42.0 1 1 1 PRT sp|Q9UK76-3|JUPI1_HUMAN Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.19 42.0 1 1 1 PRT sp|P12277|KCRB_HUMAN Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.09 42.0 2 2 2 PRT sp|Q9UKN8|TF3C4_HUMAN General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 42.0 null 614-UNIMOD:35 0.06 42.0 2 2 2 PRT sp|Q6Y7W6|GGYF2_HUMAN GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42.0 null 475-UNIMOD:35 0.02 42.0 2 1 0 PRT sp|O43823|AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 555-UNIMOD:35 0.04 41.0 2 1 0 PRT sp|P54727-2|RD23B_HUMAN Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.07 41.0 1 1 1 PRT sp|Q8IX01|SUGP2_HUMAN SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 775-UNIMOD:4,782-UNIMOD:35,737-UNIMOD:4,891-UNIMOD:35 0.08 41.0 3 3 3 PRT sp|O75367-2|H2AY_HUMAN Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.06 40.0 1 1 1 PRT sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 144-UNIMOD:35,147-UNIMOD:35 0.11 40.0 6 1 0 PRT sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.02 40.0 1 1 1 PRT sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 905-UNIMOD:4 0.01 40.0 1 1 1 PRT sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 4813-UNIMOD:4,4828-UNIMOD:4 0.00 40.0 1 1 1 PRT sp|P51858-2|HDGF_HUMAN Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 101-UNIMOD:4 0.09 40.0 1 1 1 PRT sp|Q9HCD5|NCOA5_HUMAN Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.06 40.0 1 1 1 PRT sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 1882-UNIMOD:35,1889-UNIMOD:4 0.02 40.0 2 2 2 PRT sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 97-UNIMOD:4,100-UNIMOD:4 0.05 39.0 1 1 1 PRT sp|P49321-4|NASP_HUMAN Isoform 4 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.03 39.0 1 1 1 PRT sp|Q13263-2|TIF1B_HUMAN Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.06 39.0 2 2 2 PRT sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 527-UNIMOD:35 0.01 39.0 1 1 1 PRT sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.01 39.0 1 1 1 PRT sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 276-UNIMOD:35,404-UNIMOD:35 0.07 39.0 2 2 2 PRT sp|Q15459-2|SF3A1_HUMAN Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 311-UNIMOD:35 0.06 39.0 4 2 1 PRT sp|Q9NTI5-2|PDS5B_HUMAN Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 1 1 1 PRT sp|P51610-3|HCFC1_HUMAN Isoform 3 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.07 39.0 1 1 1 PRT sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 305-UNIMOD:35,325-UNIMOD:35 0.14 38.0 8 3 1 PRT sp|Q9UKV3-5|ACINU_HUMAN Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 691-UNIMOD:4 0.02 38.0 1 1 1 PRT sp|Q96SY0-4|INT14_HUMAN Isoform 4 of Integrator complex subunit 14 OS=Homo sapiens OX=9606 GN=INTS14 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.06 38.0 1 1 1 PRT sp|P48634|PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.01 38.0 2 1 0 PRT sp|Q969G3-6|SMCE1_HUMAN Isoform 6 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 101-UNIMOD:35,118-UNIMOD:35 0.08 38.0 1 1 1 PRT sp|P33240-2|CSTF2_HUMAN Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.05 38.0 1 1 1 PRT sp|Q9UBF2|COPG2_HUMAN Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 723-UNIMOD:4,725-UNIMOD:35 0.02 38.0 1 1 1 PRT sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38.0 null 0.01 38.0 1 1 1 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38.0 null 0.05 38.0 2 1 0 PRT sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38.0 null 0.01 38.0 1 1 0 PRT sp|Q9H4A4|AMPB_HUMAN Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 2-UNIMOD:1 0.02 37.0 1 1 1 PRT sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 662-UNIMOD:35 0.03 37.0 2 1 0 PRT sp|O75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.08 37.0 1 1 1 PRT sp|Q9UKY7-3|CDV3_HUMAN Isoform 3 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 62-UNIMOD:35 0.25 37.0 1 1 1 PRT sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 179-UNIMOD:35,194-UNIMOD:4,186-UNIMOD:35 0.07 37.0 2 1 0 PRT sp|P67809|YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37.0 null 0.07 37.0 2 1 0 PRT sp|P78344-2|IF4G2_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 342-UNIMOD:35,346-UNIMOD:35 0.02 36.0 1 1 1 PRT sp|Q8WZA1|PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.03 36.0 1 1 1 PRT sp|P43307|SSRA_HUMAN Translocon-associated protein subunit alpha OS=Homo sapiens OX=9606 GN=SSR1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.08 36.0 1 1 1 PRT sp|P00367-2|DHE3_HUMAN Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 59-UNIMOD:35 0.05 36.0 1 1 1 PRT sp|P09972|ALDOC_HUMAN Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.07 36.0 2 1 0 PRT sp|P39019|RS19_HUMAN 40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 0.10 36.0 12 2 1 PRT sp|O14828|SCAM3_HUMAN Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.08 36.0 1 1 1 PRT sp|Q7LG56-5|RIR2B_HUMAN Isoform 5 of Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.37 35.0 1 1 1 PRT sp|O14744-4|ANM5_HUMAN Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 1 1 1 PRT sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|Q9Y265-2|RUVB1_HUMAN Isoform 2 of RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 141-UNIMOD:4,147-UNIMOD:35 0.06 35.0 1 1 1 PRT sp|O60885-2|BRD4_HUMAN Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 457-UNIMOD:35 0.03 35.0 1 1 1 PRT sp|Q15059-2|BRD3_HUMAN Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 415-UNIMOD:35,432-UNIMOD:35 0.04 35.0 1 1 1 PRT sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 1 1 1 PRT sp|Q9UBE0-2|SAE1_HUMAN Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.08 35.0 1 1 1 PRT sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.06 34.0 1 1 1 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 188-UNIMOD:35 0.08 34.0 2 1 0 PRT sp|Q86XP3-2|DDX42_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 214-UNIMOD:4 0.02 34.0 2 1 0 PRT sp|Q9Y613|FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 1 PRT sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|Q9Y520-2|PRC2C_HUMAN Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|A6NF01|P121B_HUMAN Putative nuclear envelope pore membrane protein POM 121B OS=Homo sapiens OX=9606 GN=POM121B PE=5 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|O15027-2|SC16A_HUMAN Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 2181-UNIMOD:35 0.01 33.0 1 1 1 PRT sp|Q15233-2|NONO_HUMAN Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 312-UNIMOD:35,330-UNIMOD:35,331-UNIMOD:35 0.10 33.0 1 1 1 PRT sp|Q6ZVM7-4|TM1L2_HUMAN Isoform 4 of TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 206-UNIMOD:35,215-UNIMOD:35 0.11 32.0 1 1 1 PRT sp|O60232|ZNRD2_HUMAN Protein ZNRD2 OS=Homo sapiens OX=9606 GN=ZNRD2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 150-UNIMOD:35,152-UNIMOD:4 0.14 32.0 1 1 1 PRT sp|Q9HC35-2|EMAL4_HUMAN Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.04 32.0 1 1 1 PRT sp|Q15910-5|EZH2_HUMAN Isoform 5 of Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 251-UNIMOD:4 0.04 32.0 1 1 1 PRT sp|O15042-3|SR140_HUMAN Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|Q8IU81|I2BP1_HUMAN Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 363-UNIMOD:4 0.05 32.0 1 1 1 PRT sp|Q16740|CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 0.06 32.0 1 1 1 PRT sp|Q9HCJ0|TNR6C_HUMAN Trinucleotide repeat-containing gene 6C protein OS=Homo sapiens OX=9606 GN=TNRC6C PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 2-UNIMOD:1 0.01 31.0 1 1 1 PRT sp|Q14974-2|IMB1_HUMAN Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 265-UNIMOD:35,272-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 1-UNIMOD:35 0.21 31.0 3 2 1 PRT sp|Q15637-4|SF01_HUMAN Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 36-UNIMOD:35 0.03 31.0 3 1 0 PRT sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 42-UNIMOD:4 0.08 31.0 1 1 1 PRT sp|P46379-4|BAG6_HUMAN Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 823-UNIMOD:35 0.02 31.0 2 1 0 PRT sp|Q7Z7F0-4|KHDC4_HUMAN Isoform 4 of KH homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KHDC4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 2-UNIMOD:1 0.06 31.0 1 1 1 PRT sp|Q96SK2-2|TM209_HUMAN Isoform 2 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 1-UNIMOD:35 0.03 31.0 1 1 1 PRT sp|O15446|RPA34_HUMAN DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 364-UNIMOD:35 0.06 31.0 2 1 0 PRT sp|Q6IBS0|TWF2_HUMAN Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 2-UNIMOD:1 0.04 30.0 2 1 0 PRT sp|Q9BSD7|NTPCR_HUMAN Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 2-UNIMOD:1 0.07 30.0 1 1 1 PRT sp|P54136-2|SYRC_HUMAN Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 0 PRT sp|Q9Y5A9|YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|Q16543|CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.05 30.0 1 1 1 PRT sp|P53367|ARFP1_HUMAN Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 78-UNIMOD:35 0.07 30.0 1 1 1 PRT sp|Q2M2I8-2|AAK1_HUMAN Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 569-UNIMOD:35 0.04 30.0 1 1 1 PRT sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|Q9Y2F5|ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 210-UNIMOD:35,213-UNIMOD:35,217-UNIMOD:35 0.03 30.0 1 1 1 PRT sp|Q92575|UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 144-UNIMOD:4 0.07 30.0 1 1 1 PRT sp|Q9HBM0|VEZA_HUMAN Vezatin OS=Homo sapiens OX=9606 GN=VEZT PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 30.0 null 632-UNIMOD:35,636-UNIMOD:35 0.03 30.0 2 1 0 PRT sp|Q86U90|YRDC_HUMAN YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 153-UNIMOD:35 0.05 29.0 1 1 1 PRT sp|Q13561|DCTN2_HUMAN Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 378-UNIMOD:35 0.04 29.0 1 1 1 PRT sp|Q86W34-5|AMZ2_HUMAN Isoform 2 of Archaemetzincin-2 OS=Homo sapiens OX=9606 GN=AMZ2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 1-UNIMOD:1,1-UNIMOD:35 0.04 29.0 1 1 1 PRT sp|Q7Z5L7|PODN_HUMAN Podocan OS=Homo sapiens OX=9606 GN=PODN PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 0.03 29.0 3 1 0 PRT sp|O14569|C56D2_HUMAN Cytochrome b561 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CYB561D2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.05 28.0 1 1 1 PRT sp|Q9Y3B2|EXOS1_HUMAN Exosome complex component CSL4 OS=Homo sapiens OX=9606 GN=EXOSC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 8-UNIMOD:4 0.06 28.0 1 1 1 PRT sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens OX=9606 GN=YIF1A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 2-UNIMOD:1 0.04 28.0 1 1 1 PRT sp|Q00341-2|VIGLN_HUMAN Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 1211-UNIMOD:35 0.02 28.0 1 1 1 PRT sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 434-UNIMOD:35 0.03 28.0 1 1 1 PRT sp|Q9P0S3|ORML1_HUMAN ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 1-UNIMOD:35 0.10 28.0 1 1 1 PRT sp|Q6PKG0-3|LARP1_HUMAN Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9P0W2-3|HM20B_HUMAN Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 2-UNIMOD:1 0.06 28.0 1 1 1 PRT sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|Q6NXS1|IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 2-UNIMOD:1 0.05 27.0 1 1 1 PRT sp|P27816-2|MAP4_HUMAN Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q9P0I2-2|EMC3_HUMAN Isoform 2 of ER membrane protein complex subunit 3 OS=Homo sapiens OX=9606 GN=EMC3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 101-UNIMOD:35,106-UNIMOD:35,110-UNIMOD:35,111-UNIMOD:35 0.09 27.0 1 1 1 PRT sp|Q93079|H2B1H_HUMAN Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 27.0 null 1-UNIMOD:35,2-UNIMOD:1 0.10 27.0 41 2 1 PRT sp|P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27.0 null 0.09 27.0 44 1 0 PRT sp|P63313|TYB10_HUMAN Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 7-UNIMOD:35 0.32 26.0 1 1 1 PRT sp|Q9H832-2|UBE2Z_HUMAN Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 11-UNIMOD:35,20-UNIMOD:35 0.07 26.0 1 1 1 PRT sp|O43149|ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 49-UNIMOD:35,54-UNIMOD:35,59-UNIMOD:35 0.04 26.0 1 1 1 PRT sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 389-UNIMOD:35 0.05 26.0 2 2 2 PRT sp|O95433-2|AHSA1_HUMAN Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 163-UNIMOD:35,168-UNIMOD:35 0.09 26.0 1 1 1 PRT sp|P62875|RPAB5_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC5 OS=Homo sapiens OX=9606 GN=POLR2L PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4 0.18 26.0 1 1 1 PRT sp|Q99880|H2B1L_HUMAN Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 2 1 0 PRT sp|Q99877|H2B1N_HUMAN Histone H2B type 1-N OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 5 1 0 PRT sp|P58876|H2B1D_HUMAN Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 22 1 0 PRT sp|Q8NC51-4|PAIRB_HUMAN Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 11-UNIMOD:4 0.04 26.0 1 1 1 PRT sp|P11387|TOP1_HUMAN DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 2-UNIMOD:1 0.02 26.0 1 1 1 PRT sp|Q13283-2|G3BP1_HUMAN Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 3-UNIMOD:35 0.10 26.0 2 1 0 PRT sp|Q96HA1|P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P23786|CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|Q13618-3|CUL3_HUMAN Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|O95218-2|ZRAB2_HUMAN Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|Q16626|MEA1_HUMAN Male-enhanced antigen 1 OS=Homo sapiens OX=9606 GN=MEA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 1-UNIMOD:1,1-UNIMOD:35 0.07 25.0 1 1 1 PRT sp|P84103-2|SRSF3_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4 0.09 25.0 1 1 1 PRT sp|Q8N257|H2B3B_HUMAN Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 25.0 null 0.09 25.0 3 1 0 PRT sp|Q9BWH6|RPAP1_HUMAN RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 185-UNIMOD:4 0.02 25.0 1 1 1 PRT sp|Q96S52|PIGS_HUMAN GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q8WWI5-3|CTL1_HUMAN Isoform 3 of Choline transporter-like protein 1 OS=Homo sapiens OX=9606 GN=SLC44A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 3-UNIMOD:4,4-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|P20290-2|BTF3_HUMAN Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.16 24.0 1 1 1 PRT sp|Q96DT7-2|ZBT10_HUMAN Isoform 2 of Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|P46778|RL21_HUMAN 60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 159-UNIMOD:35 0.10 24.0 1 1 1 PRT sp|P06396-2|GELS_HUMAN Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 1-UNIMOD:35 0.01 24.0 1 1 1 PRT sp|Q13907|IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24.0 null 12-UNIMOD:4 0.04 24.0 2 1 0 PRT sp|Q9HC77|CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 371-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 1-UNIMOD:1,1-UNIMOD:35 0.02 23.0 2 1 0 PRT sp|P35998|PRS7_HUMAN 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|P04818-3|TYSY_HUMAN Isoform 3 of Thymidylate synthase OS=Homo sapiens OX=9606 GN=TYMS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|Q13085-3|ACACA_HUMAN Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 2-UNIMOD:1 0.00 23.0 1 1 1 PRT sp|O95139-2|NDUB6_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.09 23.0 1 1 1 PRT sp|Q9Y3A3-3|PHOCN_HUMAN Isoform 3 of MOB-like protein phocein OS=Homo sapiens OX=9606 GN=MOB4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 3-UNIMOD:35 0.05 23.0 1 1 1 PRT sp|P54136|SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 2 1 0 PRT sp|Q9BW85|YJU2_HUMAN Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 275-UNIMOD:4 0.07 23.0 1 1 1 PRT sp|Q5EE01|CENPW_HUMAN Centromere protein W OS=Homo sapiens OX=9606 GN=CENPW PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23.0 null 0.11 23.0 1 1 1 PRT sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens OX=9606 GN=FBXO38 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q8TAQ2-2|SMRC2_HUMAN Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 343-UNIMOD:35 0.02 22.0 1 1 1 PRT sp|P31946|1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 220-UNIMOD:35,1-UNIMOD:35,3-UNIMOD:35 0.09 22.0 2 2 2 PRT sp|P55795|HNRH2_HUMAN Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 2-UNIMOD:35 0.03 22.0 1 1 1 PRT sp|P62847-2|RS24_HUMAN Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 1-UNIMOD:35 0.08 22.0 1 1 1 PRT sp|P11441|UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 1-UNIMOD:35 0.07 22.0 2 1 0 PRT sp|Q16778|H2B2E_HUMAN Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.09 22.0 1 1 0 PRT sp|Q99848|EBP2_HUMAN Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|Q9BXV9|GON7_HUMAN EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.27 22.0 1 1 1 PRT sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 2-UNIMOD:1,6-UNIMOD:35 0.01 22.0 2 1 0 PRT sp|P62308|RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 2-UNIMOD:1 0.12 22.0 3 1 0 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q969L4|LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens OX=9606 GN=LSM10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 2-UNIMOD:1 0.07 21.0 1 1 1 PRT sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.06 21.0 1 1 1 PRT sp|Q70E73|RAPH1_HUMAN Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P78330|SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 1-UNIMOD:1,1-UNIMOD:35 0.04 21.0 1 1 1 PRT sp|Q9NV70-2|EXOC1_HUMAN Isoform 2 of Exocyst complex component 1 OS=Homo sapiens OX=9606 GN=EXOC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 2-UNIMOD:1 0.01 21.0 1 1 1 PRT sp|Q9Y5V3|MAGD1_HUMAN Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 205-UNIMOD:35 0.05 21.0 1 1 1 PRT sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|O75781|PALM_HUMAN Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|O94766-2|B3GA3_HUMAN Isoform 2 of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q7L5Y6|DET1_HUMAN DET1 homolog OS=Homo sapiens OX=9606 GN=DET1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 1-UNIMOD:1,1-UNIMOD:35 0.02 20.0 1 1 1 PRT sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 1-UNIMOD:35,8-UNIMOD:35 0.08 20.0 1 1 1 PRT sp|O75970-5|MPDZ_HUMAN Isoform 4 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 1-UNIMOD:35 0.00 20.0 1 1 1 PRT sp|O60749|SNX2_HUMAN Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P33778|H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20.0 null 0.09 20.0 1 1 0 PRT sp|Q7Z2Z2|EFL1_HUMAN Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20.0 null 9-UNIMOD:35 0.01 20.0 1 1 1 PRT sp|Q8NEY8-3|PPHLN_HUMAN Isoform 3 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS1L PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 468-UNIMOD:35 0.07 20.0 1 1 1 PRT sp|P09669|COX6C_HUMAN Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 19.0 null 0.12 19.0 3 2 1 PRT sp|Q99497|PARK7_HUMAN Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.14 19.0 1 1 1 PRT sp|P22626-2|ROA2_HUMAN Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 120-UNIMOD:35 0.07 19.0 1 1 1 PRT sp|Q6ZS81|WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=WDFY4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q13435|SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 239-UNIMOD:35 0.03 19.0 1 1 1 PRT sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens OX=9606 GN=SLC16A2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 517-UNIMOD:35 0.05 19.0 1 1 1 PRT sp|Q04637-5|IF4G1_HUMAN Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P04406-2|G3P_HUMAN Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19.0 null 4-UNIMOD:35 0.04 19.0 1 1 1 PRT sp|P16220|CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 254-UNIMOD:35 0.09 19.0 1 1 1 PRT sp|Q13642-3|FHL1_HUMAN Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4 0.05 18.0 1 1 1 PRT sp|Q96AA3|RFT1_HUMAN Protein RFT1 homolog OS=Homo sapiens OX=9606 GN=RFT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q96AY3-2|FKB10_HUMAN Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q9H501|ESF1_HUMAN ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P22314-2|UBA1_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 194-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q5BKZ1-3|ZN326_HUMAN Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|O43920|NDUS5_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 OS=Homo sapiens OX=9606 GN=NDUFS5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|Q6EEV4-2|GL1AD_HUMAN Isoform 5 of DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 OS=Homo sapiens OX=9606 GN=POLR2M null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 28-UNIMOD:4 0.31 18.0 1 1 1 PRT sp|Q14160-2|SCRIB_HUMAN Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q5JUR7-2|TEX30_HUMAN Isoform 2 of Testis-expressed protein 30 OS=Homo sapiens OX=9606 GN=TEX30 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 2-UNIMOD:1 0.07 18.0 1 1 1 PRT sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 277-UNIMOD:4 0.06 18.0 1 1 1 PRT sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=CABP1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA 1 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 64 ms_run[2]:scan=5200 22.678 3 3176.4382 3176.4382 P K 43 77 PSM KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSD 2 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 ms_run[2]:scan=4819 21.187 3 3365.4516 3365.4516 Q K 798 832 PSM KTGEILSESSMENDDEATEVTDEPMEQD 3 sp|Q9NY27-2|PP4R2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 11-UNIMOD:35,25-UNIMOD:35 ms_run[2]:scan=5272 22.936 3 3160.2708 3160.2708 S - 333 361 PSM KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 4 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 51 9-UNIMOD:35,13-UNIMOD:35 ms_run[1]:scan=5861 24.9976921232 3 3505.580610 3505.576600 T - 609 647 PSM KALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEE 5 sp|P05386|RLA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 13-UNIMOD:4 ms_run[2]:scan=6737 29.022 4 3807.9214 3807.9214 A K 49 92 PSM RVNDGVCDCCDGTDEYNSGVICENTC 6 sp|P14314|GLU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 49 7-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4,22-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=5300 23.024861277333333 3 3069.139457 3068.131070 N K 91 117 PSM KEAAPDAGAEPITADSDPAYSS 7 sp|Q8N163-2|CCAR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=5101 22.291 2 2161.9651 2161.9651 E K 287 309 PSM KEAPAEGEAAEPGSPTAAEGEAASAASSTSSP 8 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=5129 22.407 3 2914.2952 2914.2952 E K 105 137 PSM KGEADDEDDDEDGQDNQGTVTEGSSPAYL 9 sp|Q86U86-6|PB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=5522 23.752 3 3056.2127 3056.2127 Q K 154 183 PSM KPLPPPQPPPVPAPQPQQSPAP 10 sp|Q9NWA0|MED9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=5417 23.41 3 2264.2317 2264.2317 T R 28 50 PSM KEMFPYEASTPTGISASC 11 sp|P42167|LAP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48 18-UNIMOD:4 ms_run[1]:scan=6031 25.6929015656 2 1974.873458 1974.870315 L R 346 364 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 12 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48 ms_run[1]:scan=5422 23.424706395999998 3 2775.425340 2773.424637 G K 61 94 PSM KPAEAPTAPSPAQTLENSEPAPVSQLQS 13 sp|Q9UHD8-3|SEPT9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=5978 25.492 3 2844.4141 2844.4141 P R 30 58 PSM KEMFPYEASTPTGISASC 14 sp|P42167-2|LAP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 3-UNIMOD:35,18-UNIMOD:4 ms_run[2]:scan=5729 24.508 2 1990.8652 1990.8652 L R 237 255 PSM KFVDEEDGGDGQAGPDEGEVDSCL 15 sp|O15511|ARPC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 23-UNIMOD:4 ms_run[2]:scan=5676 24.312 3 2524.0184 2524.0184 N R 23 47 PSM KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 16 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 13-UNIMOD:35 ms_run[2]:scan=6099 25.996 3 3489.5817 3489.5817 T - 609 647 PSM KTPSTMENDSSNLDPSQAPSLAQPLVFSNS 17 sp|Q14157-4|UBP2L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 6-UNIMOD:35 ms_run[2]:scan=6421 27.495 3 3177.4772 3177.4772 G K 283 313 PSM KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE 18 sp|P06748|NPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 46 ms_run[1]:scan=5274 22.946028273866666 3 3723.204952 3722.195067 V K 157 189 PSM KLSDSDIPGSSEESPQVVEAPGTESDP 19 sp|Q6ZSZ5-2|ARHGI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=5588 23.967 3 2756.2512 2756.2512 L R 606 633 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 20 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=5431 23.455158162933333 3 2775.425340 2773.424637 G K 61 94 PSM KEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLP 21 sp|Q9BSV6|SEN34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5345 23.17 3 3312.4502 3312.4502 A R 146 180 PSM KEEAEAPVEDGSQPPPPEP 22 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4734 20.84 2 2001.9167 2001.9167 L K 623 642 PSM KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM 23 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35 ms_run[2]:scan=6042 25.734 3 3230.4029 3230.4029 Q R 630 663 PSM KGVVPLAGTNGETTTQGLDGLSE 24 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=6025 25.673 3 2243.1281 2243.1281 D R 111 134 PSM PENVAPRSGATAGAAGG 25 sp|P50991-2|TCPD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=3871 16.973 2 1481.7223 1481.7223 M R 2 19 PSM KAAVPAPPPEPEGQDPPAPSQDTS 26 sp|Q96IK1|BOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=4818 21.185 3 2382.1339 2382.1339 K - 162 186 PSM KDATNVGDEGGFAPNILEN 27 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6313 26.965 2 1959.9174 1959.9174 G K 202 221 PSM KEMFPYEASTPTGISASC 28 sp|P42167-2|LAP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 18-UNIMOD:4 ms_run[2]:scan=6038 25.719 2 1974.8703 1974.8703 L R 237 255 PSM KEVEETDEMDQVELVDFDPNQE 29 sp|P31689|DNJA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 9-UNIMOD:35 ms_run[2]:scan=6325 27.025 3 2653.1225 2653.1225 R R 350 372 PSM KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM 30 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35 ms_run[2]:scan=6217 26.521 3 3230.4029 3230.4029 Q R 630 663 PSM KIGNPVPYNEGLGQPQVAPPAPAASPAASS 31 sp|P27694|RFA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=5821 24.847 3 2884.4719 2884.4719 V R 111 141 PSM KLTPLPEDNSMNVDQDGDPSD 32 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 11-UNIMOD:35 ms_run[2]:scan=5114 22.339 3 2301.9907 2301.9907 E R 3196 3217 PSM KDYEEVGADSADGEDEGEEY 33 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5076 22.182 2 2205.8346 2205.8346 E - 430 450 PSM KGVVPLAGTNGETTTQGLDGLSE 34 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5853 24.968 3 2243.1281 2243.1281 D R 111 134 PSM KNVMSAFGLTDDQVSGPPSAPAED 35 sp|Q92734-4|TFG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 4-UNIMOD:35 ms_run[2]:scan=5948 25.368 3 2448.1115 2448.1115 N R 179 203 PSM KPDDDILDIPLDDPGANAAAA 36 sp|Q92686|NEUG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6768 29.174 2 2106.0117 2106.0117 S K 11 32 PSM KPVPAAPVPSPVAPAPVPS 37 sp|Q9UK76-3|JUPI1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5521 23.75 2 1777.0138 1777.0138 E R 76 95 PSM KTDLNPDNLQGGDDLDPNYVLSS 38 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6311 26.957 3 2489.1558 2489.1558 H R 107 130 PSM KEGDVEEPTDDSLPTTGDAGG 39 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=5055 22.108677650133334 2 2088.902717 2088.897118 S R 641 662 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 40 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=6558 28.159559915200003 3 2774.432457 2773.424637 G K 61 94 PSM RPVETPVVGAPGMGSVSTEPDDEEGL 41 sp|Q6Y7W6|GGYF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 13-UNIMOD:35 ms_run[1]:scan=5763 24.636992399466667 3 2641.228862 2640.222492 L K 463 489 PSM KDATNVGDEGGFAPNILEN 42 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=6214 26.51 2 1959.9174 1959.9174 G K 202 221 PSM KGEDPFTSETVDPEMEGDDNLGGED 43 sp|O43823|AKAP8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:35 ms_run[2]:scan=5940 25.334 3 2698.0712 2698.0712 L K 541 566 PSM KPAETPVATSPTATDSTSGDSS 44 sp|P54727-2|RD23B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=4193 18.389 2 2105.9601 2105.9601 E R 79 101 PSM KPAGVDISEAPQTSSPCPSADIDM 45 sp|Q8IX01|SUGP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 17-UNIMOD:4,24-UNIMOD:35 ms_run[2]:scan=5348 23.18 3 2488.1098 2488.1098 P K 759 783 PSM KGVVPLAGTNGETTTQGLDGLSE 46 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=5834 24.901271312266665 3 2243.130023 2243.128121 D R 111 134 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 47 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=7261 31.0677508072 3 2774.429080 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 48 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=7073 30.38939068053333 3 2774.432457 2773.424637 G K 61 94 PSM KAASADSTTEGTPADGFTVLST 49 sp|O75367-2|H2AY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6071 25.864 2 2126.0015 2126.0015 S K 167 189 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 50 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 22-UNIMOD:35,25-UNIMOD:35 ms_run[2]:scan=5579 23.942 3 2730.3833 2730.3833 K R 123 152 PSM KEAPAGPLEEDDLEPLTLAPAPAP 51 sp|Q92797|SYMPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6753 29.101 3 2440.2373 2440.2373 A R 1109 1133 PSM KEEAEAPVEDGSQPPPPEP 52 sp|Q9Y4L1|HYOU1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=4831 21.229 2 2001.9167 2001.9167 L K 623 642 PSM KGPAESPDEGITTTEGEGECEQTPEELEPVE 53 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 20-UNIMOD:4 ms_run[2]:scan=5750 24.592 3 3343.4409 3343.4409 T K 886 917 PSM KILLVDSPGMGNADDEQQEEGTSS 54 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:35 ms_run[2]:scan=5378 23.286 3 2535.1283 2535.1283 S K 605 629 PSM KLPCPEGLDPDTDDAPEVC 55 sp|Q9NR09|BIRC6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:4,19-UNIMOD:4 ms_run[2]:scan=5854 24.97 2 2126.9136 2126.9136 L R 4810 4829 PSM KSCVEEPEPEPEAAEGDGD 56 sp|P51858-2|HDGF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:4 ms_run[2]:scan=4620 20.381 2 2043.8215 2043.8215 K K 99 118 PSM KTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQA 57 sp|Q9HCD5|NCOA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5785 24.716 3 3485.7638 3485.7638 L K 400 434 PSM KVAEPELMGTPDGTCYPPPPVP 58 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:35,15-UNIMOD:4 ms_run[2]:scan=6007 25.597 3 2367.1127 2367.1127 R R 1875 1897 PSM KAAEAAPPTQEAQGETEPTEQAPDALEQAADTS 59 sp|Q8N163-2|CCAR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5524 23.756 4 3351.5226 3351.5226 Q R 446 479 PSM KAGDTVIPLYIPQCGEC 60 sp|P11766|ADHX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=6554 28.139 2 1919.9121 1919.9121 L K 84 101 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 61 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 22-UNIMOD:35 ms_run[2]:scan=5884 25.086 3 2714.3884 2714.3884 K R 123 152 PSM KDGAVNGPSVVGDQTPIEPQTSIE 62 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5742 24.559 3 2437.1973 2437.1973 P R 312 336 PSM KEEDGSLSLDGADSTGVVA 63 sp|Q13263-2|TIF1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5618 24.091 2 1848.8589 1848.8589 L K 594 613 PSM KEVIPVNVPEAQEEM 64 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:35 ms_run[2]:scan=5581 23.946 2 1726.8448 1726.8448 K K 513 528 PSM KIEEPPIPPLEQPVAPED 65 sp|Q9C0C9|UBE2O_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6248 26.663 2 1997.0357 1997.0357 P K 754 772 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 66 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6089 25.953 3 2773.4246 2773.4246 G K 61 94 PSM KPGMVVTFAPVNVTTEV 67 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35 ms_run[2]:scan=6388 27.332 2 1803.9441 1803.9441 L K 273 290 PSM KPLPPAPAPDEYLVSPITGE 68 sp|Q15459-2|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6478 27.776 2 2090.0936 2090.0936 S K 334 354 PSM KSIDGTADDEDEGVPTDQAI 69 sp|Q9NTI5-2|PDS5B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5329 23.118 2 2074.9179 2074.9179 N R 627 647 PSM KYDIPATAATATSPTPNPVPSVPANPP 70 sp|P51610-3|HCFC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6009 25.606 3 2673.365 2673.3650 Q K 399 426 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 71 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=5567 23.907461421333334 3 2775.425340 2773.424637 G K 61 94 PSM KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 72 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 39 9-UNIMOD:35,13-UNIMOD:35 ms_run[1]:scan=5959 25.4272470152 3 3505.580610 3505.576600 T - 609 647 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 73 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 25-UNIMOD:35 ms_run[2]:scan=5971 25.471 3 2714.3884 2714.3884 K R 123 152 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 74 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6352 27.163 3 2698.3935 2698.3935 K R 123 152 PSM KDLYANTVLSGGTTMYPGIAD 75 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:35 ms_run[2]:scan=6278 26.802 3 2202.0514 2202.0515 R R 291 312 PSM KDPSSGQEVATPPVPQLQVCEP 76 sp|Q9UKV3-5|ACINU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 20-UNIMOD:4 ms_run[2]:scan=6149 26.215 3 2362.1475 2362.1475 T K 672 694 PSM KEGDEVGTGITDDNEDENSANQIAG 77 sp|Q96SY0-4|INT14_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5102 22.293 3 2577.095 2577.0950 N K 201 226 PSM KEGTLTQVPLAPPPPGAPPSPAPA 78 sp|P48634|PRC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6010 25.61 3 2289.2369 2289.2369 P R 1128 1152 PSM KGEPYMSIQPAEDPDDYDDGFSM 79 sp|Q969G3-6|SMCE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=5943 25.346 3 2638.0363 2638.0363 E K 96 119 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 80 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6276 26.795 3 2773.4246 2773.4246 G K 61 94 PSM KSLGTGAPVIESPYGETISPEDAPESIS 81 sp|P33240-2|CSTF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6331 27.057 3 2830.376 2830.3760 L K 102 130 PSM KVPPPPETPMPPPLPPTPDQVIV 82 sp|Q15459-2|SF3A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:35 ms_run[2]:scan=6465 27.712 3 2458.3182 2458.3182 Q R 302 325 PSM RLPDDDPTAVAGSFSCTM 83 sp|Q9UBF2|COPG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 16-UNIMOD:4,18-UNIMOD:35 ms_run[2]:scan=5847 24.952 2 1954.8401 1954.8401 V K 708 726 PSM RAVTTVTQSTPVPGPSVPPPEELQVSPGP 84 sp|P51610|HCFC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=6128 26.121763186400003 3 2923.535955 2923.529102 T R 1482 1511 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 85 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=6729 28.982708645333332 3 2774.432457 2773.424637 G K 61 94 PSM KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 86 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 9-UNIMOD:35 ms_run[1]:scan=6195 26.428334115200002 3 3489.588892 3489.581685 T - 609 647 PSM KLVQDVANNTNEEAGDGTTTATVLA 87 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=5547 23.830264160800002 3 2532.224918 2531.235105 A R 96 121 PSM KLTPLPEDNSMNVDQDGDPSD 88 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=5571 23.923230054933335 3 2285.999247 2285.995786 E R 3196 3217 PSM ASGEHSPGSGAAR 89 sp|Q9H4A4|AMPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 1-UNIMOD:1 ms_run[2]:scan=3410 15.11 2 1224.5483 1224.5483 M R 2 15 PSM KDDGEDSEMQVEAPSDSSVIAQQ 90 sp|Q9P2I0|CPSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:35 ms_run[2]:scan=5058 22.117 3 2480.0497 2480.0497 L K 654 677 PSM KGIPLATGDTSPEPELLPGAPLPPP 91 sp|O75821|EIF3G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6728 28.977 3 2463.3261 2463.3261 L K 32 57 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 92 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5891 25.12 3 2773.4246 2773.4246 G K 61 94 PSM KTAPVQAPPAPVIVTETPEPAMTSGVY 93 sp|Q9UKY7-3|CDV3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 22-UNIMOD:35 ms_run[2]:scan=6130 26.132 3 2766.415 2766.4150 N R 41 68 PSM KTIGGGDDSFNTFFSETGAG 94 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6713 28.905 2 2006.8858 2006.8858 D K 40 60 PSM RVMTIPYQPMPASSPVICAGGQD 95 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35,18-UNIMOD:4 ms_run[2]:scan=6063 25.828 3 2490.1705 2490.1705 G R 177 200 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 96 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=7166 30.730680202133332 3 2774.432052 2773.424637 G K 61 94 PSM KAADPPAENSSAPEAEQGGAE 97 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=3976 17.384969677866664 2 2025.879559 2024.892307 T - 304 325 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 98 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 25-UNIMOD:35 ms_run[2]:scan=6197 26.439 3 2714.3884 2714.3884 K R 123 152 PSM KDCPPDPVGPSPQDPSLEASGPSP 99 sp|Q8IX01|SUGP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:4 ms_run[2]:scan=5478 23.579 3 2430.1009 2430.1009 A K 735 759 PSM KDLGVFIPAPMAQGM 100 sp|P78344-2|IF4G2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=6162 26.277 2 1605.7895 1605.7895 V R 332 347 PSM KDPTPIEFSPDPLPDN 101 sp|Q8WZA1|PMGT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6308 26.945 2 1780.8519 1780.8519 C K 282 298 PSM KEEEDVSGEPEASPSADTTILFV 102 sp|P43307|SSRA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6708 28.885 3 2449.1384 2449.1384 D K 68 91 PSM KGFIGPGIDVPAPDMSTGE 103 sp|P00367-2|DHE3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:35 ms_run[2]:scan=6148 26.21 2 1902.9033 1902.9033 K R 45 64 PSM KGVVPLAGTDGETTTQGLDGLSE 104 sp|P09972|ALDOC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6109 26.041 3 2244.1121 2244.1121 D R 111 134 PSM KSYELPDGQVITIGNE 105 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6317 26.986 2 1761.8785 1761.8785 E R 238 254 PSM PGVTVKDVNQQEFV 106 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5675 24.307 2 1558.7991 1558.7991 M R 2 16 PSM REPPPAYEPPAPAPLPPPSAPSLQPS 107 sp|O14828|SCAM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6047 25.754 3 2659.3646 2659.3646 T R 47 73 PSM RVMTIPYQPMPASSPVICAGGQD 108 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:4 ms_run[2]:scan=5751 24.594 3 2506.1655 2506.1655 G R 177 200 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 109 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=6809 29.352897813600002 3 2774.432457 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 110 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=6643 28.569621732799998 3 2774.432457 2773.424637 G K 61 94 PSM GDPERPEAAGLDQDE 111 sp|Q7LG56-5|RIR2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4691 20.668 2 1597.6856 1597.6856 M R 2 17 PSM KDDGVSIPGEYTSFLAPISSS 112 sp|O14744-4|ANM5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6997 30.11 2 2169.0477 2169.0477 L K 287 308 PSM KEPNPPIDEVISTPGVVA 113 sp|P52294|IMA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6345 27.126 2 1860.9833 1860.9833 S R 112 130 PSM KEVYEGEVTELTPCETENPMGGYG 114 sp|Q9Y265-2|RUVB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:4,20-UNIMOD:35 ms_run[2]:scan=5856 24.98 3 2704.152 2704.1520 T K 128 152 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 115 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6470 27.739 3 2773.4246 2773.4246 G K 61 94 PSM KMPDEPEEPVVAVSSPAVPPPT 116 sp|O60885-2|BRD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:35 ms_run[2]:scan=5693 24.379 3 2288.1246 2288.1246 A K 456 478 PSM KMPDEPVEAPALPAPAAPMVS 117 sp|Q15059-2|BRD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5857 24.985 3 2149.0435 2149.0435 A K 414 435 PSM KPGPAEAPSPTASPSGDASPPATAPYDP 118 sp|Q9UPT8|ZC3H4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5241 22.829 3 2632.2293 2632.2293 A R 1096 1124 PSM VEKEEAGGGISEEEAAQYD 119 sp|Q9UBE0-2|SAE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5038 22.04 2 2009.8702 2009.8702 M R 2 21 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 120 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=6978 30.031203770666664 3 2774.432457 2773.424637 G K 61 94 PSM KDEILPTTPISEQ 121 sp|P23396|RS3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5682 24.342 2 1469.7613 1469.7613 P K 214 227 PSM KDGDSVMVLPTIPEEEA 122 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6522 27.985 2 1828.8764 1828.8764 W K 182 199 PSM KELEPGDGPIAVIVCPT 123 sp|Q86XP3-2|DDX42_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 15-UNIMOD:4 ms_run[2]:scan=6451 27.645 2 1793.9233 1793.9233 Q R 200 217 PSM KELEPGDGPIAVIVCPT 124 sp|Q86XP3-2|DDX42_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 15-UNIMOD:4 ms_run[2]:scan=6460 27.689 2 1793.9233 1793.9233 Q R 200 217 PSM KPLPPAPAPDEYLVSPITGE 125 sp|Q15459-2|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6570 28.218 2 2090.0936 2090.0936 S K 334 354 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 126 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=7360 31.4205859128 3 2774.430527 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 127 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=7466 31.801556204 3 2773.425567 2773.424637 G K 61 94 PSM AGGEDRGDGEPVSVVTV 128 sp|Q9Y613|FHOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5508 23.705 2 1642.7798 1642.7798 M R 2 19 PSM KAQYYLPDGSTIEIGPS 129 sp|P61163|ACTZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6628 28.499 2 1837.9098 1837.9098 E R 238 255 PSM KASPSPTDPVVPAVPIGPPPAGF 130 sp|P11498|PYC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6692 28.802 3 2197.1783 2197.1783 V R 519 542 PSM KDGDSVMVLPTIPEEEA 131 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 7-UNIMOD:35 ms_run[2]:scan=6157 26.254 2 1844.8714 1844.8714 W K 182 199 PSM KPLEPVSTVQVEPAV 132 sp|Q9Y520-2|PRC2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5723 24.484 2 1591.8821 1591.8821 E K 862 877 PSM KSPLPSYPGANPQPAFGAAEGQPPGAA 133 sp|A6NF01|P121B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5992 25.55 3 2576.266 2576.2660 A K 541 568 PSM KSYELPDGQVITIGNE 134 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6215 26.513 2 1761.8785 1761.8785 E R 238 254 PSM KTVQAAPPALPGPPGAPVNMYS 135 sp|O15027-2|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 20-UNIMOD:35 ms_run[2]:scan=5812 24.811 3 2178.1143 2178.1143 P R 2162 2184 PSM RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE 136 sp|Q15233-2|NONO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 4-UNIMOD:35,22-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=6085 25.933 4 3498.6833 3498.6833 N R 309 345 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 137 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=7364 31.4349691016 3 2774.430527 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 138 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=7639 32.44626229226667 3 2774.426481 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 139 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=6893 29.688589407200002 3 2774.432457 2773.424637 G K 61 94 PSM RPVETPVVGAPGMGSVSTEPDDEEGL 140 sp|Q6Y7W6|GGYF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 13-UNIMOD:35 ms_run[1]:scan=5759 24.6261190928 3 2641.228862 2640.222492 L K 463 489 PSM KAAEMVPDLPSPPMEAPAPASNPSG 141 sp|Q6ZVM7-4|TM1L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 5-UNIMOD:35,14-UNIMOD:35 ms_run[2]:scan=5636 24.166 3 2492.1563 2492.1563 A R 202 227 PSM KAAQGPPAPAVPPNTDVMACTQTALLQ 142 sp|O60232|ZNRD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 18-UNIMOD:35,20-UNIMOD:4 ms_run[2]:scan=5885 25.09 3 2762.3731 2762.3731 L K 133 160 PSM KAPVSSTESVIQSNTPTPPPSQPLNETAEEES 143 sp|Q9HC35-2|EMAL4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5678 24.32 3 3350.6002 3350.6002 T R 825 857 PSM KELTEQQLPGALPPECTPNIDGPNA 144 sp|Q15910-5|EZH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 16-UNIMOD:4 ms_run[2]:scan=6043 25.738 3 2688.3065 2688.3065 Y K 236 261 PSM KSLDDDLDGVPLDATEDS 145 sp|O15042-3|SR140_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6148 26.21 2 1903.8535 1903.8535 I K 321 339 PSM REPAPAEALPQQYPEPAPAALCGPPP 146 sp|Q8IU81|I2BP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 22-UNIMOD:4 ms_run[2]:scan=6176 26.34 3 2723.3377 2723.3377 F R 342 368 PSM KEPVEAAPAAEPVPAST 147 sp|Q16740|CLPP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=4771 20.9856746848 2 1662.849329 1662.846467 Q - 261 278 PSM ATGSAQGNFTGHTK 148 sp|Q9HCJ0|TNR6C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 1-UNIMOD:1 ms_run[2]:scan=4334 19.076 2 1417.6586 1417.6586 M K 2 16 PSM KAVQGGGATPVVGAVQGPVPGMPPMTQAP 149 sp|P09012|SNRPA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 25-UNIMOD:35 ms_run[2]:scan=6078 25.9 3 2714.3884 2714.3884 K R 123 152 PSM KPLVIQAMPTLIELM 150 sp|Q14974-2|IMB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 8-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=6584 28.286 2 1727.9566 1727.9566 L K 258 273 PSM KSYELPDGQVITIGNE 151 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6798 29.303 2 1761.8785 1761.8785 E R 238 254 PSM KTITLEVEPSDTIENV 152 sp|P62987|RL40_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6204 26.467 2 1786.92 1786.9200 G K 11 27 PSM KTVIPGMPTVIPPGLT 153 sp|Q15637-4|SF01_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=6256 26.702 2 1635.927 1635.9270 Q R 30 46 PSM KVPADTEVVCAPPTAYIDFA 154 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:4 ms_run[2]:scan=6723 28.954 3 2163.0558 2163.0558 A R 33 53 PSM RVGDPPQPLPEEPMEVQGAE 155 sp|P46379-4|BAG6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 14-UNIMOD:35 ms_run[2]:scan=5407 23.388 3 2190.0263 2190.0263 R R 810 830 PSM SAGSATHPGAGGR 156 sp|Q7Z7F0-4|KHDC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 1-UNIMOD:1 ms_run[2]:scan=3429 15.19 2 1166.5428 1166.5428 M R 2 15 PSM MQGEAHPSASLID 157 sp|Q96SK2-2|TM209_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 1-UNIMOD:35 ms_run[1]:scan=4955 21.716844789333333 2 1370.618169 1370.613630 - R 1 14 PSM KPLESPGGTMAPQQPEGAKPQAQAALAAP 158 sp|O15446|RPA34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 10-UNIMOD:35 ms_run[1]:scan=5476 23.576170608533335 3 2857.393876 2856.443993 M K 355 384 PSM AHQTGIHATEEL 159 sp|Q6IBS0|TWF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 1-UNIMOD:1 ms_run[2]:scan=5139 22.442 2 1347.6419 1347.6419 M K 2 14 PSM ARHVFLTGPPGVG 160 sp|Q9BSD7|NTPCR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 1-UNIMOD:1 ms_run[2]:scan=5998 25.57 2 1348.7252 1348.7252 M K 2 15 PSM KAAYPDLENPPLLVTPSQQA 161 sp|P54136-2|SYRC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6435 27.565 3 2151.1212 2151.1212 I K 17 37 PSM KDDGEDSEMQVEAPSDSSVIAQQ 162 sp|Q9P2I0|CPSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5479 23.582 3 2464.0548 2464.0548 L K 654 677 PSM KDGLNDDDFEPYLSPQA 163 sp|Q9Y5A9|YTHD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6473 27.755 2 1922.8534 1922.8534 Q R 26 43 PSM KEEETEAAIGAPPTATEGPET 164 sp|Q13263-2|TIF1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5063 22.13 3 2126.9855 2126.9855 V K 472 493 PSM KEGEEAGPGDPLLEAVP 165 sp|Q16543|CDC37_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6445 27.613 2 1706.8363 1706.8363 A K 352 369 PSM KEGVIEAGAFQGSPAPPLPSVMSPS 166 sp|P53367|ARFP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 22-UNIMOD:35 ms_run[2]:scan=6282 26.821 3 2468.2257 2468.2257 T R 57 82 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 167 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7550 32.112 3 2773.4246 2773.4246 G K 61 94 PSM KPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPV 168 sp|Q2M2I8-2|AAK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 4-UNIMOD:35 ms_run[2]:scan=5515 23.732 4 3201.6241 3201.6241 Q R 566 598 PSM KSVEQPQPPPPPPEEPGAPAPSPAAAD 169 sp|Q8NEZ4|KMT2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5121 22.374 3 2657.2973 2657.2973 D K 7 34 PSM KSYELPDGQVITIGNE 170 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6724 28.959 2 1761.8785 1761.8785 E R 238 254 PSM RVGDPPQPLPEEPMEVQGAE 171 sp|P46379-4|BAG6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5868 25.022 3 2174.0314 2174.0314 R R 810 830 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 172 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=7569 32.181955840533334 3 2774.426481 2773.424637 G K 61 94 PSM KAADPPAENSSAPEAEQGGAE 173 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=3985 17.421204895733336 3 2025.879369 2024.892307 T - 304 325 PSM PGETHSAAPGTAADLS 174 sp|Q9Y2F5|ICE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 30 ms_run[1]:scan=4443 19.5726718968 2 1480.6813 1480.6789 M R 3 19 PSM RPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYS 175 sp|P51532|SMCA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 3-UNIMOD:35,6-UNIMOD:35,10-UNIMOD:35 ms_run[1]:scan=5880 25.0729556 4 4159.964693 4159.955407 K R 208 251 PSM KSETSVANGSQSESSVSTPSASFEPNNTCENSQS 176 sp|Q92575|UBXN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 29-UNIMOD:4 ms_run[1]:scan=5109 22.320241007733333 3 3534.485053 3533.497223 L R 116 150 PSM KSLSPVDPVEPISNSEPSMNSDMG 177 sp|Q9HBM0|VEZA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 19-UNIMOD:35,23-UNIMOD:35 ms_run[1]:scan=5502 23.682069178933332 3 2551.140117 2548.130900 L K 614 638 PSM KDLLPGPVTLVME 178 sp|Q86U90|YRDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=6488 27.826 2 1426.7742 1426.7742 L R 142 155 PSM KDNTTLLTQVQTTM 179 sp|Q13561|DCTN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 14-UNIMOD:35 ms_run[2]:scan=5621 24.1 2 1608.8029 1608.8029 L R 365 379 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 180 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5183 22.617 3 2773.4246 2773.4246 G K 61 94 PSM MQIIRHSEQTL 181 sp|Q86W34-5|AMZ2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=5708 24.42 2 1412.7082 1412.7082 - K 1 12 PSM REAELESPEVMPEEEDEDDEDGGEEAPAPGGAG 182 sp|Q8IX01|SUGP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=5316 23.081 3 3457.3747 3457.3747 P K 881 914 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 183 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=7657 32.51663271413334 3 2775.429945 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 184 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=5741 24.5575592688 3 2773.433204 2773.424637 G K 61 94 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 185 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=7456 31.76365642 3 2773.425567 2773.424637 G K 61 94 PSM KTVTNAVVTVPAYFNDSQ 186 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=6238 26.616491107199998 2 1953.972786 1952.984357 G R 137 155 PSM KEEEEEEEEEEEETR 187 sp|Q7Z5L7|PODN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=3982 17.405138521066664 2 1951.785515 1951.765435 E - 599 614 PSM KEEEEEEEEEEEETR 188 sp|Q7Z5L7|PODN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=4234 18.595524603466668 2 1951.785515 1951.765435 E - 599 614 PSM ALSAETESHIY 189 sp|O14569|C56D2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5190 22.645 2 1219.5721 1219.5721 M R 2 13 PSM APPVRYCIPGE 190 sp|Q9Y3B2|EXOS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 7-UNIMOD:4 ms_run[2]:scan=5510 23.711 2 1257.6176 1257.6176 M R 2 13 PSM AYHSGYGAHGS 191 sp|O95070|YIF1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 1-UNIMOD:1 ms_run[2]:scan=4155 18.193 2 1147.4683 1147.4683 M K 2 13 PSM KAPDMSSSEEFPSFGAQVAP 192 sp|Q00341-2|VIGLN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 5-UNIMOD:35 ms_run[2]:scan=6258 26.708 3 2096.9361 2096.9361 E K 1207 1227 PSM KEITALAPSTM 193 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=4896 21.492 2 1176.606 1176.6060 Q K 315 326 PSM KMDATANDVPSPYEV 194 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 2-UNIMOD:35 ms_run[2]:scan=5539 23.802 2 1651.74 1651.7400 A R 433 448 PSM KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSD 195 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=4886 21.453 3 3365.4516 3365.4516 Q K 798 832 PSM KSLSPVDPVEPISNSEPSMNSDMG 196 sp|Q9HBM0|VEZA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 19-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=5525 23.758 3 2548.1309 2548.1309 L K 614 638 PSM MNVGVAHSEVNPNT 197 sp|Q9P0S3|ORML1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 1-UNIMOD:35 ms_run[2]:scan=4305 18.934 2 1483.6725 1483.6725 - R 1 15 PSM REQFDTLTPEPPVDPNQEVPPGPP 198 sp|Q6PKG0-3|LARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6259 26.712 3 2655.2817 2655.2817 S R 640 664 PSM SHGPKQPGAAAAPAGG 199 sp|Q9P0W2-3|HM20B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 1-UNIMOD:1 ms_run[2]:scan=3813 16.737 2 1414.6953 1414.6953 M K 2 18 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 200 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=7442 31.71200901386667 3 2775.426372 2773.424637 G K 61 94 PSM KTETAPLVVVVSTTGTGDPPDTA 201 sp|Q9UBK8|MTRR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=6227 26.567218513333334 3 2255.158058 2255.153273 L R 47 70 PSM AASTASHRPI 202 sp|Q6NXS1|IPP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 1-UNIMOD:1 ms_run[2]:scan=4299 18.908 2 1051.5411 1051.5411 M K 2 12 PSM KDVTPPPETEVVLI 203 sp|P27816-2|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6401 27.395 2 1535.8447 1535.8447 G K 518 532 PSM KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE 204 sp|P49006|MRP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4934 21.643 3 3752.6409 3752.6409 A - 157 196 PSM KVVPPSPMTDPTMLTDMM 205 sp|Q9P0I2-2|EMC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:35,13-UNIMOD:35,17-UNIMOD:35,18-UNIMOD:35 ms_run[2]:scan=5198 22.674 3 2053.908 2053.9080 R K 94 112 PSM MPDPAKSAPAP 206 sp|Q93079|H2B1H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 1-UNIMOD:35 ms_run[2]:scan=4137 18.112 2 1096.5223 1096.5223 - K 1 12 PSM PGVTVKDVNQQEFV 207 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7185 30.802 2 1558.7991 1558.7991 M R 2 16 PSM PGVTVKDVNQQEFV 208 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7280 31.137 2 1558.7991 1558.7991 M R 2 16 PSM PGVTVKDVNQQEFV 209 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=6826 29.4208576872 2 1558.8014 1558.7986 M R 2 16 PSM PGVTVKDVNQQEFV 210 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=6911 29.7614659624 2 1558.8014 1558.7986 M R 2 16 PSM PEPAKSAPAP 211 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=4254 18.6891067456 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 212 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=3667 16.294079006666667 2 963.5028 963.5020 M K 2 12 PSM PEPAKSAPAP 213 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=3787 16.639712144533334 2 963.5028 963.5020 M K 2 12 PSM PDPAKSAPAP 214 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=4735 20.845056885066665 2 949.4868 949.4864 M K 2 12 PSM KEEEEEEEEEEEETR 215 sp|Q7Z5L7|PODN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=3836 16.8364631848 2 1951.784454 1951.765435 E - 599 614 PSM ADKPDMGEIASFD 216 sp|P63313|TYB10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 6-UNIMOD:35 ms_run[2]:scan=5326 23.109 2 1410.5973 1410.5973 M K 2 15 PSM KEPPPGMFVVPDTVDMT 217 sp|Q9H832-2|UBE2Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 7-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=5888 25.103 2 1890.8743 1890.8743 Y K 5 22 PSM KLPSSSGLPAADVSPATAEEPLSPSTPT 218 sp|O43149|ZZEF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6012 25.62 3 2706.36 2706.3600 P R 1496 1524 PSM KMLLDPMGGIVMTNDGNAIL 219 sp|P49368|TCPG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 2-UNIMOD:35,7-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=6403 27.405 3 2150.0421 2150.0421 M R 48 68 PSM KSDIGEVILVGGMT 220 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 13-UNIMOD:35 ms_run[2]:scan=6364 27.219 2 1433.7436 1433.7436 S R 377 391 PSM KSYELPDGQVITIGNE 221 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6963 29.969 2 1761.8785 1761.8785 E R 238 254 PSM KTEFTQGMILPTMNGESVDPVGQPAL 222 sp|O95433-2|AHSA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 8-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=6380 27.293 3 2791.3408 2791.3408 L K 156 182 PSM MIIPVRCFTCG 223 sp|P62875|RPAB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 1-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4 ms_run[2]:scan=5974 25.479 2 1368.6352 1368.6352 - K 1 12 PSM PELAKSAPAP 224 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4431 19.521 2 979.53385 979.5338 M K 2 12 PSM PEPSKSAPAP 225 sp|Q99877|H2B1N_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3792 16.657 1 979.49746 979.4975 M K 2 12 PSM PEPTKSAPAP 226 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3850 16.89 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 227 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4014 17.544 2 993.51311 993.5131 M K 2 12 PSM PGHLQEGFGCVVTN 228 sp|Q8NC51-4|PAIRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4 ms_run[2]:scan=5533 23.781 2 1513.6984 1513.6984 M R 2 16 PSM PGVTVKDVNQQEFV 229 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7389 31.531 2 1558.7991 1558.7991 M R 2 16 PSM SGDHLHNDSQIEADF 230 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 1-UNIMOD:1 ms_run[2]:scan=5840 24.922 2 1725.7231 1725.7231 M R 2 17 PSM VMEKPSPLLVG 231 sp|Q13283-2|G3BP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 2-UNIMOD:35 ms_run[2]:scan=5453 23.514 2 1184.6475 1184.6475 M R 2 13 PSM VMEKPSPLLVG 232 sp|Q13283-2|G3BP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5739 24.553 2 1168.6526 1168.6526 M R 2 13 PSM SPAAAAAGAGER 233 sp|Q96HA1|P121A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=3557 15.778055413599999 2 1027.5075 1027.5041 M R 2 14 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 234 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=7705 32.69860654746667 3 2775.431404 2773.424637 G K 61 94 PSM PGVTVKDVNQQEFV 235 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=7001 30.127938289600003 2 1558.8014 1558.7986 M R 2 16 PSM PGVTVKDVNQQEFV 236 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=6739 29.032918660266667 2 1558.8014 1558.7986 M R 2 16 PSM PEPAKSAPAP 237 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=5028 21.99933044906667 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 238 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=5349 23.183272533866667 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 239 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=5125 22.388082304 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 240 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4001 17.488502502133333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 241 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=6760 29.134605624000002 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 242 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4430 19.517055431466666 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 243 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4344 19.1201769776 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 244 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4090 17.903354020266665 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 245 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=5809 24.79643875733333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 246 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=6443 27.602726201333333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 247 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4829 21.2201397672 2 963.5023 963.5020 M K 2 12 PSM PDPAKSAPAP 248 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=3936 17.249206235733332 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 249 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4332 19.065477385333335 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 250 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4122 18.039434004266663 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 251 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4632 20.4330096608 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 252 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=3839 16.845475505866666 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 253 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4035 17.64542043146667 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 254 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=6254 26.694709346133333 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 255 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=4420 19.468168434400003 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 256 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 26 ms_run[1]:scan=6347 27.13651261013333 2 949.4867 949.4864 M K 2 12 PSM KEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLP 257 sp|Q9BSV6|SEN34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=5318 23.089900154400002 4 3312.458200 3312.450196 A R 146 180 PSM KPLESPGGTMAPQQPEGAKPQAQAALAAP 258 sp|O15446|RPA34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=5714 24.447234851466664 3 2841.399423 2840.449078 M K 355 384 PSM KDSTQTPAVTPQSQPATTDSTVTVQ 259 sp|P23786|CPT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4895 21.49 3 2587.2613 2587.2613 F K 389 414 PSM KEDGSEVGVGGAQVTGSNT 260 sp|Q13618-3|CUL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4592 20.259 2 1790.8282 1790.8282 K R 503 522 PSM KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA 261 sp|P49006|MRP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5280 22.963 3 3176.4382 3176.4382 P K 43 77 PSM KLDEDEDEDDADLS 262 sp|O95218-2|ZRAB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4676 20.602 2 1607.6322 1607.6322 Y K 168 182 PSM MGPERHLSGAPA 263 sp|Q16626|MEA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=4492 19.8 2 1279.5979 1279.5979 - R 1 13 PSM MHRDSCPLDC 264 sp|P84103-2|SRSF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4 ms_run[2]:scan=4380 19.275 2 1347.5006 1347.5006 - K 1 11 PSM PELAKSAPAP 265 sp|Q99880|H2B1L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4566 20.127 2 979.53385 979.5338 M K 2 12 PSM PEPSKSAPAP 266 sp|Q99877|H2B1N_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3773 16.605 2 979.49746 979.4975 M K 2 12 PSM PEPSKSAPAP 267 sp|Q99877|H2B1N_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3744 16.534 1 979.49746 979.4975 M K 2 12 PSM PEPTKSAPAP 268 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3732 16.51 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 269 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4058 17.751 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 270 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4489 19.784 2 993.51311 993.5131 M K 2 12 PSM PGVTVKDVNQQEFV 271 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5808 24.792 2 1558.7991 1558.7991 M R 2 16 PSM PEPAKSAPAP 272 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6844 29.496563657866666 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 273 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6093 25.966056125066665 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 274 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6608 28.398960426133332 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 275 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4177 18.30001144906667 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 276 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6182 26.3647282624 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 277 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6682 28.7524226272 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 278 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=7137 30.641278699466667 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 279 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6357 27.18154356746667 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 280 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=5226 22.771293938933333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 281 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4730 20.8218715912 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 282 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4630 20.422878521333335 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 283 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=5905 25.168522065066668 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 284 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=7235 30.9759326416 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 285 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4541 20.012689740533336 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 286 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6931 29.842446631466665 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 287 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=7018 30.201713008000002 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 288 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6269 26.758869383999997 2 963.5023 963.5020 M K 2 12 PSM PDPAKSAPAP 289 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4244 18.642271898666667 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 290 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6434 27.559203781333334 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 291 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=5185 22.626009814133333 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 292 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6847 29.5088591704 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 293 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=5748 24.58524432 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 294 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6689 28.78607861413333 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 295 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6764 29.152301332533334 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 296 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6609 28.404314575733334 2 949.4867 949.4864 M K 2 12 PSM PDPSKSAPAP 297 sp|Q8N257|H2B3B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=3964 17.344782441866666 1 965.4782 965.4813 M K 2 12 PSM KGPSVGEVVPNVGPPEGAVTCETPTP 298 sp|Q9BWH6|RPAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 21-UNIMOD:4 ms_run[1]:scan=6049 25.764486436533332 3 2576.270088 2574.263569 A R 165 191 PSM AAAGAAATHLEVA 299 sp|Q96S52|PIGS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=4940 21.658166074666667 2 1151.5965 1151.5930 M R 2 15 PSM GCCSSASSAAQSSK 300 sp|Q8WWI5-3|CTL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 2-UNIMOD:4,3-UNIMOD:4 ms_run[2]:scan=3330 14.755 2 1386.5504 1386.5504 M R 2 16 PSM KAPLATGEDDDDEVPDLVENFDEAS 301 sp|P20290-2|BTF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6779 29.223 3 2690.1719 2690.1719 G K 133 158 PSM KDLFDPIIED 302 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6693 28.808 2 1203.6023 1203.6023 F R 86 96 PSM KELLLPQDAGGPTSLGGGAGGPLLAE 303 sp|Q96DT7-2|ZBT10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6651 28.609 3 2417.2802 2417.2802 A R 92 118 PSM KEPELLEPIPYEFMA 304 sp|P46778|RL21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 14-UNIMOD:35 ms_run[2]:scan=6929 29.835 2 1820.8906 1820.8906 G - 146 161 PSM MVVEHPEFL 305 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 1-UNIMOD:35 ms_run[2]:scan=5938 25.325 2 1115.5321 1115.5321 - K 1 10 PSM PDPAKSAPAP 306 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7413 31.619 2 949.4869 949.4869 M K 2 12 PSM PDPAKSAPAP 307 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7601 32.302 2 949.4869 949.4869 M K 2 12 PSM PEINTNHLD 308 sp|Q13907|IDI1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4695 20.683 2 1051.4934 1051.4934 M K 2 11 PSM PEPSKSAPAP 309 sp|Q99877|H2B1N_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3655 16.242 2 979.49746 979.4975 M K 2 12 PSM PEPTKSAPAP 310 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4257 18.702 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 311 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4278 18.81 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 312 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4503 19.852 2 993.51311 993.5131 M K 2 12 PSM PEPAKSAPAP 313 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5582 23.94894678853333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 314 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5997 25.56500652453333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 315 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=7423 31.650313514666667 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 316 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=7330 31.312461572 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 317 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=6532 28.035692072266666 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 318 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=7863 33.3381399152 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 319 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=4927 21.609218448533333 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 320 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5471 23.563780385866668 2 963.5023 963.5020 M K 2 12 PSM PEPAKSAPAP 321 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5707 24.4172477344 2 963.5023 963.5020 M K 2 12 PSM PDPAKSAPAP 322 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5951 25.3828494504 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 323 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5080 22.198608894133333 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 324 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=4978 21.808294289333332 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 325 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=4536 19.993677247999997 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 326 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=5855 24.974343845866667 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 327 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=6152 26.231233275466664 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 328 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=7227 30.948791175199997 2 949.4869 949.4864 M K 2 12 PSM PDPSKSAPAP 329 sp|Q8N257|H2B3B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=3938 17.255966531733336 1 965.4782 965.4813 M K 2 12 PSM EIVHIQAGQCGNQIGA 330 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 10-UNIMOD:4 ms_run[1]:scan=5366 23.25072065866667 2 1693.8231 1693.8201 R K 3 19 PSM KQQIADLREDL 331 sp|Q9HC77|CENPJ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=6300 26.909980833866666 2 1327.725334 1327.709579 L K 1000 1011 PSM KTAENATSGETLEENEAGD 332 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=4526 19.9543191216 2 1965.831775 1964.844688 S - 376 395 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 333 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=5464 23.542916162666664 2 2773.423274 2773.424637 G K 61 94 PSM KDLYANTVLSGGTTMYPGIAD 334 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 15-UNIMOD:35 ms_run[2]:scan=6263 26.734 3 2202.0514 2202.0515 R R 291 312 PSM KDMEDPTPVPNIEEVVLP 335 sp|Q92922|SMRC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35 ms_run[2]:scan=6887 29.664 2 2036.9976 2036.9976 T K 369 387 PSM KGEDPFTSETVDPEMEGDDNLGGED 336 sp|O43823|AKAP8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6204 26.467 3 2682.0763 2682.0763 L K 541 566 PSM MDFQHRPGG 337 sp|Q15428|SF3A2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=4386 19.303 2 1101.4662 1101.4662 - K 1 10 PSM PDPAKSAPAP 338 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 1-UNIMOD:1 ms_run[2]:scan=4562 20.107 2 991.49746 991.4975 M K 2 12 PSM PDPSKSAPAP 339 sp|Q8N257|H2B3B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=3806 16.709 2 965.48181 965.4818 M K 2 12 PSM PDYLGADQR 340 sp|P35998|PRS7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4738 20.857 2 1033.4829 1033.4829 M K 2 11 PSM PEPTKSAPAP 341 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4105 17.961 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 342 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4623 20.395 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 343 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4779 21.023 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 344 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6362 27.208 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 345 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6549 28.118 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 346 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6778 29.218 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 347 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6859 29.554 2 993.51311 993.5131 M K 2 12 PSM PGVTVKDVNQQEFV 348 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7092 30.464 2 1558.7991 1558.7991 M R 2 16 PSM PVAGSELPR 349 sp|P04818-3|TYSY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4552 20.06 2 924.50288 924.5029 M R 2 11 PSM PYQYPALTPEQK 350 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5451 23.51 2 1433.7191 1433.7191 M K 2 14 PSM SGLHLVKQG 351 sp|Q13085-3|ACACA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 1-UNIMOD:1 ms_run[2]:scan=5112 22.33 2 979.54508 979.5451 M R 2 11 PSM TGYTPDEKL 352 sp|O95139-2|NDUB6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4961 21.74 2 1022.492 1022.4920 M R 2 11 PSM VMAEGTAVLR 353 sp|Q9Y3A3-3|PHOCN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 2-UNIMOD:35 ms_run[2]:scan=4643 20.478 2 1061.5539 1061.5539 M R 2 12 PSM KEELQANGSAPAAD 354 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=4140 18.12711278453333 2 1400.648364 1399.657937 A K 55 69 PSM KAAYPDLENPPLLVTPSQQA 355 sp|P54136|SYRC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6403 27.40533372186667 3 2151.125748 2151.121185 I K 89 109 PSM PEPAKSAPAP 356 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=7607 32.32462568213334 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 357 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=7516 31.987242710133334 2 963.5030 963.5020 M K 2 12 PSM PEPAKSAPAP 358 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=7695 32.66234836986667 2 963.5030 963.5020 M K 2 12 PSM PDPAKSAPAP 359 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=3862 16.935433143733334 2 949.4830 949.4864 M K 2 12 PSM PDPAKSAPAP 360 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=5338 23.144024984 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 361 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=7058 30.3407077512 2 949.4869 949.4864 M K 2 12 PSM KADPDCSNGQPQAAPTPGAPQN 362 sp|Q9BW85|YJU2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 6-UNIMOD:4 ms_run[1]:scan=4171 18.270826345333333 3 2220.972762 2219.986559 A R 270 292 PSM ALSTIVSQR 363 sp|Q5EE01|CENPW_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=4950 21.694384613066667 2 973.5580 973.5551 M K 2 11 PSM KLNMDQVLDQIL 364 sp|Q6PIJ6|FBX38_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6267 26.751111096 2 1428.762920 1428.764651 K R 980 992 PSM KDMDEPSPVPNVEEVTLP 365 sp|Q8TAQ2-2|SMRC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 3-UNIMOD:35 ms_run[2]:scan=6458 27.678 2 2010.9456 2010.9456 T K 341 359 PSM KDSTLIMQLL 366 sp|P31946|1433B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=6917 29.787 2 1176.6424 1176.6424 Y R 214 224 PSM MLSTEGREGFVV 367 sp|P55795|HNRH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:35 ms_run[2]:scan=5767 24.652 2 1339.6442 1339.6442 M K 2 14 PSM MNDTVTIRT 368 sp|P62847-2|RS24_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:35 ms_run[2]:scan=4665 20.557 2 1065.5125 1065.5125 - R 1 10 PSM MQIFVKTLTG 369 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:35 ms_run[2]:scan=5743 24.561 2 1152.6213 1152.6213 - K 1 11 PSM MQLTVKALQG 370 sp|P11441|UBL4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:35 ms_run[2]:scan=5277 22.958 2 1103.6009 1103.6009 - R 1 11 PSM PDPAKSAPAP 371 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7508 31.958 2 949.4869 949.4869 M K 2 12 PSM PEPAKSAPAP 372 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3399 15.068 2 963.50255 963.5025 M K 2 12 PSM PEPTKSAPAP 373 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4191 18.378 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 374 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4400 19.372 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 375 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6231 26.588 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 376 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6461 27.694 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 377 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6945 29.901 2 993.51311 993.5131 M K 2 12 PSM PGVTVKDVNQQEFV 378 sp|P39019|RS19_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7599 32.295 2 1558.7991 1558.7991 M R 2 16 PSM RLDVTLGPVPEIGGSEAPAPQN 379 sp|Q99848|EBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6439 27.585 3 2216.1437 2216.1437 E K 69 91 PSM RVAAAPDEDLDGDDEDDAEDENNIDN 380 sp|Q9BXV9|GON7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5128 22.402 3 2831.1125 2831.1125 H R 59 85 PSM SHLPMKLL 381 sp|Q9NVP1|DDX18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:1,5-UNIMOD:35 ms_run[2]:scan=5795 24.75 2 995.54739 995.5474 M R 2 10 PSM SKAHPPEL 382 sp|P62308|RUXG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:1 ms_run[2]:scan=4805 21.141 2 919.47633 919.4763 M K 2 10 PSM KAAVPAPPPEPEGQD 383 sp|Q96IK1|BOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 ms_run[1]:scan=4579 20.19301963626667 2 1501.7387 1501.7407 K P 162 177 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 384 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7728 32.781695468533336 3 2774.428998 2773.424637 G K 61 94 PSM GVTVKDVNQQEFV 385 sp|P39019|RS19_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 ms_run[1]:scan=5575 23.93584682 2 1461.7362 1461.7458 P R 3 16 PSM KNAVITVPAYFNDSQ 386 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6393 27.357521538666667 2 1666.824017 1665.836236 A R 187 202 PSM EIVHIQAGQCGNQIGA 387 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 10-UNIMOD:4 ms_run[1]:scan=5379 23.290196779733332 2 1693.8231 1693.8201 R K 3 19 PSM KAENNSEVGASGYGVPGPTWD 388 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6073 25.873281560000002 2 2134.946878 2133.960327 L R 120 141 PSM AVSHSVKE 389 sp|Q969L4|LSM10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 1-UNIMOD:1 ms_run[2]:scan=3827 16.794 2 897.4556 897.4556 M R 2 10 PSM KPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLP 390 sp|O94826|TOM70_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6221 26.543 3 2731.4141 2731.4141 S R 5 38 PSM KTVAPVVTQAAPPTPTPPVPPA 391 sp|Q70E73|RAPH1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5712 24.439 3 2135.199 2135.1990 T K 792 814 PSM MQIFVKTLTG 392 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6249 26.668 2 1136.6264 1136.6264 - K 1 11 PSM MVSHSELR 393 sp|P78330|SERB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=4196 18.405 2 1015.4757 1015.4757 - K 1 9 PSM PEPSKSAPAP 394 sp|Q99877|H2B1N_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4037 17.652 2 979.49746 979.4975 M K 2 12 PSM PYQYPALTPEQK 395 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7386 31.521 2 1433.7191 1433.7191 M K 2 14 PSM SHLPMKLL 396 sp|Q9NVP1|DDX18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 1-UNIMOD:1 ms_run[2]:scan=6429 27.536 2 979.55247 979.5525 M R 2 10 PSM TAIKHALQ 397 sp|Q9NV70-2|EXOC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 1-UNIMOD:1 ms_run[2]:scan=5024 21.988 2 922.52362 922.5236 M R 2 10 PSM PYQYPALTPEQK 398 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=7251 31.0332572264 2 1434.7212 1433.7182 M K 2 14 PSM KAAYPDLENPPLLVTPSQQA 399 sp|P54136|SYRC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=6364 27.218545427200002 3 2151.125748 2151.121185 I K 89 109 PSM PDPAKSAPAP 400 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=4844 21.2859979224 2 949.4868 949.4864 M K 2 12 PSM PDPAKSAPAP 401 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=7322 31.2851973144 2 949.4869 949.4864 M K 2 12 PSM PDPAKSAPAP 402 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 21 ms_run[1]:scan=6935 29.860602678933333 2 949.4867 949.4864 M K 2 12 PSM KMATSQADIETDPGISEPDGATAQTSADGSQAQNLES 403 sp|Q9Y5V3|MAGD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 2-UNIMOD:35 ms_run[1]:scan=5346 23.173374907733333 4 3736.658869 3736.649367 A R 204 241 PSM MQLTVKALQG 404 sp|P11441|UBL4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=5798 24.757509858933336 2 1087.606577 1087.605965 - R 1 11 PSM KLGDEDEEIDGDTN 405 sp|P09884|DPOLA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4636 20.454424086933333 2 1549.657575 1548.642741 Q K 815 829 PSM KEPAPPNGSAAEPPTEAAS 406 sp|O75781|PALM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4468 19.691264766933333 2 1820.846411 1819.858822 P R 338 357 PSM KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM 407 sp|P23246|SFPQ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35 ms_run[1]:scan=6183 26.370082422666666 3 3230.404828 3230.402859 Q R 630 663 PSM KDPPPPGTQGVVYFADDDNTYS 408 sp|O94766-2|B3GA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6144 26.194 3 2382.0652 2382.0652 E R 179 201 PSM KGVVPLAGTDGETTTQGLDGLSE 409 sp|P09972|ALDOC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6207 26.483 3 2244.1121 2244.1121 D R 111 134 PSM KPLPPAPAPDEYLVSPITGE 410 sp|Q15459-2|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6577 28.252 3 2090.0936 2090.0936 S K 334 354 PSM KSGDAAIVDMVPG 411 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:35 ms_run[2]:scan=5116 22.349 2 1274.6177 1274.6177 L K 395 408 PSM KTVIPGMPTVIPPGLT 412 sp|Q15637-4|SF01_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6810 29.358 2 1619.9321 1619.9321 Q R 30 46 PSM MDFQHRPGG 413 sp|Q15428|SF3A2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:1 ms_run[2]:scan=5202 22.682 2 1085.4713 1085.4713 - K 1 10 PSM MDHHVSTI 414 sp|Q7L5Y6|DET1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=4409 19.416 2 996.43348 996.4335 - K 1 9 PSM MKPDETPMFDPSLL 415 sp|Q96EK6|GNA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=6491 27.842 2 1651.7473 1651.7473 - K 1 15 PSM MLEAIDKN 416 sp|O75970-5|MPDZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:35 ms_run[2]:scan=4210 18.478 2 948.45863 948.4586 - R 1 9 PSM MTMDKSELVQ 417 sp|P31946|1433B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:35,3-UNIMOD:35 ms_run[2]:scan=4120 18.033 2 1212.5366 1212.5366 - K 1 11 PSM PDPAKSAPAP 418 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=3435 15.204 2 949.4869 949.4869 M K 2 12 PSM PDPAKSAPAP 419 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7859 33.322 2 949.4869 949.4869 M K 2 12 PSM REPILSSEPSPAVTPVTPTTLIAP 420 sp|O60749|SNX2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6637 28.544 3 2472.3476 2472.3476 E R 88 112 PSM SKAHPPEL 421 sp|P62308|RUXG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:1 ms_run[2]:scan=4707 20.718 2 919.47633 919.4763 M K 2 10 PSM PEPAKSAPAP 422 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=3882 17.026545111466667 2 963.5028 963.5020 M K 2 12 PSM PDPAKSAPAP 423 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=6524 27.995973508266665 2 949.4867 949.4864 M K 2 12 PSM PDPAKSAPAP 424 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=7129 30.61368923066667 2 949.4869 949.4864 M K 2 12 PSM PDPAKSAPAP 425 sp|Q93079|H2B1H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=6054 25.788827968 2 949.4867 949.4864 M K 2 12 PSM PEPSKSAPAP 426 sp|P33778|H2B1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=4566 20.127355449866666 2 979.4999 979.4969 M K 2 12 PSM VLNSLDKMIQLQ 427 sp|Q7Z2Z2|EFL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 8-UNIMOD:35 ms_run[1]:scan=5822 24.85120919786667 2 1416.7362 1416.7642 M K 2 14 PSM KETTLQAPQPPQAPQPLQP 428 sp|Q8NEY8-3|PPHLN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=5721 24.4759513288 3 2069.101462 2068.095304 M R 346 365 PSM KEAQPELQEPQPAAPGTPGGFSEVMGSALA 429 sp|Q6P1R4|DUS1L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 25-UNIMOD:35 ms_run[1]:scan=6150 26.220589604266667 3 3010.451110 3009.438967 W - 444 474 PSM AHQTGIHATEEL 430 sp|Q6IBS0|TWF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 1-UNIMOD:1 ms_run[2]:scan=5160 22.518 2 1347.6419 1347.6419 M K 2 14 PSM APEVLPKP 431 sp|P09669|COX6C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5043 22.064 2 849.496 849.4960 M R 2 10 PSM KEGPYDVVVLPGGNLGAQNLSESAAV 432 sp|Q99497|PARK7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6672 28.706 3 2583.318 2583.3180 K K 63 89 PSM KEGTLTQVPLAPPPPGAPPSPAPA 433 sp|P48634|PRC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5967 25.457 3 2289.2369 2289.2369 P R 1128 1152 PSM KIDTIEIITD 434 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6081 25.913 2 1159.6336 1159.6336 G R 125 135 PSM KIESDVQEPTEPEDDLDIMLGN 435 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 19-UNIMOD:35 ms_run[2]:scan=6265 26.744 3 2502.1319 2502.1319 L K 102 124 PSM KTSPAVTALAVSRNHT 436 sp|Q6ZS81|WDFY4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6351 27.158 2 1651.9006 1651.9006 S K 3151 3167 PSM PEPTKSAPAP 437 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3419 15.144 2 993.51311 993.5131 M K 2 12 PSM PEPTKSAPAP 438 sp|P58876|H2B1D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5604 24.038 2 993.51311 993.5131 M K 2 12 PSM PYQYPALTPEQK 439 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7074 30.395 2 1433.7191 1433.7191 M K 2 14 PSM RVAAPVGPVGPTPTVLPMGAPVP 440 sp|Q13435|SF3B2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 18-UNIMOD:35 ms_run[2]:scan=6348 27.142 3 2195.2136 2195.2136 P R 222 245 PSM SKAHPPEL 441 sp|P62308|RUXG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 1-UNIMOD:1 ms_run[2]:scan=4892 21.482 2 919.47633 919.4763 M K 2 10 PSM KLVQDVANNTNEEAGDGTTTATVLA 442 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=5574 23.933563489866668 3 2532.224918 2531.235105 A R 96 121 PSM KLVQNGTEPSSLPFLDPNA 443 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=6722 28.948567144 2 2027.025361 2026.037121 G R 137 156 PSM KMLAPDPDPNGELLPGSPNPEEPI 444 sp|P36021|MOT8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:35 ms_run[1]:scan=6335 27.075463076800002 3 2542.229692 2542.226121 D - 516 540 PSM QPPQIAPK 445 sp|Q04637-5|IF4G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=4104 17.956122488000002 2 877.5019 877.5016 N R 3 11 PSM YMFQYDSTHG 446 sp|P04406-2|G3P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 2-UNIMOD:35 ms_run[1]:scan=5229 22.786181422933332 2 1263.4872 1263.4861 V K 3 13 PSM RTAPTSTIAPGVVMASSPALPTQPAEEAA 447 sp|P16220|CREB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 14-UNIMOD:35 ms_run[1]:scan=5888 25.103484660533336 3 2836.433715 2836.427674 I R 241 270 PSM AEKFDCHYC 448 sp|Q13642-3|FHL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4 ms_run[2]:scan=5095 22.265 2 1270.4747 1270.4747 M R 2 11 PSM GSQEVLGHAA 449 sp|Q96AA3|RFT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4507 19.869 2 967.47231 967.4723 M R 2 12 PSM KDGEVPPEEFSTFI 450 sp|Q96AY3-2|FKB10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6831 29.443 2 1593.7563 1593.7563 N K 286 300 PSM KDGTSPEEEIEIE 451 sp|Q9H501|ESF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5546 23.826 2 1474.6675 1474.6675 A R 690 703 PSM KDNPGVVTCLDEA 452 sp|P22314-2|UBA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 9-UNIMOD:4 ms_run[2]:scan=5425 23.433 2 1416.6555 1416.6555 T R 186 199 PSM KEEPADFPVEQPEEN 453 sp|Q5BKZ1-3|ZN326_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5241 22.829 2 1756.7792 1756.7792 A - 362 377 PSM KTVIPGMPTVIPPGLT 454 sp|Q15637-4|SF01_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 7-UNIMOD:35 ms_run[2]:scan=6363 27.213 2 1635.927 1635.9270 Q R 30 46 PSM PFLDIQK 455 sp|O43920|NDUS5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5698 24.387 2 859.48035 859.4804 M R 2 9 PSM RAPESPPSADPALVAGPAEEAECPPP 456 sp|Q6EEV4-2|GL1AD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 23-UNIMOD:4 ms_run[2]:scan=5777 24.686 3 2611.2224 2611.2224 A R 6 32 PSM RLAEAPSPAPTPSPTPVEDLGPQTSTSPG 457 sp|Q14160-2|SCRIB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5711 24.434 3 2856.4141 2856.4141 E R 1454 1483 PSM SHTEVKL 458 sp|Q5JUR7-2|TEX30_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 1-UNIMOD:1 ms_run[2]:scan=4903 21.518 2 854.44978 854.4498 M K 2 9 PSM SILKIHA 459 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 1-UNIMOD:1 ms_run[2]:scan=5995 25.56 2 822.49634 822.4963 M R 2 9 PSM PEVLPKP 460 sp|P09669|COX6C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=4969 21.7760048152 2 778.4595 778.4584 A R 3 10 PSM PEVLPKP 461 sp|P09669|COX6C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=4872 21.401505435999997 2 778.4595 778.4584 A R 3 10 PSM REPFDLGEPEQSNGGFPCTTAP 462 sp|Q99961|SH3G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 18-UNIMOD:4 ms_run[1]:scan=6494 27.857812057333334 3 2406.047745 2405.059390 P K 260 282 PSM KIEILAPPNGSVPGD 463 sp|Q12904|AIMP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=6019 25.6479017784 2 1506.7902 1505.8082 E R 235 250 PSM RSLPAGGPAP 464 sp|Q9NZU7|CABP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=3776 16.609597782666665 2 921.488496 921.503215 P R 31 41 PSM KSQDVQRESEPL 465 sp|Q9UNY4|TTF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5744 24.56467161813333 2 1415.689866 1414.705222 G R 243 255