MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-3 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F20.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172207832815^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q14669-4|TRIPC_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	64.0	null	89-UNIMOD:35,102-UNIMOD:35	0.02	64.0	1	1	1
PRT	sp|Q92598-3|HS105_HUMAN	Isoform 3 of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.08	61.0	3	3	3
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	60.0	null		0.21	60.0	5	3	2
PRT	sp|P28702|RXRB_HUMAN	Retinoic acid receptor RXR-beta OS=Homo sapiens OX=9606 GN=RXRB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null	340-UNIMOD:4	0.06	59.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.04	58.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	354-UNIMOD:35,420-UNIMOD:35,154-UNIMOD:35	0.20	56.0	7	4	2
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.07	56.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.07	55.0	1	1	1
PRT	sp|Q15542-2|TAF5_HUMAN	Isoform Short of Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.05	55.0	1	1	1
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	1407-UNIMOD:35	0.01	52.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	52.0	null		0.14	52.0	3	3	3
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	552-UNIMOD:4	0.03	51.0	2	2	2
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.07	51.0	8	1	0
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	144-UNIMOD:4	0.07	51.0	1	1	1
PRT	sp|Q86WB0-3|NIPA_HUMAN	Isoform 3 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.06	50.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.07	50.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	50.0	null		0.12	50.0	11	4	3
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.12	49.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	558-UNIMOD:35,568-UNIMOD:35,572-UNIMOD:35,561-UNIMOD:35,564-UNIMOD:35,495-UNIMOD:35,506-UNIMOD:35,513-UNIMOD:35,190-UNIMOD:35	0.20	49.0	18	6	2
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	134-UNIMOD:4	0.45	49.0	5	3	2
PRT	sp|Q9BZE9-4|ASPC1_HUMAN	Isoform 4 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.09	49.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	365-UNIMOD:4,1294-UNIMOD:4,1302-UNIMOD:4	0.05	49.0	4	4	4
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	523-UNIMOD:4	0.05	49.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.14	48.0	3	3	2
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.30	48.0	7	5	3
PRT	sp|Q9H9B1-4|EHMT1_HUMAN	Isoform 4 of Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	32-UNIMOD:35	0.08	48.0	4	3	2
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|O43251-6|RFOX2_HUMAN	Isoform 6 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	1	1	1
PRT	sp|Q7L2E3-2|DHX30_HUMAN	Isoform 2 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	55-UNIMOD:35	0.02	47.0	2	1	0
PRT	sp|Q9H467|CUED2_HUMAN	CUE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CUEDC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.08	47.0	1	1	1
PRT	sp|Q9H0W5|CCDC8_HUMAN	Coiled-coil domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CCDC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	162-UNIMOD:4	0.07	47.0	3	2	1
PRT	sp|Q9NVU0-2|RPC5_HUMAN	Isoform 2 of DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	2	1	0
PRT	sp|Q96DX4-2|RSPRY_HUMAN	Isoform 2 of RING finger and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSPRY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.24	47.0	1	1	1
PRT	sp|P08621-2|RU17_HUMAN	Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	307-UNIMOD:35,404-UNIMOD:35,406-UNIMOD:35,423-UNIMOD:35	0.18	47.0	3	3	2
PRT	sp|Q8TF71|MOT10_HUMAN	Monocarboxylate transporter 10 OS=Homo sapiens OX=9606 GN=SLC16A10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.07	47.0	1	1	1
PRT	sp|P46937-4|YAP1_HUMAN	Isoform 4 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	245-UNIMOD:35,117-UNIMOD:35,128-UNIMOD:35	0.18	47.0	2	2	2
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null	78-UNIMOD:4,101-UNIMOD:35	0.05	47.0	3	2	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.14	46.0	2	2	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.01	46.0	3	3	3
PRT	sp|Q12948|FOXC1_HUMAN	Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.09	46.0	2	2	2
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9Y6M4-6|KC1G3_HUMAN	Isoform 6 of Casein kinase I isoform gamma-3 OS=Homo sapiens OX=9606 GN=CSNK1G3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	2	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	101-UNIMOD:4	0.09	46.0	1	1	1
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	2	2	2
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	3794-UNIMOD:35,643-UNIMOD:35	0.01	46.0	3	3	3
PRT	sp|P18583-8|SON_HUMAN	Isoform H of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	355-UNIMOD:35,266-UNIMOD:35,272-UNIMOD:35	0.05	46.0	3	2	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	1202-UNIMOD:4	0.02	46.0	1	1	1
PRT	sp|Q86YR5-2|GPSM1_HUMAN	Isoform 2 of G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	161-UNIMOD:4	0.17	46.0	1	1	1
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	275-UNIMOD:4	0.07	45.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	156-UNIMOD:4	0.04	45.0	2	2	2
PRT	sp|Q6FIF0-2|ZFAN6_HUMAN	Isoform 2 of AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.13	45.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|O75781-2|PALM_HUMAN	Isoform 2 of Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.10	45.0	1	1	1
PRT	sp|O75822-3|EIF3J_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	99-UNIMOD:35	0.10	45.0	1	1	1
PRT	sp|Q92908-2|GATA6_HUMAN	Isoform 2 of Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	400-UNIMOD:35	0.08	45.0	1	1	1
PRT	sp|Q92734-2|TFG_HUMAN	Isoform 2 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	367-UNIMOD:35	0.12	45.0	2	2	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	24-UNIMOD:35	0.20	45.0	5	4	3
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	646-UNIMOD:35	0.03	45.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	1088-UNIMOD:35	0.04	45.0	3	2	1
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	2	2	2
PRT	sp|Q9C0C7-4|AMRA1_HUMAN	Isoform 4 of Activating molecule in BECN1-regulated autophagy protein 1 OS=Homo sapiens OX=9606 GN=AMBRA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|Q9NRL3|STRN4_HUMAN	Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	132-UNIMOD:4	0.20	45.0	1	1	1
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	182-UNIMOD:35	0.06	45.0	1	1	0
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	2	2	2
PRT	sp|Q14493-2|SLBP_HUMAN	Isoform 2 of Histone RNA hairpin-binding protein OS=Homo sapiens OX=9606 GN=SLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	82-UNIMOD:35,97-UNIMOD:35	0.09	44.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	947-UNIMOD:35	0.03	44.0	2	2	2
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1179-UNIMOD:35	0.01	44.0	2	1	0
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	364-UNIMOD:4,544-UNIMOD:35	0.09	44.0	3	3	3
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	23-UNIMOD:4,31-UNIMOD:35	0.10	44.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.09	44.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	1	1	0
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	209-UNIMOD:4,678-UNIMOD:35,691-UNIMOD:4	0.05	44.0	3	2	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	233-UNIMOD:35,237-UNIMOD:4	0.04	44.0	2	2	2
PRT	sp|Q9UBF2|COPG2_HUMAN	Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	723-UNIMOD:4,725-UNIMOD:35,583-UNIMOD:35	0.04	44.0	4	2	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	165-UNIMOD:35,169-UNIMOD:35,357-UNIMOD:4,97-UNIMOD:35,94-UNIMOD:35	0.15	43.0	18	4	2
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	3	2	1
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	239-UNIMOD:35,254-UNIMOD:4	0.10	43.0	2	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	527-UNIMOD:35,299-UNIMOD:35,1474-UNIMOD:35	0.04	43.0	6	4	2
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	45-UNIMOD:4	0.17	43.0	2	1	0
PRT	sp|Q9Y6M1-5|IF2B2_HUMAN	Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.01	43.0	2	1	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	434-UNIMOD:35	0.03	43.0	6	3	1
PRT	sp|Q86T24|KAISO_HUMAN	Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	2	2	2
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	67-UNIMOD:35,68-UNIMOD:35,72-UNIMOD:35	0.04	43.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	563-UNIMOD:4,569-UNIMOD:4,572-UNIMOD:35	0.05	43.0	1	1	1
PRT	sp|Q9NXH9-2|TRM1_HUMAN	Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	610-UNIMOD:4	0.05	43.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	305-UNIMOD:35	0.06	43.0	4	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	241-UNIMOD:4	0.13	43.0	4	3	2
PRT	sp|O75970|MPDZ_HUMAN	Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.01	43.0	2	1	0
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|O15381-3|NVL_HUMAN	Isoform 3 of Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	429-UNIMOD:4	0.08	42.0	5	3	2
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	1	1	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	134-UNIMOD:35	0.13	42.0	2	2	2
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	20-UNIMOD:35	0.05	42.0	2	1	0
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	84-UNIMOD:4	0.07	42.0	1	1	1
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q13099-3|IFT88_HUMAN	Isoform 3 of Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	164-UNIMOD:35,166-UNIMOD:35	0.07	42.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	42-UNIMOD:4	0.22	42.0	5	3	2
PRT	sp|Q13601|KRR1_HUMAN	KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	2	1	0
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1037-UNIMOD:35	0.02	42.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.09	42.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1280-UNIMOD:35	0.04	42.0	2	2	2
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q9H0B6-2|KLC2_HUMAN	Isoform 2 of Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	2	2	2
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	368-UNIMOD:35,377-UNIMOD:35	0.12	42.0	3	3	3
PRT	sp|Q96DF8|ESS2_HUMAN	Splicing factor ESS-2 homolog OS=Homo sapiens OX=9606 GN=ESS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q96AY3-2|FKB10_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	219-UNIMOD:35,220-UNIMOD:4	0.05	42.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	162-UNIMOD:35,242-UNIMOD:35,230-UNIMOD:35,121-UNIMOD:35	0.12	42.0	5	4	2
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.12	42.0	1	1	0
PRT	sp|Q86W50|MET16_HUMAN	RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	448-UNIMOD:4	0.06	42.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.08	42.0	6	2	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	863-UNIMOD:35,867-UNIMOD:4	0.04	42.0	3	2	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.10	42.0	7	2	0
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1211-UNIMOD:35	0.03	41.0	3	2	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q969Y2-3|GTPB3_HUMAN	Isoform 3 of tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	398-UNIMOD:4	0.04	41.0	1	1	1
PRT	sp|P51965-2|UB2E1_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	34-UNIMOD:4	0.12	41.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	182-UNIMOD:4,183-UNIMOD:4,854-UNIMOD:35,858-UNIMOD:35	0.03	41.0	4	2	0
PRT	sp|Q7Z5L2-2|R3HCL_HUMAN	Isoform 2 of Coiled-coil domain-containing protein R3HCC1L OS=Homo sapiens OX=9606 GN=R3HCC1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	614-UNIMOD:35,146-UNIMOD:35	0.05	41.0	2	2	2
PRT	sp|P00374-2|DYR_HUMAN	Isoform 2 of Dihydrofolate reductase OS=Homo sapiens OX=9606 GN=DHFR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.13	41.0	1	1	1
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	405-UNIMOD:35,411-UNIMOD:4,419-UNIMOD:35	0.04	41.0	3	1	0
PRT	sp|Q6PJT7-8|ZC3HE_HUMAN	Isoform 8 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	228-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|Q9H0U6|RM18_HUMAN	39S ribosomal protein L18, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL18 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.11	41.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	1827-UNIMOD:35	0.02	41.0	4	4	4
PRT	sp|Q9BUB5-3|MKNK1_HUMAN	Isoform 3 of MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	13-UNIMOD:35	0.05	41.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	497-UNIMOD:35	0.10	41.0	8	4	2
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|P43307-2|SSRA_HUMAN	Isoform 2 of Translocon-associated protein subunit alpha OS=Homo sapiens OX=9606 GN=SSR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	216-UNIMOD:35,226-UNIMOD:35	0.10	41.0	1	1	1
PRT	sp|Q9HCS7|SYF1_HUMAN	Pre-mRNA-splicing factor SYF1 OS=Homo sapiens OX=9606 GN=XAB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	766-UNIMOD:35,769-UNIMOD:35	0.03	41.0	1	1	1
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	453-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:35,7-UNIMOD:4,11-UNIMOD:35,18-UNIMOD:4,682-UNIMOD:4,689-UNIMOD:4	0.06	41.0	2	2	2
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	195-UNIMOD:35	0.20	41.0	2	2	2
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	70-UNIMOD:35	0.03	41.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	339-UNIMOD:35,342-UNIMOD:35,272-UNIMOD:35	0.11	41.0	5	3	1
PRT	sp|O00488|ZN593_HUMAN	Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	130-UNIMOD:35	0.15	41.0	1	1	1
PRT	sp|O60826|CCD22_HUMAN	Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	2	2	2
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	1	1	1
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	11-UNIMOD:4,17-UNIMOD:35	0.07	41.0	2	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.27	41.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	4803-UNIMOD:35,4814-UNIMOD:4,4815-UNIMOD:4,4817-UNIMOD:4	0.01	40.0	2	2	2
PRT	sp|Q5JRA6-2|TGO1_HUMAN	Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	697-UNIMOD:35	0.01	40.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	305-UNIMOD:35,325-UNIMOD:35	0.17	40.0	21	4	1
PRT	sp|Q6IN85-5|P4R3A_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	93-UNIMOD:4	0.10	40.0	2	2	2
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.09	40.0	2	2	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	32-UNIMOD:4	0.10	40.0	1	1	1
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	201-UNIMOD:35,59-UNIMOD:4	0.11	40.0	2	2	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1005-UNIMOD:35	0.02	40.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	765-UNIMOD:35,107-UNIMOD:4	0.03	40.0	3	3	3
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	3	1	0
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q9BX40-3|LS14B_HUMAN	Isoform 3 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|O43264|ZW10_HUMAN	Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	690-UNIMOD:35	0.04	40.0	3	2	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	2	1	0
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q86Y82|STX12_HUMAN	Syntaxin-12 OS=Homo sapiens OX=9606 GN=STX12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|O95785-4|WIZ_HUMAN	Isoform 4 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9GZT9-2|EGLN1_HUMAN	Isoform 2 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	285-UNIMOD:35,294-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|Q9NZW5|MPP6_HUMAN	MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	103-UNIMOD:4,113-UNIMOD:35	0.05	39.0	1	1	1
PRT	sp|Q9BXR0|TGT_HUMAN	Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	317-UNIMOD:4,319-UNIMOD:4,322-UNIMOD:4	0.04	39.0	2	1	0
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	346-UNIMOD:35,342-UNIMOD:35,247-UNIMOD:35,253-UNIMOD:4,255-UNIMOD:4,258-UNIMOD:35	0.04	39.0	6	2	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q03154-2|ACY1_HUMAN	Isoform 2 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	262-UNIMOD:35,271-UNIMOD:35	0.06	39.0	1	1	1
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9Y3P9-4|RBGP1_HUMAN	Isoform 4 of Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	69-UNIMOD:35,73-UNIMOD:35	0.07	39.0	1	1	1
PRT	sp|Q969T4|UB2E3_HUMAN	Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens OX=9606 GN=UBE2E3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	81-UNIMOD:4	0.16	39.0	2	2	2
PRT	sp|Q99933-4|BAG1_HUMAN	Isoform 4 of BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	85-UNIMOD:35,98-UNIMOD:4	0.07	39.0	1	1	1
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	589-UNIMOD:35,592-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.04	39.0	4	3	2
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q9P2J5-2|SYLC_HUMAN	Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q9H6T3-2|RPAP3_HUMAN	Isoform 2 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	160-UNIMOD:35	0.05	39.0	2	2	2
PRT	sp|Q02241-3|KIF23_HUMAN	Isoform 3 of Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1241-UNIMOD:35	0.01	39.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	208-UNIMOD:35,291-UNIMOD:35	0.08	39.0	3	3	3
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1484-UNIMOD:35	0.01	39.0	3	2	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	288-UNIMOD:4,284-UNIMOD:35,71-UNIMOD:4	0.13	39.0	6	3	1
PRT	sp|Q00536|CDK16_HUMAN	Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	122-UNIMOD:35	0.10	39.0	11	3	2
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	270-UNIMOD:4,274-UNIMOD:4	0.08	39.0	3	1	0
PRT	sp|Q15834|CC85B_HUMAN	Coiled-coil domain-containing protein 85B OS=Homo sapiens OX=9606 GN=CCDC85B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	198-UNIMOD:4	0.14	39.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	136-UNIMOD:35	0.04	39.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	311-UNIMOD:4	0.05	39.0	2	2	2
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	246-UNIMOD:35	0.09	39.0	3	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	194-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|P35612|ADDB_HUMAN	Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	2	2	2
PRT	sp|P52594-2|AGFG1_HUMAN	Isoform 2 of Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q4V328-4|GRAP1_HUMAN	Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	796-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q86SF2|GALT7_HUMAN	N-acetylgalactosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=GALNT7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q7Z406-6|MYH14_HUMAN	Isoform 6 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1159-UNIMOD:35,2232-UNIMOD:35,779-UNIMOD:4,785-UNIMOD:35	0.03	38.0	10	6	3
PRT	sp|Q9Y450-4|HBS1L_HUMAN	Isoform 3 of HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	522-UNIMOD:35,524-UNIMOD:35	0.04	38.0	2	2	2
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	4	1	0
PRT	sp|Q7Z2Z2-2|EFL1_HUMAN	Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	423-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q96KG9-5|SCYL1_HUMAN	Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	427-UNIMOD:4	0.07	38.0	2	2	0
PRT	sp|Q96GY3|LIN37_HUMAN	Protein lin-37 homolog OS=Homo sapiens OX=9606 GN=LIN37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	176-UNIMOD:4	0.07	38.0	1	1	1
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	274-UNIMOD:35	0.08	38.0	2	1	0
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	2	2
PRT	sp|Q8NEZ5-3|FBX22_HUMAN	Isoform 3 of F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	143-UNIMOD:4,158-UNIMOD:35	0.09	38.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.12	38.0	4	1	0
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	627-UNIMOD:35,718-UNIMOD:35,720-UNIMOD:35	0.04	38.0	5	2	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	2	2	2
PRT	sp|O00425|IF2B3_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	257-UNIMOD:4,158-UNIMOD:35	0.06	38.0	3	2	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	392-UNIMOD:35	0.04	38.0	4	4	4
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q9BWT3|PAPOG_HUMAN	Poly(A) polymerase gamma OS=Homo sapiens OX=9606 GN=PAPOLG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	693-UNIMOD:35,604-UNIMOD:4	0.05	38.0	2	2	2
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q9H000-2|MKRN2_HUMAN	Isoform 2 of Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	83-UNIMOD:35,90-UNIMOD:4,99-UNIMOD:35	0.06	38.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	38.0	2	2	2
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q9Y448-3|SKAP_HUMAN	Isoform 3 of Small kinetochore-associated protein OS=Homo sapiens OX=9606 GN=KNSTRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	732-UNIMOD:4,17-UNIMOD:35,24-UNIMOD:35,29-UNIMOD:4,1606-UNIMOD:35	0.03	38.0	4	4	4
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q03164-2|KMT2A_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	3455-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	246-UNIMOD:35,326-UNIMOD:35,329-UNIMOD:4	0.09	38.0	3	2	1
PRT	sp|Q6PJ69|TRI65_HUMAN	Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	145-UNIMOD:35,146-UNIMOD:35	0.31	38.0	3	3	3
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:35	0.05	38.0	2	1	0
PRT	sp|Q96SW2-2|CRBN_HUMAN	Isoform 2 of Protein cereblon OS=Homo sapiens OX=9606 GN=CRBN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	221-UNIMOD:35,236-UNIMOD:4	0.11	38.0	9	7	5
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	4	2	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	263-UNIMOD:35,266-UNIMOD:4	0.08	37.0	4	2	1
PRT	sp|Q9UL03-3|INT6_HUMAN	Isoform 3 of Integrator complex subunit 6 OS=Homo sapiens OX=9606 GN=INTS6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9Y5Z4|HEBP2_HUMAN	Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.08	37.0	2	1	0
PRT	sp|Q9NPF5|DMAP1_HUMAN	DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.07	37.0	2	2	2
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1002-UNIMOD:35,1032-UNIMOD:35,1038-UNIMOD:35	0.03	37.0	3	2	1
PRT	sp|Q96ED9-2|HOOK2_HUMAN	Isoform 2 of Protein Hook homolog 2 OS=Homo sapiens OX=9606 GN=HOOK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q13618-3|CUL3_HUMAN	Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O43776|SYNC_HUMAN	Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	427-UNIMOD:35,438-UNIMOD:4	0.06	37.0	3	2	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	722-UNIMOD:4,726-UNIMOD:4,727-UNIMOD:35,728-UNIMOD:35,586-UNIMOD:35	0.03	37.0	4	2	1
PRT	sp|Q6UVY6-2|MOXD1_HUMAN	Isoform 2 of DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	375-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q99986|VRK1_HUMAN	Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	168-UNIMOD:35,202-UNIMOD:4	0.10	37.0	3	3	3
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	66-UNIMOD:4,71-UNIMOD:4	0.12	37.0	2	2	2
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	608-UNIMOD:35	0.06	37.0	4	3	2
PRT	sp|O43399-2|TPD54_HUMAN	Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	22-UNIMOD:35	0.11	37.0	2	1	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	4	2	1
PRT	sp|Q9NPF0-2|CD320_HUMAN	Isoform 2 of CD320 antigen OS=Homo sapiens OX=9606 GN=CD320	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	58-UNIMOD:4,66-UNIMOD:4,68-UNIMOD:4,74-UNIMOD:4	0.11	37.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	337-UNIMOD:35,339-UNIMOD:35,340-UNIMOD:35,347-UNIMOD:35,354-UNIMOD:35,472-UNIMOD:35,481-UNIMOD:35	0.13	37.0	4	3	2
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	64-UNIMOD:35	0.11	37.0	1	1	1
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9P0U3-2|SENP1_HUMAN	Isoform 2 of Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	427-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|Q92793-2|CBP_HUMAN	Isoform 2 of CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	346-UNIMOD:35	0.08	37.0	4	3	2
PRT	sp|A8CG34|P121C_HUMAN	Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	2	2
PRT	sp|Q13107-2|UBP4_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	602-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	3	3	3
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	281-UNIMOD:4,286-UNIMOD:4,822-UNIMOD:4	0.03	37.0	4	4	4
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	11-UNIMOD:4	0.15	37.0	9	4	3
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1724-UNIMOD:35,1726-UNIMOD:35	0.01	37.0	2	1	0
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	146-UNIMOD:4	0.07	37.0	1	1	1
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	2	2
PRT	sp|Q6EEV4-2|GL1AD_HUMAN	Isoform 5 of DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 OS=Homo sapiens OX=9606 GN=POLR2M	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	28-UNIMOD:4	0.31	37.0	1	1	1
PRT	sp|P36915-2|GNL1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|O75818-2|RPP40_HUMAN	Isoform 2 of Ribonuclease P protein subunit p40 OS=Homo sapiens OX=9606 GN=RPP40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	196-UNIMOD:4,212-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|Q9Y312|AAR2_HUMAN	Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	111-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	179-UNIMOD:35,186-UNIMOD:35,194-UNIMOD:4,87-UNIMOD:35	0.12	37.0	4	2	0
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.06	37.0	1	1	0
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|A0A0U1RRE5|NBDY_HUMAN	Negative regulator of P-body association OS=Homo sapiens OX=9606 GN=NBDY PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.41	37.0	2	1	0
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	898-UNIMOD:35,899-UNIMOD:35,900-UNIMOD:35,209-UNIMOD:35	0.03	36.0	2	2	1
PRT	sp|O15357-2|SHIP2_HUMAN	Isoform 2 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	47-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|P13051-2|UNG_HUMAN	Isoform 1 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	2	1	0
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9NZZ3|CHMP5_HUMAN	Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	20-UNIMOD:4	0.16	36.0	2	2	2
PRT	sp|Q86WA8-2|LONP2_HUMAN	Isoform 2 of Lon protease homolog 2, peroxisomal OS=Homo sapiens OX=9606 GN=LONP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	598-UNIMOD:35,601-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	378-UNIMOD:35	0.09	36.0	2	2	2
PRT	sp|O75909-1|CCNK_HUMAN	Isoform 3 of Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	239-UNIMOD:4	0.07	36.0	4	3	2
PRT	sp|Q13439-5|GOGA4_HUMAN	Isoform 5 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	293-UNIMOD:35	0.07	36.0	5	4	3
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	123-UNIMOD:4,153-UNIMOD:35	0.04	36.0	3	3	3
PRT	sp|P52294|IMA5_HUMAN	Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q92947-2|GCDH_HUMAN	Isoform Short of Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GCDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	176-UNIMOD:4,191-UNIMOD:35	0.06	36.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	2	2	2
PRT	sp|Q3ZCQ8|TIM50_HUMAN	Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.08	36.0	3	2	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	518-UNIMOD:35,137-UNIMOD:35	0.05	36.0	3	3	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	389-UNIMOD:35	0.07	36.0	6	3	1
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.08	36.0	3	2	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	496-UNIMOD:35	0.06	36.0	2	2	2
PRT	sp|Q6P587|FAHD1_HUMAN	Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	61-UNIMOD:35	0.09	36.0	2	1	0
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	339-UNIMOD:4,327-UNIMOD:35	0.05	36.0	2	1	0
PRT	sp|Q12846-2|STX4_HUMAN	Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	77-UNIMOD:35	0.06	36.0	1	1	0
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	796-UNIMOD:35,310-UNIMOD:35,556-UNIMOD:4	0.06	36.0	3	3	3
PRT	sp|Q9NW08-2|RPC2_HUMAN	Isoform 2 of DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	774-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|Q14318|FKBP8_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	211-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|P24386|RAE1_HUMAN	Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens OX=9606 GN=CHM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	187-UNIMOD:4,196-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	318-UNIMOD:35,323-UNIMOD:35,326-UNIMOD:35	0.02	36.0	3	2	1
PRT	sp|P63272|SPT4H_HUMAN	Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	33-UNIMOD:4,36-UNIMOD:4,42-UNIMOD:35	0.18	36.0	1	1	1
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	139-UNIMOD:35,150-UNIMOD:4	0.07	36.0	5	2	0
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	90-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|Q8NC60|NOA1_HUMAN	Nitric oxide-associated protein 1 OS=Homo sapiens OX=9606 GN=NOA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	68-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	559-UNIMOD:35,564-UNIMOD:35	0.03	36.0	1	1	0
PRT	sp|P42126-2|ECI1_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens OX=9606 GN=ECI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	60-UNIMOD:35	0.06	36.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.11	36.0	2	2	2
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P98194-2|AT2C1_HUMAN	Isoform 2 of Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	661-UNIMOD:35,669-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|P78362|SRPK2_HUMAN	SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	320-UNIMOD:4	0.06	35.0	2	2	2
PRT	sp|Q9H8M7|MINY3_HUMAN	Ubiquitin carboxyl-terminal hydrolase MINDY-3 OS=Homo sapiens OX=9606 GN=MINDY3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	347-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q9H2M9|RBGPR_HUMAN	Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1342-UNIMOD:35	0.02	35.0	3	2	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	140-UNIMOD:35,144-UNIMOD:35,465-UNIMOD:35,473-UNIMOD:35	0.07	35.0	2	2	2
PRT	sp|Q8IZ73-2|RUSD2_HUMAN	Isoform 2 of RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	430-UNIMOD:35,438-UNIMOD:4,441-UNIMOD:4,403-UNIMOD:35	0.08	35.0	3	2	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	616-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	20-UNIMOD:35,21-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	236-UNIMOD:35	0.12	35.0	6	2	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	648-UNIMOD:35	0.03	35.0	2	2	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q96A26|F162A_HUMAN	Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	91-UNIMOD:35	0.12	35.0	2	1	0
PRT	sp|Q9BV44|THUM3_HUMAN	THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	208-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|Q8WW35|TC1D2_HUMAN	Tctex1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCTEX1D2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:35	0.13	35.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	2	2
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	567-UNIMOD:35,571-UNIMOD:35	0.02	35.0	2	1	0
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	340-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|O95429-2|BAG4_HUMAN	Isoform 2 of BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q14674-2|ESPL1_HUMAN	Isoform 2 of Separin OS=Homo sapiens OX=9606 GN=ESPL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|O94822-2|LTN1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P60900-2|PSA6_HUMAN	Isoform 2 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:4,61-UNIMOD:35,64-UNIMOD:35	0.08	35.0	1	1	1
PRT	sp|Q68CP9-3|ARID2_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|O75351|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	411-UNIMOD:35,414-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|A6NDU8|CE051_HUMAN	UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	2	1	0
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	49-UNIMOD:35,54-UNIMOD:35,59-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	276-UNIMOD:35,410-UNIMOD:35,411-UNIMOD:4,404-UNIMOD:35	0.10	35.0	7	3	0
PRT	sp|Q5T0F9-3|C2D1B_HUMAN	Isoform 3 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	2	2
PRT	sp|Q53GS7-2|GLE1_HUMAN	Isoform 2 of Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	2	2	2
PRT	sp|Q14BN4-4|SLMAP_HUMAN	Isoform 4 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	61-UNIMOD:35	0.05	35.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1594-UNIMOD:4	0.01	35.0	2	1	0
PRT	sp|O15054|KDM6B_HUMAN	Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P29558-2|RBMS1_HUMAN	Isoform 2 of RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	221-UNIMOD:4	0.04	35.0	2	1	0
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	703-UNIMOD:35	0.03	35.0	2	2	2
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	2	2
PRT	sp|Q96GX9-3|MTNB_HUMAN	Isoform 2 of Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	465-UNIMOD:35	0.07	35.0	3	3	3
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	71-UNIMOD:35	0.06	35.0	1	1	1
PRT	sp|Q96KQ7-3|EHMT2_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	154-UNIMOD:35	0.15	35.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	260-UNIMOD:35,272-UNIMOD:35,186-UNIMOD:35,192-UNIMOD:35	0.07	35.0	2	2	0
PRT	sp|O95104|SCAF4_HUMAN	SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	null		0.05	35.0	2	2	2
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	10-UNIMOD:35,1208-UNIMOD:35	0.05	35.0	3	3	3
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	134-UNIMOD:35	0.09	35.0	2	1	0
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.10	35.0	2	2	1
PRT	sp|Q8N1S5-2|S39AB_HUMAN	Isoform 2 of Zinc transporter ZIP11 OS=Homo sapiens OX=9606 GN=SLC39A11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q96BH1|RNF25_HUMAN	E3 ubiquitin-protein ligase RNF25 OS=Homo sapiens OX=9606 GN=RNF25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	222-UNIMOD:35	0.05	34.0	3	1	0
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9UHD2|TBK1_HUMAN	Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	263-UNIMOD:35,267-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	17-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	188-UNIMOD:35	0.13	34.0	3	2	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1059-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|O75674-2|TM1L1_HUMAN	Isoform 2 of TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q15154-2|PCM1_HUMAN	Isoform 2 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|O15118|NPC1_HUMAN	NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	227-UNIMOD:4,238-UNIMOD:4,240-UNIMOD:4,243-UNIMOD:4,247-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9H582-2|ZN644_HUMAN	Isoform 2 of Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	152-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	127-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.42	34.0	3	2	1
PRT	sp|O43741|AAKB2_HUMAN	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	36-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	63-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	407-UNIMOD:35	0.08	34.0	2	2	2
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	87-UNIMOD:35	0.06	34.0	2	1	0
PRT	sp|Q9NZL4-2|HPBP1_HUMAN	Isoform 2 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	245-UNIMOD:4,254-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	107-UNIMOD:35	0.05	34.0	4	2	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	797-UNIMOD:4,800-UNIMOD:35,801-UNIMOD:35,517-UNIMOD:35	0.03	34.0	5	2	0
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q7Z2K8-2|GRIN1_HUMAN	Isoform 2 of G protein-regulated inducer of neurite outgrowth 1 OS=Homo sapiens OX=9606 GN=GPRIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	658-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1182-UNIMOD:4	0.01	34.0	2	2	1
PRT	sp|P56182|RRP1_HUMAN	Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q12968-5|NFAC3_HUMAN	Isoform 5 of Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9Y520-3|PRC2C_HUMAN	Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	4	4	4
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q5HYK7-3|SH319_HUMAN	Isoform 3 of SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|O75190-4|DNJB6_HUMAN	Isoform D of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P49750-3|YLPM1_HUMAN	Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	288-UNIMOD:35	0.02	34.0	3	2	1
PRT	sp|Q5W0B1|OBI1_HUMAN	ORC ubiquitin ligase 1 OS=Homo sapiens OX=9606 GN=OBI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	1	1	1
PRT	sp|Q5T8P6-2|RBM26_HUMAN	Isoform 2 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	25-UNIMOD:4,620-UNIMOD:35	0.05	34.0	3	3	3
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q9H4L5-8|OSBL3_HUMAN	Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	478-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|Q2TAL8|QRIC1_HUMAN	Glutamine-rich protein 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	687-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	928-UNIMOD:35,1069-UNIMOD:35	0.06	34.0	5	4	3
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	3	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|O95639-3|CPSF4_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	173-UNIMOD:35	0.09	34.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	2	1
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	191-UNIMOD:35,209-UNIMOD:35	0.20	34.0	3	3	3
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.11	34.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	1	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|Q13330|MTA1_HUMAN	Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	281-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q8WWK9-6|CKAP2_HUMAN	Isoform 4 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	449-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q66K89|E4F1_HUMAN	Transcription factor E4F1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	361-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	29-UNIMOD:35,33-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	373-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	76-UNIMOD:35,88-UNIMOD:4	0.03	33.0	3	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	294-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q9H9G7-2|AGO3_HUMAN	Isoform 2 of Protein argonaute-3 OS=Homo sapiens OX=9606 GN=AGO3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	250-UNIMOD:35,257-UNIMOD:4,259-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q96A65-2|EXOC4_HUMAN	Isoform 2 of Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|O75147-2|OBSL1_HUMAN	Isoform 2 of Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	581-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9BQ52-3|RNZ2_HUMAN	Isoform 3 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	44-UNIMOD:35,49-UNIMOD:4	0.04	33.0	2	1	0
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	553-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	990-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	959-UNIMOD:35	0.01	33.0	1	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	943-UNIMOD:35,880-UNIMOD:35,888-UNIMOD:35	0.02	33.0	3	2	1
PRT	sp|Q8WY54|PPM1E_HUMAN	Protein phosphatase 1E OS=Homo sapiens OX=9606 GN=PPM1E PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q99576-4|T22D3_HUMAN	Isoform 3 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:4	0.23	33.0	1	1	1
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	221-UNIMOD:35	0.12	33.0	4	2	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	197-UNIMOD:35	0.03	33.0	1	1	0
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	434-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|O43432-4|IF4G3_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1131-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	552-UNIMOD:4	0.04	33.0	2	2	2
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	327-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q15637-5|SF01_HUMAN	Isoform 5 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	2	2	2
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	708-UNIMOD:35	0.03	33.0	2	2	2
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q92917|GPKOW_HUMAN	G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	381-UNIMOD:35,392-UNIMOD:4,394-UNIMOD:4	0.03	33.0	2	1	0
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	418-UNIMOD:35,420-UNIMOD:4	0.00	33.0	1	1	1
PRT	sp|P56181|NDUV3_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	4	2	1
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	478-UNIMOD:4,482-UNIMOD:35,483-UNIMOD:35	0.04	33.0	2	2	2
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	2	1	0
PRT	sp|Q9H0E3-2|SP130_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	535-UNIMOD:4,540-UNIMOD:35,292-UNIMOD:35,296-UNIMOD:35,300-UNIMOD:35,478-UNIMOD:35,450-UNIMOD:35,506-UNIMOD:35,514-UNIMOD:35	0.13	33.0	9	8	7
PRT	sp|Q9UIJ7-2|KAD3_HUMAN	Isoform 2 of GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	3126-UNIMOD:35,2012-UNIMOD:35,2018-UNIMOD:35	0.01	33.0	4	4	4
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	140-UNIMOD:35	0.03	33.0	1	1	0
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	48-UNIMOD:4	0.07	33.0	2	1	0
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|O00429-7|DNM1L_HUMAN	Isoform 7 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	1	1	1
PRT	sp|Q8WYQ5-3|DGCR8_HUMAN	Isoform 3 of Microprocessor complex subunit DGCR8 OS=Homo sapiens OX=9606 GN=DGCR8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	398-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	574-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	881-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|Q06587|RING1_HUMAN	E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	332-UNIMOD:4	0.13	33.0	1	1	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	899-UNIMOD:35	0.04	32.0	2	2	2
PRT	sp|Q96EK5|KBP_HUMAN	KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	3	2	1
PRT	sp|Q8WX92|NELFB_HUMAN	Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P48634-2|PRC2A_HUMAN	Isoform 2 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1355-UNIMOD:35	0.04	32.0	4	4	4
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	189-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	296-UNIMOD:35	0.02	32.0	3	2	1
PRT	sp|P82932|RT06_HUMAN	28S ribosomal protein S6, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	105-UNIMOD:4	0.11	32.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	159-UNIMOD:35	0.10	32.0	1	1	1
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	42-UNIMOD:4,47-UNIMOD:4	0.14	32.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	40-UNIMOD:4	0.04	32.0	2	2	2
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	17-UNIMOD:35,26-UNIMOD:35	0.08	32.0	4	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|O75717-2|WDHD1_HUMAN	Isoform 2 of WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	241-UNIMOD:35,242-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	110-UNIMOD:4,114-UNIMOD:4,205-UNIMOD:4	0.11	32.0	2	2	1
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	403-UNIMOD:4,404-UNIMOD:35,407-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	4	4	4
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	120-UNIMOD:4,122-UNIMOD:35,127-UNIMOD:4	0.11	32.0	3	1	0
PRT	sp|Q8IX01-4|SUGP2_HUMAN	Isoform 4 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P28289-2|TMOD1_HUMAN	Isoform 2 of Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	0
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.16	32.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P61964|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|Q9Y5X3|SNX5_HUMAN	Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q02487-2|DSC2_HUMAN	Isoform 2B of Desmocollin-2 OS=Homo sapiens OX=9606 GN=DSC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9UHD8-3|SEPT9_HUMAN	Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	58-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	2	2
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	414-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q86TM6-2|SYVN1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	540-UNIMOD:35	0.04	32.0	1	1	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	5	1	0
PRT	sp|P61011|SRP54_HUMAN	Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:35,382-UNIMOD:35,376-UNIMOD:35	0.04	32.0	3	1	0
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	2	2	2
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1180-UNIMOD:4	0.03	31.0	3	2	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	407-UNIMOD:35	0.03	31.0	2	2	2
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P47974|TISD_HUMAN	mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	2	2	2
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	153-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q9NQT5|EXOS3_HUMAN	Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	174-UNIMOD:35,180-UNIMOD:4,184-UNIMOD:4,178-UNIMOD:35	0.05	31.0	2	1	0
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	630-UNIMOD:35	0.04	31.0	5	2	1
PRT	sp|P24752-2|THIL_HUMAN	Isoform 2 of Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	91-UNIMOD:35	0.18	31.0	2	2	1
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P43363|MAGAA_HUMAN	Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	0
PRT	sp|Q8NB90-3|AFG2H_HUMAN	Isoform 3 of ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	70-UNIMOD:35	0.10	31.0	2	1	0
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9HCE1-2|MOV10_HUMAN	Isoform 2 of Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9UHB7-2|AFF4_HUMAN	Isoform 2 of AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	596-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	233-UNIMOD:35	0.03	31.0	2	2	2
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	2	2
PRT	sp|Q9GZS1|RPA49_HUMAN	DNA-directed RNA polymerase I subunit RPA49 OS=Homo sapiens OX=9606 GN=POLR1E PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	800-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	3531-UNIMOD:4	0.01	31.0	2	1	0
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	145-UNIMOD:35	0.08	31.0	1	1	1
PRT	sp|Q7Z309-4|F122B_HUMAN	Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	6-UNIMOD:35	0.07	31.0	1	1	1
PRT	sp|Q96EQ0|SGTB_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens OX=9606 GN=SGTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q92905|CSN5_HUMAN	COP9 signalosome complex subunit 5 OS=Homo sapiens OX=9606 GN=COPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9UDY2-6|ZO2_HUMAN	Isoform 6 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	314-UNIMOD:4,315-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	134-UNIMOD:35	0.04	31.0	1	1	0
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	457-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	627-UNIMOD:35	0.04	31.0	3	2	1
PRT	sp|O60828-5|PQBP1_HUMAN	Isoform 5 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|Q9Y6N7-6|ROBO1_HUMAN	Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	318-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9Y5V0|ZN706_HUMAN	Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.18	31.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	439-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	583-UNIMOD:35	0.08	31.0	5	4	3
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	142-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q9P2B2|FPRP_HUMAN	Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	429-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	88-UNIMOD:35	0.06	31.0	2	1	0
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:35,12-UNIMOD:4	0.11	31.0	4	2	1
PRT	sp|Q96EK6|GNA1_HUMAN	Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:35,8-UNIMOD:35	0.08	31.0	4	1	0
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	9-UNIMOD:35	0.07	31.0	4	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	2	1	0
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	72-UNIMOD:35,75-UNIMOD:35	0.09	31.0	2	1	0
PRT	sp|Q96RS0|TGS1_HUMAN	Trimethylguanosine synthase OS=Homo sapiens OX=9606 GN=TGS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	602-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q99961-3|SH3G1_HUMAN	Isoform 3 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	213-UNIMOD:4	0.08	31.0	2	1	0
PRT	sp|A0A0U1RRL7|MMPOS_HUMAN	Protein MMP24OS OS=Homo sapiens OX=9606 GN=MMP24OS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.38	31.0	1	1	1
PRT	sp|Q96GX2|A7L3B_HUMAN	Ataxin-7-like protein 3B OS=Homo sapiens OX=9606 GN=ATXN7L3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:4	0.22	31.0	1	1	1
PRT	sp|O00330-3|ODPX_HUMAN	Isoform 3 of Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q8WXF1|PSPC1_HUMAN	Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	492-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	38-UNIMOD:35	0.03	31.0	3	1	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.25	31.0	3	2	1
PRT	sp|Q08209|PP2BA_HUMAN	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|O14519|CDKA1_HUMAN	Cyclin-dependent kinase 2-associated protein 1 OS=Homo sapiens OX=9606 GN=CDK2AP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.23	31.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.07	30.0	1	1	1
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	290-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	745-UNIMOD:35	0.03	30.0	2	2	2
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	333-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	970-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	242-UNIMOD:4	0.04	30.0	3	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	196-UNIMOD:35,148-UNIMOD:35	0.09	30.0	5	4	3
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P63208-2|SKP1_HUMAN	Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9BXW9-3|FACD2_HUMAN	Isoform 3 of Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P57772-2|SELB_HUMAN	Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1223-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	2	2
PRT	sp|Q9BW27-2|NUP85_HUMAN	Isoform 2 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	62-UNIMOD:4	0.03	30.0	1	1	0
PRT	sp|Q9NQ66|PLCB1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:35	0.12	30.0	2	2	2
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	634-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	447-UNIMOD:35	0.03	30.0	4	3	2
PRT	sp|Q9BU02-2|THTPA_HUMAN	Isoform 2 of Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	93-UNIMOD:4	0.14	30.0	2	1	0
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	2	2
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9Y679|AUP1_HUMAN	Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|Q9HCJ3-2|RAVR2_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 2 OS=Homo sapiens OX=9606 GN=RAVER2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	344-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	208-UNIMOD:35	0.05	30.0	2	2	2
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P56537-2|IF6_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	217-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|P53675-2|CLH2_HUMAN	Isoform 2 of Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	778-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q6PCT2-2|FXL19_HUMAN	Isoform 2 of F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	434-UNIMOD:35	0.03	30.0	3	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	593-UNIMOD:35,111-UNIMOD:35	0.11	30.0	4	4	4
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	556-UNIMOD:35,557-UNIMOD:35,567-UNIMOD:4,568-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	10-UNIMOD:35	0.02	30.0	3	2	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q9ULF5-2|S39AA_HUMAN	Isoform 2 of Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	209-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:1	0.03	30.0	2	2	2
PRT	sp|P52564-2|MP2K6_HUMAN	Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9H2Y7|ZN106_HUMAN	Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q01968-2|OCRL_HUMAN	Isoform B of Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	712-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	154-UNIMOD:35,164-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q9NXX6|NSE4A_HUMAN	Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q8N0X4-2|CLYBL_HUMAN	Isoform 2 of Citramalyl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=CLYBL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1184-UNIMOD:35	0.00	30.0	1	1	1
PRT	sp|Q9HAH7|FBRS_HUMAN	Probable fibrosin-1 OS=Homo sapiens OX=9606 GN=FBRS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	738-UNIMOD:35	0.01	30.0	3	2	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	168-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q6GMV3|PTRD1_HUMAN	Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P49770|EI2BB_HUMAN	Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O14641|DVL2_HUMAN	Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	2	1	0
PRT	sp|O75643-2|U520_HUMAN	Isoform 2 of U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	387-UNIMOD:35,394-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q9UNP9-2|PPIE_HUMAN	Isoform B of Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens OX=9606 GN=PPIE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9UHX1|PUF60_HUMAN	Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	487-UNIMOD:4	0.06	30.0	3	2	0
PRT	sp|Q6PJT7|ZC3HE_HUMAN	Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	488-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	212-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q6IBW4|CNDH2_HUMAN	Condensin-2 complex subunit H2 OS=Homo sapiens OX=9606 GN=NCAPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	193-UNIMOD:35,199-UNIMOD:35,202-UNIMOD:35,210-UNIMOD:35	0.04	30.0	1	1	0
PRT	sp|Q9BQ52|RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	416-UNIMOD:35,421-UNIMOD:4	0.02	30.0	1	1	0
PRT	sp|O60502|OGA_HUMAN	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	514-UNIMOD:35,516-UNIMOD:35,520-UNIMOD:4,527-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	110-UNIMOD:35	0.10	29.0	3	2	1
PRT	sp|O95433-2|AHSA1_HUMAN	Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	136-UNIMOD:35	0.05	29.0	2	1	0
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	2	2	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	3	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q9UJK0|TSR3_HUMAN	18S rRNA aminocarboxypropyltransferase OS=Homo sapiens OX=9606 GN=TSR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	296-UNIMOD:4	0.04	29.0	3	2	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	244-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:35,122-UNIMOD:35	0.06	29.0	3	3	2
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	438-UNIMOD:35	0.01	29.0	3	1	0
PRT	sp|Q96RR4-6|KKCC2_HUMAN	Isoform 6 of Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	354-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	48-UNIMOD:4	0.10	29.0	1	1	1
PRT	sp|Q9BY32-2|ITPA_HUMAN	Isoform 2 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P42696-2|RBM34_HUMAN	Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	108-UNIMOD:35	0.09	29.0	2	1	0
PRT	sp|Q9H269-2|VPS16_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens OX=9606 GN=VPS16	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	453-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q5JRX3-3|PREP_HUMAN	Isoform 3 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	132-UNIMOD:35,139-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	120-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	425-UNIMOD:35	0.06	29.0	3	2	1
PRT	sp|Q8TED0|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	2	2	2
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	248-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P35249|RFC4_HUMAN	Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	18-UNIMOD:4,19-UNIMOD:4	0.05	29.0	2	2	2
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P61960|UFM1_HUMAN	Ubiquitin-fold modifier 1 OS=Homo sapiens OX=9606 GN=UFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.19	29.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	83-UNIMOD:35,89-UNIMOD:35,93-UNIMOD:35	0.14	29.0	2	1	0
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	53-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q6IBW4-5|CNDH2_HUMAN	Isoform 3 of Condensin-2 complex subunit H2 OS=Homo sapiens OX=9606 GN=NCAPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	193-UNIMOD:35,202-UNIMOD:35,210-UNIMOD:35	0.09	29.0	1	1	0
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.17	29.0	2	1	0
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	508-UNIMOD:35,514-UNIMOD:35,516-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	0
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	573-UNIMOD:35	0.02	29.0	1	1	0
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	225-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	132-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	197-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	686-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	2048-UNIMOD:35	0.01	28.0	3	2	1
PRT	sp|Q5ST30|SYVM_HUMAN	Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O75436-2|VP26A_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:35,37-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	87-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	43-UNIMOD:35	0.21	28.0	1	1	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	102-UNIMOD:35,97-UNIMOD:35	0.05	28.0	3	1	0
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q8NFI4|F10A5_HUMAN	Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	220-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	2	2	2
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	151-UNIMOD:4,155-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	178-UNIMOD:35,187-UNIMOD:35	0.04	28.0	2	1	0
PRT	sp|P52952-3|NKX25_HUMAN	Isoform 3 of Homeobox protein Nkx-2.5 OS=Homo sapiens OX=9606 GN=NKX2-5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.17	28.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	24-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q7Z5J4-3|RAI1_HUMAN	Isoform 3 of Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8NG68|TTL_HUMAN	Tubulin--tyrosine ligase OS=Homo sapiens OX=9606 GN=TTL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:35	0.22	28.0	2	2	2
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	3	3	3
PRT	sp|Q9Y5T5-5|UBP16_HUMAN	Isoform 5 of Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	24-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|O75964|ATP5L_HUMAN	ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.14	28.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.12	28.0	2	1	0
PRT	sp|Q6SPF0|SAMD1_HUMAN	Atherin OS=Homo sapiens OX=9606 GN=SAMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	2	2	2
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	262-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	80-UNIMOD:35,247-UNIMOD:4	0.09	28.0	4	4	4
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	3	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	0
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.01	28.0	1	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	166-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	209-UNIMOD:35	0.01	28.0	1	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	708-UNIMOD:35,709-UNIMOD:35,719-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q8TBB5|KLDC4_HUMAN	Kelch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KLHDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	284-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	84-UNIMOD:35	0.13	27.0	2	2	2
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	347-UNIMOD:35,355-UNIMOD:35,359-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q9HD45|TM9S3_HUMAN	Transmembrane 9 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM9SF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	103-UNIMOD:35,108-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q49A26-4|GLYR1_HUMAN	Isoform 4 of Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O15014-2|ZN609_HUMAN	Isoform 2 of Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	2	1	0
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9UEE9-2|CFDP1_HUMAN	Isoform 2 of Craniofacial development protein 1 OS=Homo sapiens OX=9606 GN=CFDP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9NUA8|ZBT40_HUMAN	Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2119-UNIMOD:35	0.01	27.0	2	2	2
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	691-UNIMOD:4,708-UNIMOD:4	0.02	27.0	2	2	2
PRT	sp|Q13438-8|OS9_HUMAN	Isoform 8 of Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8NEY8-3|PPHLN_HUMAN	Isoform 3 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	179-UNIMOD:35	0.01	27.0	2	1	0
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q14344-2|GNA13_HUMAN	Isoform 2 of Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens OX=9606 GN=GNA13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	215-UNIMOD:35,216-UNIMOD:35,222-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|Q92896-3|GSLG1_HUMAN	Isoform 3 of Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	860-UNIMOD:35,861-UNIMOD:35,870-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	262-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q8NE62|CHDH_HUMAN	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	518-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	13-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|Q9NW64-2|RBM22_HUMAN	Isoform 2 of Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	589-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NRA8-2|4ET_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.18	27.0	2	1	0
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	2	1	0
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	314-UNIMOD:35,284-UNIMOD:35	0.04	27.0	3	2	1
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	390-UNIMOD:35,394-UNIMOD:35	0.02	27.0	2	2	2
PRT	sp|O43402-2|EMC8_HUMAN	Isoform 2 of ER membrane protein complex subunit 8 OS=Homo sapiens OX=9606 GN=EMC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	12-UNIMOD:4	0.10	27.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	564-UNIMOD:35	0.02	27.0	1	1	0
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	87-UNIMOD:35	0.05	27.0	1	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P06280|AGAL_HUMAN	Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	81-UNIMOD:35	0.06	27.0	2	1	0
PRT	sp|Q15059|BRD3_HUMAN	Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	515-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P09417-2|DHPR_HUMAN	Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	116-UNIMOD:35,121-UNIMOD:35	0.08	26.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	3	2	1
PRT	sp|Q9NPH2-2|INO1_HUMAN	Isoform 2 of Inositol-3-phosphate synthase 1 OS=Homo sapiens OX=9606 GN=ISYNA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.17	26.0	1	1	1
PRT	sp|Q9NTK5-3|OLA1_HUMAN	Isoform 3 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	159-UNIMOD:35	0.04	26.0	2	1	0
PRT	sp|Q9H6R7-2|WDCP_HUMAN	Isoform 2 of WD repeat and coiled-coil-containing protein OS=Homo sapiens OX=9606 GN=WDCP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	246-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q9Y287-2|ITM2B_HUMAN	Isoform 2 of Integral membrane protein 2B OS=Homo sapiens OX=9606 GN=ITM2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q14232-2|EI2BA_HUMAN	Isoform 2 of Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	20-UNIMOD:35,1-UNIMOD:35	0.11	26.0	3	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35	0.08	26.0	9	5	2
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O43670-2|ZN207_HUMAN	Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q08209-4|PP2BA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	199-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|Q8NFG4|FLCN_HUMAN	Folliculin OS=Homo sapiens OX=9606 GN=FLCN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	286-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q9BTX1-4|NDC1_HUMAN	Isoform 4 of Nucleoporin NDC1 OS=Homo sapiens OX=9606 GN=NDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	456-UNIMOD:35,9-UNIMOD:4	0.06	26.0	2	2	2
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	511-UNIMOD:35,517-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P15121|ALDR_HUMAN	Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|O60907-2|TBL1X_HUMAN	Isoform 2 of F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	161-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|O60499-2|STX10_HUMAN	Isoform 2 of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P53992-2|SC24C_HUMAN	Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	185-UNIMOD:35	0.06	26.0	2	1	0
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P10515|ODP2_HUMAN	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	103-UNIMOD:35	0.03	26.0	3	1	0
PRT	sp|P02768-3|ALBU_HUMAN	Isoform 3 of Albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	2	2	2
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	327-UNIMOD:35	0.03	26.0	3	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	53-UNIMOD:35	0.02	26.0	3	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|P98194|AT2C1_HUMAN	Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	3	2	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	75-UNIMOD:35	0.08	26.0	1	1	0
PRT	sp|Q12846|STX4_HUMAN	Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	0
PRT	sp|Q9BW27|NUP85_HUMAN	Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	230-UNIMOD:4	0.02	26.0	1	1	0
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.09	26.0	6	1	0
PRT	sp|P58876|H2B1D_HUMAN	Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.09	26.0	2	1	0
PRT	sp|P98175|RBM10_HUMAN	RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	493-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:35	0.05	26.0	2	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|P48739|PIPNB_HUMAN	Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P11171-7|EPB41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8WWY3-2|PRP31_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	81-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q8IYI6|EXOC8_HUMAN	Exocyst complex component 8 OS=Homo sapiens OX=9606 GN=EXOC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P59998|ARPC4_HUMAN	Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q8NI77|KI18A_HUMAN	Kinesin-like protein KIF18A OS=Homo sapiens OX=9606 GN=KIF18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	710-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P49643|PRI2_HUMAN	DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	330-UNIMOD:35,257-UNIMOD:35	0.05	25.0	2	2	2
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.15	25.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	136-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	611-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q15067-3|ACOX1_HUMAN	Isoform 3 of Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P48735|IDHP_HUMAN	Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	53-UNIMOD:35,58-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q16637-4|SMN_HUMAN	Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:35	0.08	25.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P51513-2|NOVA1_HUMAN	Isoform 2 of RNA-binding protein Nova-1 OS=Homo sapiens OX=9606 GN=NOVA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	0
PRT	sp|O00186|STXB3_HUMAN	Syntaxin-binding protein 3 OS=Homo sapiens OX=9606 GN=STXBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q96F07-2|CYFP2_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q6NVV1|R13P3_HUMAN	Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens OX=9606 GN=RPL13AP3 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	2	1	0
PRT	sp|Q99966|CITE1_HUMAN	Cbp/p300-interacting transactivator 1 OS=Homo sapiens OX=9606 GN=CITED1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|P10321-2|HLAC_HUMAN	Isoform 2 of HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q96HA1|P121A_HUMAN	Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	727-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P59768|GBG2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Homo sapiens OX=9606 GN=GNG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.24	25.0	1	1	1
PRT	sp|P09417|DHPR_HUMAN	Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	171-UNIMOD:35,189-UNIMOD:35	0.10	25.0	1	1	1
PRT	sp|P60763|RAC3_HUMAN	Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens OX=9606 GN=RAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	145-UNIMOD:35	0.08	25.0	1	1	1
PRT	sp|Q14232|EI2BA_HUMAN	Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	20-UNIMOD:35	0.05	25.0	1	1	0
PRT	sp|O60333|KIF1B_HUMAN	Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1635-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q3SY69|AL1L2_HUMAN	Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH1L2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	260-UNIMOD:4,261-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P28289|TMOD1_HUMAN	Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	0
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	203-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|O96013-2|PAK4_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	420-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q7Z7C8|TAF8_HUMAN	Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|A0AVF1-2|IFT56_HUMAN	Isoform 2 of Intraflagellar transport protein 56 OS=Homo sapiens OX=9606 GN=TTC26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q5TC12-2|ATPF1_HUMAN	Isoform 2 of ATP synthase mitochondrial F1 complex assembly factor 1 OS=Homo sapiens OX=9606 GN=ATPAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q96FX2|DPH3_HUMAN	DPH3 homolog OS=Homo sapiens OX=9606 GN=DPH3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	48-UNIMOD:4,51-UNIMOD:4	0.26	24.0	1	1	1
PRT	sp|Q15843|NEDD8_HUMAN	NEDD8 OS=Homo sapiens OX=9606 GN=NEDD8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.15	24.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	183-UNIMOD:35,192-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	579-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q969U7-2|PSMG2_HUMAN	Isoform 2 of Proteasome assembly chaperone 2 OS=Homo sapiens OX=9606 GN=PSMG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q96JC1-2|VPS39_HUMAN	Isoform 2 of Vam6/Vps39-like protein OS=Homo sapiens OX=9606 GN=VPS39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O75489-2|NDUS3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|Q92859-3|NEO1_HUMAN	Isoform 3 of Neogenin OS=Homo sapiens OX=9606 GN=NEO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1185-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	303-UNIMOD:35	0.04	24.0	2	2	2
PRT	sp|Q15382|RHEB_HUMAN	GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	115-UNIMOD:35	0.07	24.0	1	1	1
PRT	sp|Q8WXX7-2|AUTS2_HUMAN	Isoform 2 of Autism susceptibility gene 2 protein OS=Homo sapiens OX=9606 GN=AUTS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	11-UNIMOD:4	0.04	24.0	2	1	0
PRT	sp|Q86TM6|SYVN1_HUMAN	E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|P10586|PTPRF_HUMAN	Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	503-UNIMOD:35,511-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q09019|DMWD_HUMAN	Dystrophia myotonica WD repeat-containing protein OS=Homo sapiens OX=9606 GN=DMWD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9BYD6|RM01_HUMAN	39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	122-UNIMOD:4,220-UNIMOD:35	0.04	23.0	2	2	2
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=GFUS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q96PV7-2|F193B_HUMAN	Isoform 2 of Protein FAM193B OS=Homo sapiens OX=9606 GN=FAM193B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	400-UNIMOD:35,405-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P61326|MGN_HUMAN	Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|O75970-5|MPDZ_HUMAN	Isoform 4 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	628-UNIMOD:35,630-UNIMOD:4,631-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P51649|SSDH_HUMAN	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	272-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	93-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	277-UNIMOD:4	0.02	23.0	2	1	0
PRT	sp|Q96HE9|PRR11_HUMAN	Proline-rich protein 11 OS=Homo sapiens OX=9606 GN=PRR11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	209-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q8TEM1-2|PO210_HUMAN	Isoform 2 of Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	380-UNIMOD:35,387-UNIMOD:35	0.02	23.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	41-UNIMOD:4	0.03	23.0	2	2	2
PRT	sp|Q8N1G2|CMTR1_HUMAN	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=CMTR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	214-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9Y3D3|RT16_HUMAN	28S ribosomal protein S16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.11	23.0	1	1	1
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	144-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96RE7|NACC1_HUMAN	Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q16881-5|TRXR1_HUMAN	Isoform 5 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P16278-2|BGAL_HUMAN	Isoform 2 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q6P158-3|DHX57_HUMAN	Isoform 3 of Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O94973-3|AP2A2_HUMAN	Isoform 3 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	10-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9Y487|VPP2_HUMAN	V-type proton ATPase 116 kDa subunit a2 OS=Homo sapiens OX=9606 GN=ATP6V0A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	244-UNIMOD:35	0.02	23.0	1	1	0
PRT	sp|P55210|CASP7_HUMAN	Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	0
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	3	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96GM5|SMRD1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	466-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q9UN86|G3BP2_HUMAN	Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	109-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	3-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q04727-4|TLE4_HUMAN	Isoform 4 of Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	393-UNIMOD:4,396-UNIMOD:4,190-UNIMOD:35	0.05	22.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P49917|DNLI4_HUMAN	DNA ligase 4 OS=Homo sapiens OX=9606 GN=LIG4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	68-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	515-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q13042-4|CDC16_HUMAN	Isoform 4 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q6QNY1|BL1S2_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:4	0.09	22.0	1	1	1
PRT	sp|Q9BYW2-3|SETD2_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q15046-2|SYK_HUMAN	Isoform Mitochondrial of Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	601-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	38-UNIMOD:4,41-UNIMOD:35	0.06	22.0	4	2	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	137-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|O43447-2|PPIH_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	108-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	4888-UNIMOD:35	0.00	22.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	951-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	655-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q8N554-2|ZN276_HUMAN	Isoform 2 of Zinc finger protein 276 OS=Homo sapiens OX=9606 GN=ZNF276	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O95239|KIF4A_HUMAN	Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q5VT66-3|MARC1_HUMAN	Isoform 3 of Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P45983-3|MK08_HUMAN	Isoform 3 of Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	245-UNIMOD:4,249-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|Q99877|H2B1N_HUMAN	Histone H2B type 1-N OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q9Y6W5-2|WASF2_HUMAN	Isoform 2 of Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P55210-4|CASP7_HUMAN	Isoform 4 of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	0
PRT	sp|A5YKK6-3|CNOT1_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1594-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q9NZJ9|NUDT4_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	53-UNIMOD:35	0.14	22.0	1	1	1
PRT	sp|P62308|RUXG_HUMAN	Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.12	22.0	2	1	0
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	1257-UNIMOD:4	0.01	22.0	1	1	0
PRT	sp|Q02880|TOP2B_HUMAN	DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	964-UNIMOD:35	0.01	22.0	1	1	0
PRT	sp|P51153|RAB13_HUMAN	Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q9NPA3|M1IP1_HUMAN	Mid1-interacting protein 1 OS=Homo sapiens OX=9606 GN=MID1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|P51513|NOVA1_HUMAN	RNA-binding protein Nova-1 OS=Homo sapiens OX=9606 GN=NOVA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|P61956|SUMO2_HUMAN	Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.14	22.0	1	1	0
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	890-UNIMOD:35	0.01	22.0	3	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q5JVS0|HABP4_HUMAN	Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	396-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q15286-2|RAB35_HUMAN	Isoform 2 of Ras-related protein Rab-35 OS=Homo sapiens OX=9606 GN=RAB35	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.06	21.0	1	1	1
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Y5B6-2|PAXB1_HUMAN	Isoform 2 of PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9BZE1|RM37_HUMAN	39S ribosomal protein L37, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NXF1-2|TEX10_HUMAN	Isoform 2 of Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:35,131-UNIMOD:35	0.02	21.0	1	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9H9Y6-4|RPA2_HUMAN	Isoform 4 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9Y3A6-2|TMED5_HUMAN	Isoform 2 of Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	151-UNIMOD:35	0.06	21.0	1	1	1
PRT	sp|Q9Y2J2-3|E41L3_HUMAN	Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	594-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q96N11-2|CG026_HUMAN	Isoform 2 of Uncharacterized protein C7orf26 OS=Homo sapiens OX=9606 GN=C7orf26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P35610|SOAT1_HUMAN	Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	7-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q93009|UBP7_HUMAN	Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	244-UNIMOD:35,245-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|P17677|NEUM_HUMAN	Neuromodulin OS=Homo sapiens OX=9606 GN=GAP43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	794-UNIMOD:35,798-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q01968|OCRL_HUMAN	Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	413-UNIMOD:35,415-UNIMOD:35	0.06	21.0	1	1	0
PRT	sp|Q9ULT0-3|TTC7A_HUMAN	Isoform 2 of Tetratricopeptide repeat protein 7A OS=Homo sapiens OX=9606 GN=TTC7A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q6NUQ1|RINT1_HUMAN	RAD50-interacting protein 1 OS=Homo sapiens OX=9606 GN=RINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	473-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P82912-2|RT11_HUMAN	Isoform 2 of 28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q15003-2|CND2_HUMAN	Isoform 2 of Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q9UNN5-2|FAF1_HUMAN	Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|O95630-2|STABP_HUMAN	Isoform 2 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q12830-4|BPTF_HUMAN	Isoform 4 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	445-UNIMOD:4,2076-UNIMOD:35	0.01	20.0	2	2	2
PRT	sp|O14957|QCR10_HUMAN	Cytochrome b-c1 complex subunit 10 OS=Homo sapiens OX=9606 GN=UQCR11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:35	0.16	20.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	119-UNIMOD:4	0.09	20.0	1	1	1
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	322-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q9UKA9-5|PTBP2_HUMAN	Isoform 5 of Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q96TA2-3|YMEL1_HUMAN	Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	243-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	0
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	1	1	0
PRT	sp|Q5MIZ7|P4R3B_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP4R3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	0
PRT	sp|Q8N9V3|WSDU1_HUMAN	WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDSUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9H8H0|NOL11_HUMAN	Nucleolar protein 11 OS=Homo sapiens OX=9606 GN=NOL11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	539-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|P17301|ITA2_HUMAN	Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q7L5A8|FA2H_HUMAN	Fatty acid 2-hydroxylase OS=Homo sapiens OX=9606 GN=FA2H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q8NEB9|PK3C3_HUMAN	Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens OX=9606 GN=PIK3C3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	260-UNIMOD:35,262-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	43-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P53990|IST1_HUMAN	IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q8NFP7|NUD10_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens OX=9606 GN=NUDT10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,155-UNIMOD:35	0.19	20.0	2	2	2
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	152-UNIMOD:4,156-UNIMOD:4	0.10	20.0	4	2	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P17544-4|ATF7_HUMAN	Isoform 4 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	96-UNIMOD:35	0.06	19.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	149-UNIMOD:35	0.05	19.0	2	1	0
PRT	sp|Q9NUL3-4|STAU2_HUMAN	Isoform 4 of Double-stranded RNA-binding protein Staufen homolog 2 OS=Homo sapiens OX=9606 GN=STAU2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	224-UNIMOD:35	0.09	19.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	63-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NVM9-2|INT13_HUMAN	Isoform 2 of Integrator complex subunit 13 OS=Homo sapiens OX=9606 GN=INTS13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9HD20-3|AT131_HUMAN	Isoform C of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9UJ83-4|HACL1_HUMAN	Isoform 4 of 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens OX=9606 GN=HACL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	223-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q06787-11|FMR1_HUMAN	Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	333-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q8IY22|CMIP_HUMAN	C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	89-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	175-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:35	0.11	19.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1607-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P07910-3|HNRPC_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q7Z6K5|ARPIN_HUMAN	Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	1	1	1
PRT	sp|P78330|SERB_HUMAN	Phosphoserine phosphatase OS=Homo sapiens OX=9606 GN=PSPH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.04	19.0	2	1	0
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|O14936|CSKP_HUMAN	Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	480-UNIMOD:35,482-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9P015|RM15_HUMAN	39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	76-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q08623|HDHD1_HUMAN	Pseudouridine-5'-phosphatase OS=Homo sapiens OX=9606 GN=PUDP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	92-UNIMOD:35	0.07	19.0	1	1	1
PRT	sp|Q9Y3B2|EXOS1_HUMAN	Exosome complex component CSL4 OS=Homo sapiens OX=9606 GN=EXOSC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	2	1	0
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|O43639|NCK2_HUMAN	Cytoplasmic protein NCK2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	174-UNIMOD:35,180-UNIMOD:35	0.02	19.0	1	1	0
PRT	sp|P68133|ACTS_HUMAN	Actin, alpha skeletal muscle OS=Homo sapiens OX=9606 GN=ACTA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NXE8|CWC25_HUMAN	Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens OX=9606 GN=CWC25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q96PY6-5|NEK1_HUMAN	Isoform 5 of Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O94760-2|DDAH1_HUMAN	Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	2	1	0
PRT	sp|O00139-2|KIF2A_HUMAN	Isoform 2 of Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q96DT7-4|ZBT10_HUMAN	Isoform 4 of Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O43464-4|HTRA2_HUMAN	Isoform 4 of Serine protease HTRA2, mitochondrial OS=Homo sapiens OX=9606 GN=HTRA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	114-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q6ZSJ8-2|CA122_HUMAN	Isoform 2 of Uncharacterized protein C1orf122 OS=Homo sapiens OX=9606 GN=C1orf122	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.28	18.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P53350|PLK1_HUMAN	Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	212-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|P15586-2|GNS_HUMAN	Isoform 2 of N-acetylglucosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GNS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	371-UNIMOD:35,374-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	121-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	760-UNIMOD:35,761-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q9Y3B7-3|RM11_HUMAN	Isoform 3 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	30-UNIMOD:35	0.10	18.0	1	1	1
PRT	sp|Q86U70-3|LDB1_HUMAN	Isoform 2 of LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	11-UNIMOD:35	0.06	18.0	1	1	1
PRT	sp|Q86Y37-2|CACL1_HUMAN	Isoform 2 of CDK2-associated and cullin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACUL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	422-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q7Z3B4|NUP54_HUMAN	Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	163-UNIMOD:4,174-UNIMOD:35	0.07	18.0	2	1	0
PRT	sp|Q8NC26|ZN114_HUMAN	Zinc finger protein 114 OS=Homo sapiens OX=9606 GN=ZNF114 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	585-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	220-UNIMOD:35,3-UNIMOD:35	0.14	18.0	5	3	1
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|O94906|PRP6_HUMAN	Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	482-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	60-UNIMOD:35,63-UNIMOD:35	0.13	18.0	1	1	1
PRT	sp|Q13415|ORC1_HUMAN	Origin recognition complex subunit 1 OS=Homo sapiens OX=9606 GN=ORC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|O43292-2|GPAA1_HUMAN	Isoform 2 of Glycosylphosphatidylinositol anchor attachment 1 protein OS=Homo sapiens OX=9606 GN=GPAA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	2	1	0
PRT	sp|Q53HL2|BOREA_HUMAN	Borealin OS=Homo sapiens OX=9606 GN=CDCA8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9Y4C2-2|TCAF1_HUMAN	Isoform 2 of TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	208-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9BTA9-3|WAC_HUMAN	Isoform 3 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	0
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:35	0.08	17.0	1	1	1
PRT	sp|Q9NPA8|ENY2_HUMAN	Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:35,6-UNIMOD:35	0.08	17.0	1	1	1
PRT	sp|Q9NQW7-2|XPP1_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	150-UNIMOD:35,154-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|Q6ZTU2|E400N_HUMAN	Putative EP400-like protein OS=Homo sapiens OX=9606 GN=EP400P1 PE=5 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	333-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	48-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q53GS9|SNUT2_HUMAN	U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	353-UNIMOD:35	0.02	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RTDEAPQGAAASSSVAGAVGMTTSGESESDDSEMG	1	sp|Q14669-4|TRIPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	64	21-UNIMOD:35,34-UNIMOD:35	ms_run[2]:scan=5198	22.3	3	3376.3791	3376.3791	A	R	69	104
PSM	KNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEEN	2	sp|Q92598-3|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=5118	22.065	3	3996.8057	3996.8057	D	K	488	525
PSM	KPGTTGSGAGSGGPGGLTSAAPAGGD	3	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=4648	20.558	2	2083.977	2083.9770	T	K	26	52
PSM	KSDQGVEGPGGTGGSGSSPNDPVTNICQAAD	4	sp|P28702|RXRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59	27-UNIMOD:4	ms_run[2]:scan=5577	23.217	3	2958.2897	2958.2897	Q	K	314	345
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSD	5	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=4844	21.247	3	3365.4516	3365.4516	Q	K	798	832
PSM	KATLVESSTSGFTPGGGGSSVSMIAS	6	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	23-UNIMOD:35	ms_run[2]:scan=6236	24.61	2	2430.1584	2430.1584	L	R	332	358
PSM	RGDAGPGSGAASGTVVAAAAGGPGPGAGGVAAAGPAPAPPTGGSGGSGAGGSGSA	7	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=5848	23.765	4	4195.9867	4195.9867	G	R	36	91
PSM	KPAETPVATSPTATDSTSGDSS	8	sp|P54727-2|RD23B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=4159	18.461	2	2105.9601	2105.9601	E	R	79	101
PSM	RVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPG	9	sp|Q15542-2|TAF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=5451	22.947	3	3042.5007	3042.5007	S	K	150	186
PSM	KATIEVFQQSAETGSSSGSTASNMPSSS	10	sp|Q93074-3|MED12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	24-UNIMOD:35	ms_run[2]:scan=5595	23.25	3	2791.2454	2791.2454	A	K	1384	1412
PSM	KGVVPLAGTNGETTTQGLDGLSE	11	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=6669	25.638	3	2243.1281	2243.1281	D	R	111	134
PSM	KDVISNTSDVIGTCEAADVAQ	12	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	14-UNIMOD:4	ms_run[2]:scan=6291	24.725	2	2192.0267	2192.0267	Q	K	539	560
PSM	KDYEEVGVDSVEGEGEEEGEEY	13	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6307	24.755	2	2475.9925	2475.9925	E	-	314	336
PSM	KSETSVANGSQSESSVSTPSASFEPNNTCENSQS	14	sp|Q92575|UBXN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	29-UNIMOD:4	ms_run[2]:scan=5164	22.199	3	3533.4972	3533.4972	L	R	116	150
PSM	KAADPPAENSSAPEAEQGGAE	15	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=3908	17.354	2	2024.8923	2024.8923	T	-	304	325
PSM	KDTSATSQSVNGSPQAEQPSLESTS	16	sp|Q86WB0-3|NIPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4726	20.839	3	2535.1572	2535.1572	A	K	50	75
PSM	KELGGLEGDPSPEEDEGIQ	17	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5649	23.366	2	1997.9066	1997.9066	R	K	247	266
PSM	KTDLNPDNLQGGDDLDPNYVLSS	18	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7243	27.293	3	2489.1558	2489.1558	H	R	107	130
PSM	KASAEGPLLGPEAAPSGEGAGS	19	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5528	23.11	2	1951.9487	1951.9487	K	K	21	43
PSM	KDPGMGAMGGMGGGMGGGMF	20	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	5-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5647	23.36	2	1849.6926	1849.6926	E	-	554	574
PSM	KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	21	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=4924	21.498	4	3752.6409	3752.6409	A	-	157	196
PSM	KTPGSLGSSASAGQAAASAPLPLESGELS	22	sp|Q9BZE9-4|ASPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6892	26.237	3	2640.3243	2640.3243	G	R	103	132
PSM	KVELPSEEQVSGSQGPSEE	23	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5357	22.732	2	2014.9331	2014.9331	E	K	271	290
PSM	RVTEAPCYPGAPSTEASGQTGPQEPTSA	24	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	7-UNIMOD:4	ms_run[2]:scan=5231	22.4	3	2845.2825	2845.2825	P	R	517	545
PSM	KDYEEVGADSADGEDEGEEY	25	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5163	22.198	2	2205.8346	2205.8346	E	-	430	450
PSM	KEAPAEGEAAEPGSPTAAEGEAASAASSTSSP	26	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5256	22.473	3	2914.2952	2914.2952	E	K	105	137
PSM	KETCVSGEDPTQGADLSPDE	27	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	4-UNIMOD:4	ms_run[2]:scan=4989	21.687	2	2133.9008	2133.9008	L	K	362	382
PSM	KTELLGEETPMAADEGSAE	28	sp|Q9H9B1-4|EHMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	11-UNIMOD:35	ms_run[2]:scan=5438	22.919	2	1992.8834	1992.8834	V	K	22	41
PSM	KTVEPPISQVGNVDTASELE	29	sp|O95104-2|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6516	25.275	2	2112.0586	2112.0586	N	K	1069	1089
PSM	RESELELPVPGAGGDGADPGLS	30	sp|O43251-6|RFOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7269	27.38	2	2122.0178	2122.0178	K	K	24	46
PSM	KDPGMGAMGGMGGGMGGGMF	31	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	5-UNIMOD:35,8-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=4988	21.684	2	1865.6875	1865.6875	E	-	554	574
PSM	KEAAEAESGMAPGGPGEGDGSLVNAS	32	sp|Q7L2E3-2|DHX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5368	22.762	3	2387.0547	2387.0547	T	R	46	72
PSM	KENLQPQSSGVQGQVPISPEPLQ	33	sp|Q9H467|CUED2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6222	24.581	3	2459.2656	2459.2656	N	R	93	116
PSM	KEQTAPTGQGADIEADQGGEAADSQ	34	sp|Q9H0W5|CCDC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4493	19.936	3	2473.0841	2473.0841	R	R	279	304
PSM	KGIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNS	35	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6823	26.06	3	3375.608	3375.6080	A	R	642	678
PSM	KQILVPFPPQTAASPDEQ	36	sp|Q9NVU0-2|RPC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7292	27.466	2	1965.0207	1965.0207	C	K	617	635
PSM	RDDSGTDDSVDTQQQQAENSAVPTADT	37	sp|Q96DX4-2|RSPRY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4821	21.167	3	2850.2024	2850.2024	C	R	47	74
PSM	RGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEE	38	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	7-UNIMOD:35	ms_run[2]:scan=5618	23.297	3	3416.3859	3416.3859	L	K	301	337
PSM	RGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVE	39	sp|Q8TF71|MOT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5901	23.871	3	3064.4738	3064.4738	A	K	12	45
PSM	RTPDDFLNSVDEMDTGDTINQSTLPSQQN	40	sp|P46937-4|YAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	13-UNIMOD:35	ms_run[2]:scan=7234	27.253	3	3253.4317	3253.4317	P	R	233	262
PSM	RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQ	41	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47	18-UNIMOD:4,41-UNIMOD:35	ms_run[1]:scan=5695	23.4640915984	4	4173.885057	4173.886869	S	R	61	103
PSM	KAADPPAENSSAPEAEQGGAE	42	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3998	17.746	2	2024.8923	2024.8923	T	-	304	325
PSM	KAGEAPTENPAPPTQQSSAE	43	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4077	18.093	2	2008.9338	2008.9338	A	-	284	304
PSM	KAQETEAAPSQAPADEPEPESAAAQSQENQDT	44	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4668	20.628	3	3324.4502	3324.4502	T	R	119	151
PSM	KAYSDPSTGEPATYGELQQ	45	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5294	22.57	2	2040.9276	2040.9276	A	R	3147	3166
PSM	KEEPAAAGSGAASPSAAE	46	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3813	16.885	2	1599.7376	1599.7376	D	K	69	87
PSM	KIESPDSSSSSLSSGSSPPGSLPSA	47	sp|Q12948|FOXC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5467	22.976	3	2347.1027	2347.1027	P	R	256	281
PSM	KLLEVQPQVANSPSSAAQ	48	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5457	22.96	2	1865.9847	1865.9847	K	K	882	900
PSM	KQLPTPVGAVQQDPALSSN	49	sp|Q9Y6M4-6|KC1G3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5864	23.796	2	1949.0218	1949.0218	G	R	216	235
PSM	KSCVEEPEPEPEAAEGDGD	50	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	3-UNIMOD:4	ms_run[2]:scan=4583	20.314	2	2043.8215	2043.8215	K	K	99	118
PSM	KSVSTPSEAGSQDSGDGAVGS	51	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3913	17.374	2	1921.8501	1921.8501	S	R	85	106
PSM	REESPMDVDQPSPSAQDTQSIASDGTPQGE	52	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	6-UNIMOD:35	ms_run[2]:scan=5083	21.957	3	3174.3531	3174.3531	R	K	3789	3819
PSM	RLPEQPVDVPSEIADSSMT	53	sp|P18583-8|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	18-UNIMOD:35	ms_run[2]:scan=6637	25.563	2	2085.9888	2085.9889	L	R	338	357
PSM	RSDPDGGDSPLPASGGPLTC	54	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	20-UNIMOD:4	ms_run[2]:scan=5827	23.724	2	1954.8691	1954.8691	S	K	1183	1203
PSM	RVDLAGGPEQGAGGPPEPQQQCQPGAS	55	sp|Q86YR5-2|GPSM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	22-UNIMOD:4	ms_run[2]:scan=5143	22.137	3	2687.2358	2687.2358	Q	-	140	167
PSM	KAADPPAENSSAPEAEQGGAE	56	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=4026	17.87582065653333	2	2025.876876	2024.892307	T	-	304	325
PSM	KADPDCSNGQPQAAPTPGAPQN	57	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	6-UNIMOD:4	ms_run[2]:scan=4060	18.021	3	2219.9866	2219.9866	A	R	270	292
PSM	KAIEDEGGNPDEIEITSEGN	58	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5585	23.231	2	2115.9444	2115.9444	K	K	63	83
PSM	KAVPETEDVQASVSDTAQQPSEEQS	59	sp|Q6FIF0-2|ZFAN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5017	21.783	3	2659.2097	2659.2097	D	K	100	125
PSM	KDPGMGAMGGMGGGMGGGMF	60	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=4858	21.293	2	1865.6875	1865.6875	E	-	554	574
PSM	KEDSGSVPSTGPSQGTPISL	61	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6210	24.556	2	1942.9484	1942.9484	P	K	850	870
PSM	KEPAPPNGSAAEPPTEAAS	62	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4353	19.317	2	1819.8588	1819.8588	P	R	294	313
PSM	KEPVADEEEEDSDDDVEPITEF	63	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7070	26.734	2	2536.05	2536.0500	S	R	91	113
PSM	KETFGVNNAVYGIDAMNPSS	64	sp|O75822-3|EIF3J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	16-UNIMOD:35	ms_run[2]:scan=6595	25.462	2	2128.9735	2128.9735	A	R	84	104
PSM	KNTSPTTQPTASGAGAPVMTGAGESTNPENSEL	65	sp|Q92908-2|GATA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	19-UNIMOD:35	ms_run[2]:scan=5229	22.396	3	3217.4681	3217.4681	S	K	382	415
PSM	KNVMSAFGLTDDQVSGPPSAPAED	66	sp|Q92734-2|TFG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7395	27.86	3	2432.1166	2432.1166	N	R	179	203
PSM	KPFMLDEEGDTQTEETQPSET	67	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	4-UNIMOD:35	ms_run[2]:scan=5508	23.064	3	2427.0271	2427.0271	K	K	21	42
PSM	KSADGSAPAGEGEGVTLQ	68	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4763	20.962	2	1672.7904	1672.7904	A	R	30	48
PSM	KVIPATDLSEQISTAGTEASGTGNM	69	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	25-UNIMOD:35	ms_run[2]:scan=6465	25.16	3	2493.1905	2493.1905	E	K	622	647
PSM	KVQPPPETPAEEEMETETEAEALQE	70	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	14-UNIMOD:35	ms_run[2]:scan=6529	25.3	3	2827.2593	2827.2593	D	K	1075	1100
PSM	RDYEPPSPSPAPGAPPPPPQ	71	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5187	22.268	3	2052.9905	2052.9905	P	R	1673	1693
PSM	REVPEPGTAASGPGEGEGSEYGASGEDALS	72	sp|Q9C0C7-4|AMRA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5476	22.999	3	2862.2428	2862.2428	E	R	1030	1060
PSM	RPLGSGAGPGPTGAAPVSAPAPGPGPAG	73	sp|Q9NRL3|STRN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5394	22.824	3	2320.1924	2320.1924	C	K	18	46
PSM	RTEDSGLAAGPPEAAGENFAPCSVAPG	74	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	22-UNIMOD:4	ms_run[2]:scan=6509	25.262	3	2627.1922	2627.1922	D	K	111	138
PSM	KNVMSAFGLTDDQVSGPPSAPAED	75	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	4-UNIMOD:35	ms_run[1]:scan=6526	25.293441805333334	3	2449.110944	2448.111485	N	R	179	203
PSM	KALTSADGASEEQSQNDEDNQGSE	76	sp|Q92552|RT27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=3889	17.262	3	2509.0324	2509.0324	L	K	288	312
PSM	KDPGMGAMGGMGGGMGGGMF	77	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5262	22.49	2	1865.6875	1865.6875	E	-	554	574
PSM	KDVSDQIGNEEQVEDTFQ	78	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6279	24.702	2	2079.9233	2079.9233	M	K	4687	4705
PSM	KESMSTVPADFETDESVLM	79	sp|Q14493-2|SLBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	4-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=6720	25.784	2	2146.9286	2146.9286	S	R	79	98
PSM	KGTMDDISQEEGSSQGEDSVSGSQ	80	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	4-UNIMOD:35	ms_run[2]:scan=4308	19.12	3	2473.0034	2473.0035	S	R	944	968
PSM	KPLPPPPTQTEEEEDPAM	81	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	18-UNIMOD:35	ms_run[2]:scan=4779	21.016	2	2020.9299	2020.9299	T	K	1162	1180
PSM	KPQPAPQAGPIPVAPIGTL	82	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7370	27.759	2	1851.0618	1851.0618	L	K	181	200
PSM	KQEPLGSDSEGVNCLAYDEAIMAQQD	83	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	14-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=6997	26.534	3	2883.2539	2883.2539	Q	R	10	36
PSM	KSPSEESAPTTSPESVSGSVPSSGSSG	84	sp|P54725-2|RD23A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4714	20.801	3	2521.1304	2521.1304	D	R	122	149
PSM	KTAENATSGETLEENEAGD	85	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4399	19.539	2	1964.8447	1964.8447	S	-	322	341
PSM	REALGLGPPAAQLTPPPAPVGL	86	sp|Q8IY67|RAVR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7655	28.948	3	2121.1946	2121.1946	D	R	450	472
PSM	REDEEESLNEVGYDDIGGC	87	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	19-UNIMOD:4	ms_run[2]:scan=6428	25.055	2	2184.8753	2184.8753	K	R	191	210
PSM	REVIAEEEPPTVTEPLPEN	88	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6174	24.478	2	2148.0586	2148.0586	E	R	834	853
PSM	RLLEGDGGPNTGGMGAYCPAPQVSNDLLL	89	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	14-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=7651	28.927	3	2987.4117	2987.4117	K	K	220	249
PSM	RLPDDDPTAVAGSFSCTM	90	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	16-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=6375	24.919	2	1954.8401	1954.8401	V	K	708	726
PSM	KATAAPAGAPPQPQDLEFT	91	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6320	24.787	2	1908.9581	1908.9581	V	K	23	42
PSM	KDATNVGDEGGFAPNILEN	92	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6977	26.48	2	1959.9174	1959.9174	G	K	202	221
PSM	KDPGMGAMGGMGGGMGGGMF	93	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5089	21.974	2	1865.6875	1865.6875	E	-	554	574
PSM	KEEAEAPVEDGSQPPPPEP	94	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4800	21.092	2	2001.9167	2001.9167	L	K	623	642
PSM	KEMFPYEASTPTGISASC	95	sp|P42167-2|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=6271	24.684	2	1990.8652	1990.8652	L	R	237	255
PSM	KEVSSLEGSPPPCLGQEEAVCT	96	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	13-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6007	24.107	3	2373.0828	2373.0828	A	K	1282	1304
PSM	KEYIPGQPPLSQSSDSSPT	97	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5539	23.139	2	2016.964	2016.9640	G	R	870	889
PSM	KFVDEEDGGDGQAGPDEGEVDSCL	98	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	23-UNIMOD:4	ms_run[2]:scan=6108	24.329	3	2524.0184	2524.0184	N	R	23	47
PSM	KISYIPDEEVSSPSPPQ	99	sp|Q9Y6M1-5|IF2B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6045	24.191	2	1871.9153	1871.9153	F	R	88	105
PSM	KIVSGSPISTPSPSPLP	100	sp|Q9ULM3|YETS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6414	25.021	2	1662.9192	1662.9192	C	R	460	477
PSM	KPVQTSAVTGQASTGPVTQIIQT	101	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6256	24.649	3	2311.2383	2311.2383	T	K	621	644
PSM	KPVTTPEEIAQVATISANGD	102	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7131	26.919	2	2040.0375	2040.0375	S	K	160	180
PSM	KSISGTAQDGNTEPLPPDSGD	103	sp|Q86T24|KAISO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4709	20.79	2	2084.9498	2084.9498	V	K	124	145
PSM	KTELLGEETPMAADEGSAE	104	sp|Q9H9B1-4|EHMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6144	24.416	2	1976.8885	1976.8885	V	K	22	41
PSM	KTVVGQITVDMMYGGM	105	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:35,12-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=5885	23.843	2	1776.8096	1776.8096	G	R	57	73
PSM	KYAALSVDGEDENEGEDYAE	106	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5725	23.523	2	2202.9077	2202.9077	S	-	553	573
PSM	KYSLADQTSGDQSPLPPCTPTPPCAEM	107	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	18-UNIMOD:4,24-UNIMOD:4,27-UNIMOD:35	ms_run[2]:scan=6276	24.694	3	2963.2987	2963.2987	I	R	546	573
PSM	RVSADAAPDCPETSNQTPPGPGAAAGPGID	108	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	10-UNIMOD:4	ms_run[2]:scan=5295	22.574	3	2875.3043	2875.3043	P	-	601	631
PSM	KDLYANTVLSGGTTMYPGIAD	109	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	15-UNIMOD:35	ms_run[1]:scan=7087	26.7819756568	3	2203.050067	2202.051451	R	R	291	312
PSM	KSGGGTGEEPGSQGLNGEAGPEDST	110	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=4543	20.157955596533334	2	2317.982573	2316.994206	S	R	172	197
PSM	KETEPTVTTSDAAVDLSSF	111	sp|O75970|MPDZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=7258	27.33570544	2	1996.952851	1996.947697	N	K	1460	1479
PSM	KAAGDTTVIENSDVSPETESSE	112	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5022	21.793	2	2265.0132	2265.0132	V	K	1242	1264
PSM	KALGLVTPAGVLLAGPPGCG	113	sp|O15381-3|NVL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:4	ms_run[2]:scan=7817	29.717	2	1847.0339	1847.0339	F	K	411	431
PSM	KALSGTSPDDVQPGPSVGPPS	114	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5135	22.112	2	1991.98	1991.9800	A	K	132	153
PSM	KAQFAQPEILIGTIPGAGGTQ	115	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7615	28.774	3	2096.1266	2096.1266	E	R	157	178
PSM	KASYGVEDPEYAVTQLAQTTM	116	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	21-UNIMOD:35	ms_run[2]:scan=7463	28.122	3	2317.0784	2317.0784	Y	R	114	135
PSM	KATESGAQSAPLPMEGVDISP	117	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6994	26.522	2	2084.0096	2084.0096	M	K	7	28
PSM	KEDLISAFGTDDQTEIC	118	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	17-UNIMOD:4	ms_run[2]:scan=7331	27.609	2	1940.8673	1940.8673	K	K	68	85
PSM	KEDQPAVPGETQGDSYFTG	119	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6073	24.259	2	2024.8963	2024.8963	A	K	729	748
PSM	KEIDASYVDPLGPQIE	120	sp|Q13099-3|IFT88_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7136	26.935	2	1772.8832	1772.8832	N	R	772	788
PSM	KELAAEVEVQDGPNEDGEMFM	121	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=6172	24.475	3	2369.0039	2369.0039	A	R	146	167
PSM	KELASQPDVDGFLVGGASL	122	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7549	28.472	2	1901.9735	1901.9735	C	K	219	238
PSM	KELASQPDVDGFLVGGASL	123	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7751	29.396	2	1901.9735	1901.9735	C	K	219	238
PSM	KEYTPFPPPQPESQID	124	sp|Q13601|KRR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6340	24.841	2	1871.8941	1871.8941	K	K	264	280
PSM	KEYTPFPPPQPESQID	125	sp|Q13601|KRR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6493	25.223	2	1871.8941	1871.8941	K	K	264	280
PSM	KFSAPVVPSSFNFGGPAPGMN	126	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=7505	28.278	3	2123.0146	2123.0146	Y	-	1018	1039
PSM	KIMQSSSEVGYDAMAGDFVNMVE	127	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:35,14-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=6627	25.536	3	2555.0866	2555.0866	E	K	493	516
PSM	KLGSTAPQVLSTSSPAQQAENEA	128	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5654	23.38	3	2313.1448	2313.1448	Q	K	148	171
PSM	KSEDPPGQEAGSEEEGSSASGLA	129	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4582	20.312	3	2217.9509	2217.9509	S	K	653	676
PSM	KSLLDGEGPQAVGGQDVAFS	130	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6979	26.484	2	1973.9694	1973.9694	D	R	678	698
PSM	KSVEEPTQPGGTGLSDS	131	sp|Q9H0B6-2|KLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4526	20.082	2	1687.7901	1687.7901	N	R	511	528
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPST	132	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4761	20.955	3	2394.1411	2394.1411	K	K	455	485
PSM	KTPASGLQTPTSTPAPGSAT	133	sp|Q96DF8|ESS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4805	21.112	2	1868.948	1868.9480	L	R	429	449
PSM	KVIEGLDTGLQGMCVGE	134	sp|Q96AY3-2|FKB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	13-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=6143	24.414	2	1820.8648	1820.8648	N	R	207	224
PSM	KVVSQYSSLLSPMSVNAVM	135	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:35	ms_run[2]:scan=7432	28.001	2	2055.038	2055.0380	S	K	144	163
PSM	RAPPEPAPPAEATGAPAPS	136	sp|P84157-2|MXRA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4687	20.706	2	1782.8901	1782.8901	A	R	39	58
PSM	REGEAAAVEGPCPSQESLSQEENPEPTEDE	137	sp|Q86W50|MET16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	12-UNIMOD:4	ms_run[2]:scan=5433	22.905	3	3270.3743	3270.3743	L	R	437	467
PSM	RGADTAPTLAPEALPSQGEVE	138	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6267	24.672	2	2108.0386	2108.0386	E	R	1018	1039
PSM	RPGAEGAPLLPPPLPPPSPPGSG	139	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7079	26.761	3	2157.1582	2157.1582	E	R	26	49
PSM	RPLVLPSPLVTPGSNSQE	140	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7180	27.071	2	1890.0211	1890.0211	P	R	465	483
PSM	RTVGTPIASVPGSTNTGTVPGSE	141	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5603	23.266	2	2184.1022	2184.1022	L	K	269	292
PSM	KDATNVGDEGGFAPNILEN	142	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7132	26.921120954133336	2	1960.905053	1959.917400	G	K	202	221
PSM	KDYEEVGVDSVEGEGEEEGEEY	143	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=8120	30.9244354672	2	2476.994919	2475.992534	E	-	430	452
PSM	KFVDEEDGGDGQAGPDEGEVDSCL	144	sp|O15511|ARPC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	23-UNIMOD:4	ms_run[1]:scan=6100	24.314977557066666	3	2524.015151	2524.018372	N	R	23	47
PSM	KQPQPPPPPPPAAAQPPPGAP	145	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=5146	22.148740113333336	3	2036.084014	2036.084346	N	R	16	37
PSM	KDLFDLNSSEEDDTEGFSE	146	sp|Q9Y3T9|NOC2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7480	28.16987470613333	2	2175.900100	2175.896783	F	R	665	684
PSM	KAASADSTTEGTPADGFTVLST	147	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6656	25.611	2	2126.0015	2126.0015	S	K	167	189
PSM	KAEAGPEGVAPAPEGE	148	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4497	19.957	2	1507.7155	1507.7155	E	K	669	685
PSM	KAPDMSSSEEFPSFGAQVAP	149	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7287	27.442	2	2080.9412	2080.9412	E	K	1207	1227
PSM	KEGVILTNESAASTGQPDNDVTEGQ	150	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5284	22.541	3	2559.1936	2559.1936	K	R	476	501
PSM	KELAAVCGDPSTDPPLLT	151	sp|Q969Y2-3|GTPB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4	ms_run[2]:scan=6633	25.552	2	1882.9346	1882.9346	R	R	392	410
PSM	KELADITLDPPPNCSAGP	152	sp|P51965-2|UB2E1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	14-UNIMOD:4	ms_run[2]:scan=6563	25.386	2	1893.9142	1893.9142	Q	K	21	39
PSM	KESLQDTQPVGVLVDCC	153	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6571	25.411	2	1946.9078	1946.9078	L	K	167	184
PSM	KEVLSQGQQQGAPNAGVITNAPLQ	154	sp|Q7Z5L2-2|R3HCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5954	23.98	3	2447.2769	2447.2769	S	R	114	138
PSM	KGEPAAAAAPEAGASPVE	155	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4602	20.378	2	1621.7948	1621.7948	E	K	87	105
PSM	KGTEAPAVVTEEEDDDEETAPPVIAP	156	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6648	25.591	3	2708.2552	2708.2552	A	R	160	186
PSM	KILLVDSPGMGNADDEQQEEGTSS	157	sp|Q9UKN8|TF3C4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:35	ms_run[2]:scan=5639	23.343	3	2535.1283	2535.1283	S	K	605	629
PSM	KLLPEYPGVLSDVQEE	158	sp|P00374-2|DYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7388	27.828	2	1814.9302	1814.9302	Y	K	106	122
PSM	KMDAPDGCPPAVYEVM	159	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	2-UNIMOD:35,8-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=5453	22.95	2	1810.7576	1810.7576	Y	K	404	420
PSM	KPAVAPPAPPSSSQLC	160	sp|Q6PJT7-8|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:4	ms_run[2]:scan=5124	22.08	2	1605.8185	1605.8185	P	R	213	229
PSM	KPEVDPVENEAVAPEFTN	161	sp|Q9H0U6|RM18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6244	24.626	2	1983.9426	1983.9426	A	R	33	51
PSM	KPFMLDEEGDTQTEETQPSET	162	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6001	24.092	3	2411.0322	2411.0322	K	K	21	42
PSM	KPIAEAPSAFTLGSEM	163	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:35	ms_run[2]:scan=6552	25.359	2	1663.8127	1663.8127	H	K	1812	1828
PSM	KPIEMGSSEPLPIADGD	164	sp|Q9BUB5-3|MKNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:35	ms_run[2]:scan=5732	23.537	2	1770.8346	1770.8346	E	R	9	26
PSM	KPVLMALAEGPGAEGP	165	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:35	ms_run[2]:scan=6374	24.918	2	1551.7967	1551.7967	T	R	493	509
PSM	KSAEIDSDDTGGSAAQ	166	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3621	15.959	2	1550.6696	1550.6696	K	K	813	829
PSM	KSEYTQPTPIQCQGVPVALSG	167	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	12-UNIMOD:4	ms_run[2]:scan=6566	25.395	2	2259.1205	2259.1205	R	R	151	172
PSM	KSVPVTVDDDDDDNDPEN	168	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4550	20.179	2	1987.8131	1987.8131	S	R	1184	1202
PSM	KVEMGTSSQNDVDMSWIPQETLNQIN	169	sp|P43307-2|SSRA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=7347	27.673	3	2995.3539	2995.3539	Q	K	213	239
PSM	KVSGSATGTVSDLAPGQSGMDDM	170	sp|Q9HCS7|SYF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	20-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=5011	21.769	3	2241.9729	2241.9729	L	K	747	770
PSM	KVTGPQATTGTPLVTM	171	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:35	ms_run[2]:scan=5057	21.879	2	1616.8444	1616.8444	L	R	419	435
PSM	KYIYDQCPAVAGYGPIEQLPDYN	172	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4	ms_run[2]:scan=7503	28.272	3	2673.2421	2673.2421	S	R	447	470
PSM	MKPPAACAGDMADAASPCSVVNDL	173	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:35,7-UNIMOD:4,11-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=6675	25.651	3	2479.0488	2479.0488	-	R	1	25
PSM	RAESAPLPVSADDTPEVLN	174	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6487	25.206	2	1979.98	1979.9800	S	R	38	57
PSM	RALASGTEASSTDPGAPGGPGGAEGPMA	175	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	27-UNIMOD:35	ms_run[2]:scan=4814	21.144	3	2484.1187	2484.1187	G	K	169	197
PSM	RDDDEGPVSNQGYMPYLN	176	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	14-UNIMOD:35	ms_run[2]:scan=6002	24.094	2	2084.8745	2084.8745	F	R	57	75
PSM	RDMYMESEGGDGYLAPENGYLMEAAPE	177	sp|P08621-2|RU17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:35,5-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=6925	26.333	3	3042.2205	3042.2205	S	-	402	429
PSM	RIPSAVGYQPTLATDMGTMQE	178	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5965	24.015	3	2297.0668	2297.0668	G	R	324	345
PSM	RLAVPTEVSTEVPEMDTST	179	sp|O00488|ZN593_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	15-UNIMOD:35	ms_run[2]:scan=6133	24.389	2	2076.9885	2076.9885	R	-	116	135
PSM	RLPDDDPTAVAGSFSCTM	180	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:4	ms_run[2]:scan=7096	26.807	2	1938.8452	1938.8452	V	K	708	726
PSM	RLPTDASEDADQPAGDSAILL	181	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7228	27.232	2	2154.0441	2154.0441	E	R	107	128
PSM	RPAGPAGDEPAESPSETPGP	182	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4625	20.459	2	1917.8704	1917.8704	P	S	545	565
PSM	RTCETGEPMEAESGDTSSEGPAQVYLPG	183	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6224	24.585	3	2970.2495	2970.2495	R	R	9	37
PSM	RVAAAPDEDLDGDDEDDAEDENNIDN	184	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5239	22.421	3	2831.1125	2831.1125	H	R	59	85
PSM	KAAPPPPPPPPPLESSP	185	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5325	22.661	2	1674.8981	1674.8981	E	R	605	622
PSM	KAMQGTEVGQTDQTDSTGGPAFLS	186	sp|Q5JRA6-2|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35	ms_run[2]:scan=5922	23.914	3	2441.1016	2441.1016	H	K	695	719
PSM	KDLYANTVLSGGTTMYPGIAD	187	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7450	28.081	2	2186.0565	2186.0565	R	R	291	312
PSM	KDPGMGAMGGMGGGMGGGMF	188	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=4406	19.567	3	1881.6824	1881.6824	E	-	554	574
PSM	KDPSVDITQDLVDESEEE	189	sp|Q6IN85-5|P4R3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7348	27.678	2	2046.9117	2046.9117	G	R	103	121
PSM	KDYEEVGVDSVEGEGEEEGEEY	190	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8029	30.608	2	2475.9925	2475.9925	E	-	314	336
PSM	KDYEEVGVDSVEGEGEEEGEEY	191	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8217	31.266	2	2475.9925	2475.9925	E	-	314	336
PSM	KEAAGEGPALYEDPPDQ	192	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5245	22.439	2	1785.8057	1785.8057	D	K	35	52
PSM	KEAGSEPAPEQESTEATPAE	193	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4172	18.517	2	2056.9073	2056.9073	G	-	501	521
PSM	KEALGQAGVSETDNSSQDALGLS	194	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5981	24.044	3	2276.0768	2276.0768	G	K	824	847
PSM	KENLPVSSDGNLPQQAASAPS	195	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5305	22.607	3	2109.0338	2109.0338	Q	R	199	220
PSM	KEQGVTFPAIGSQAAEQA	196	sp|Q92783-2|STAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6545	25.343	2	1830.9112	1830.9112	L	K	136	154
PSM	KGFIGPGIDVPAPDMSTGE	197	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7351	27.69	2	1886.9084	1886.9084	K	R	45	64
PSM	KILATPPQEDAPSVDIANI	198	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7275	27.403	2	1991.0575	1991.0575	K	R	283	302
PSM	KLDQEDALLGSYPVDDGC	199	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	18-UNIMOD:4	ms_run[2]:scan=7077	26.755	2	1993.8939	1993.8939	S	R	15	33
PSM	KLTLQPVDNSTISLQMGTN	200	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:35	ms_run[2]:scan=6578	25.427	3	2075.0569	2075.0569	Q	K	186	205
PSM	KLVQNGTEPSSLPFLDPNA	201	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7551	28.478	2	2026.0371	2026.0371	G	R	137	156
PSM	KPVLMALAEGPGAEGP	202	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7396	27.862	2	1535.8018	1535.8018	T	R	493	509
PSM	KQDAVPPVPAALQSMPTLDP	203	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	15-UNIMOD:35	ms_run[2]:scan=6982	26.49	3	2090.0718	2090.0718	P	R	991	1011
PSM	KQIDSSPVGGETDETTVSQNY	204	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5267	22.501	3	2254.0237	2254.0237	F	R	564	585
PSM	KQPPPLAPQSPQGGVMGGSNSNQQQQM	205	sp|P46937-4|YAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=4598	20.366	3	2822.3076	2822.3076	V	R	102	129
PSM	KSIDGTADDEDEGVPTDQAI	206	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5571	23.209	2	2074.9179	2074.9179	N	R	627	647
PSM	KSSPPSIAPLALDSADLSEE	207	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7385	27.816	2	2026.0106	2026.0106	N	K	182	202
PSM	KTASDVVQPAAVQAQGQVNDEN	208	sp|Q9BX40-3|LS14B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4891	21.406	3	2268.0982	2268.0982	S	R	151	173
PSM	KTIGGGDDSFNTFFSETGAG	209	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7595	28.676	2	2006.8858	2006.8858	D	K	40	60
PSM	KTVMDEGPQVFAPLSEES	210	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7390	27.838	2	1962.9245	1962.9245	C	K	687	705
PSM	KVNEASGDGDGEDAVVILE	211	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6557	25.373	2	1915.9011	1915.9011	G	K	67	86
PSM	RAVYDEQGTVDEDSPVLTQD	212	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5839	23.748	2	2236.0132	2236.0131	Q	R	75	95
PSM	RTQPDGTSVPGEPASPISQ	213	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5174	22.225	2	1922.9334	1922.9334	P	R	607	626
PSM	KELGSLPLPLSTSEQ	214	sp|Q86Y82|STX12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7189	27.1095611096	2	1597.854696	1597.856303	L	R	82	97
PSM	KADPPPEESQAPQAQTAAAEAP	215	sp|O95785-4|WIZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4671	20.64	3	2203.0393	2203.0393	S	-	814	836
PSM	KANLYPPSNTPGDALSPGGGL	216	sp|Q9GZT9-2|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6710	25.757	2	2025.0167	2025.0167	E	R	159	180
PSM	KAPGEQTVPALNLQNAF	217	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7542	28.439	2	1796.9421	1796.9421	I	R	606	623
PSM	KAQIEEPDPPEMETSLDSSEMA	218	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=5290	22.56	3	2465.0462	2465.0462	Q	K	274	296
PSM	KCYDSPPSSPEMNNSSINNQLLPVDAI	219	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=7489	28.211	3	3005.3747	3005.3747	S	R	102	129
PSM	KDFGPIDPECTCPTCQ	220	sp|Q9BXR0|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	10-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5892	23.855	2	1923.7801	1923.7801	E	K	308	324
PSM	KDLGVFIPAPMAQGM	221	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:35	ms_run[2]:scan=7468	28.138	2	1589.7946	1589.7946	V	R	332	347
PSM	KDLGVFIPAPMAQGM	222	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:35	ms_run[2]:scan=7474	28.153	2	1589.7946	1589.7946	V	R	332	347
PSM	KDLVQDPSLLGGTISAY	223	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7567	28.549	2	1775.9305	1775.9305	L	K	40	57
PSM	KDMNLTLEPEIMPAATDN	224	sp|Q03154-2|ACY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6266	24.669	2	2033.9286	2033.9286	C	R	260	278
PSM	KDYEEVGVDSVEGEGEEEGEEY	225	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8018	30.566	2	2475.9925	2475.9925	E	-	314	336
PSM	KEDGEEPPGTSQTSPEEFTDA	226	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5456	22.958	2	2249.9448	2249.9448	G	K	140	161
PSM	KELADVLMDPPMDDQPGE	227	sp|Q9Y3P9-4|RBGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6432	25.062	2	2030.8813	2030.8813	Q	K	62	80
PSM	KELAEITLDPPPNCSAGP	228	sp|Q969T4|UB2E3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	14-UNIMOD:4	ms_run[2]:scan=6598	25.469	2	1907.9299	1907.9299	Q	K	68	86
PSM	KEMETPLSALGIQDGC	229	sp|Q99933-4|BAG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7422	27.96	2	1763.807	1763.8070	L	R	83	99
PSM	KEPVEAAPAAEPVPAST	230	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4768	20.979	2	1662.8465	1662.8465	Q	-	261	278
PSM	KEVDEGPSPPEQFTAV	231	sp|Q14331|FRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6182	24.494	2	1728.8206	1728.8206	H	K	85	101
PSM	KEVEGDDVPESIMLEM	232	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6243	24.624	2	1851.8118	1851.8118	R	K	577	593
PSM	KEVIPVNVPEAQEEM	233	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:35	ms_run[2]:scan=5932	23.935	2	1726.8448	1726.8448	K	K	513	528
PSM	KEVIPVNVPEAQEEM	234	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6680	25.662	2	1710.8498	1710.8498	K	K	513	528
PSM	KGEIGDATPFNDAVNVQ	235	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6464	25.158	2	1773.8533	1773.8533	N	K	993	1010
PSM	KGPASTPTYSPAPTQPAP	236	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4878	21.349	2	1766.8839	1766.8839	G	R	199	217
PSM	KGTGVVTSVPSDSPDDIAAL	237	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6828	26.07	2	1927.9739	1927.9739	D	R	330	350
PSM	KIEEVSDTSSLQPQASL	238	sp|Q9H6T3-2|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6040	24.18	2	1830.9211	1830.9211	L	K	464	481
PSM	KIIAEGANGPTTPEAD	239	sp|P00367-2|DHE3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4682	20.683	2	1582.7839	1582.7839	A	K	232	248
PSM	KLVQAPLDADGDNVLQE	240	sp|Q02241-3|KIF23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6590	25.452	2	1823.9265	1823.9265	I	K	125	142
PSM	KLVQDVANNTNEEAGDGTTTATVLA	241	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5879	23.831	3	2531.2351	2531.2351	A	R	96	121
PSM	KPEDFLVPELQATEEE	242	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7616	28.777	2	1872.8993	1872.8993	I	K	481	497
PSM	KPSDNEQGLPVFSGSPPM	243	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	18-UNIMOD:35	ms_run[2]:scan=6562	25.384	2	1901.8829	1901.8829	L	K	1224	1242
PSM	KSEIIPMFSNLASDEQDSV	244	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	7-UNIMOD:35	ms_run[2]:scan=7401	27.876	2	2124.9885	2124.9885	V	R	202	221
PSM	KSELVANNVTLPAGEQ	245	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5668	23.409	2	1668.8683	1668.8683	L	R	17	33
PSM	KSPAVATSTAAPPPPSSPLPS	246	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5340	22.689	2	1959.0313	1959.0313	E	K	431	452
PSM	KTDDVEAMSSQPALALDE	247	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:35	ms_run[2]:scan=5814	23.699	2	1934.8779	1934.8779	K	R	1477	1495
PSM	KTDMDNQIVVSDYAQMD	248	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	16-UNIMOD:35	ms_run[2]:scan=5956	23.985	2	1987.8503	1987.8503	P	R	227	244
PSM	KTGQATVASGIPAGWMGLDCGPESS	249	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	20-UNIMOD:4	ms_run[2]:scan=7560	28.52	3	2476.1363	2476.1363	A	K	269	294
PSM	KTNGAPEQIGLDESGGGGGSDPGEAPT	250	sp|Q00536|CDK16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5274	22.517	3	2497.1205	2497.1205	D	R	23	50
PSM	KTVDFTQDSNYLLTGGQD	251	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7205	27.156	2	2000.9327	2000.9327	V	K	104	122
PSM	KTVTNAVVTVPAYFNDSQ	252	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6978	26.482	2	1952.9844	1952.9844	G	R	137	155
PSM	KVAAPEIVSGVSGESEQ	253	sp|O15381-3|NVL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5562	23.189	2	1685.8472	1685.8472	L	K	131	148
PSM	KVEQLGAEGNVEESQ	254	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4580	20.307	2	1615.7689	1615.7689	A	K	136	151
PSM	RAIVDALPPPCESACTVPTDVD	255	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6615	25.51	3	2382.1195	2382.1195	A	K	260	282
PSM	RDLGDGSSSTGSVGSPDQLPLACSPDD	256	sp|Q15834|CC85B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	23-UNIMOD:4	ms_run[2]:scan=6477	25.178	3	2689.1773	2689.1773	P	-	176	203
PSM	RFEEVEEEPEVIPGPPSESPGMLT	257	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	22-UNIMOD:35	ms_run[2]:scan=7050	26.675	3	2670.2371	2670.2371	P	K	115	139
PSM	RIFPPETSASVAATPPPSTASAPAAVNSSASAD	258	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6722	25.794	3	3124.5313	3124.5313	D	K	355	388
PSM	RQPPPAPPEQADGNAPGPQPPPV	259	sp|Q12948|FOXC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5258	22.481	3	2313.1502	2313.1502	G	R	199	222
PSM	RSGPTDDGEEEMEEDTVTNGS	260	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:35	ms_run[2]:scan=4400	19.545	2	2269.8765	2269.8765	R	-	235	256
PSM	RTDYNASVSVPDSSGPE	261	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5142	22.135	2	1779.7911	1779.7911	L	R	69	86
PSM	KEEENVGIDITEPLYMQ	262	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	16-UNIMOD:35	ms_run[1]:scan=7223	27.211147833600002	2	2023.948887	2022.945589	A	R	179	196
PSM	KAATTEPETTQPEGVVVNG	263	sp|P35612|ADDB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4870	21.328	2	1926.9535	1926.9535	S	R	633	652
PSM	KALVVPEPEPDSDSNQE	264	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5251	22.458	2	1852.8691	1852.8691	R	R	125	142
PSM	KAPVGSVVSVPSQSSASSD	265	sp|P52594-2|AGFG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5004	21.751	2	1787.8901	1787.8901	G	K	314	333
PSM	KAPVPGTPDSLSSGSS	266	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4746	20.908	2	1485.7311	1485.7311	T	R	276	292
PSM	KDATNVGDEGGFAPNILEN	267	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8094	30.833	2	1959.9174	1959.9174	G	K	202	221
PSM	KDLYANTVLSGGTTMYPGIAD	268	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:35	ms_run[2]:scan=8082	30.794	2	2202.0514	2202.0515	R	R	291	312
PSM	KECVGPPDPDLEPGETS	269	sp|Q4V328-4|GRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4	ms_run[2]:scan=5335	22.678	2	1825.804	1825.8040	S	-	794	811
PSM	KEPEPPGVVGGPGE	270	sp|Q86SF2|GALT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4843	21.244	2	1347.667	1347.6670	P	K	138	152
PSM	KEPGVPASVSTVSYGELE	271	sp|Q7Z406-6|MYH14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6541	25.332	2	1847.9153	1847.9153	R	R	226	244
PSM	KEQGVTFPSGDIQEQLI	272	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7437	28.027	2	1887.9578	1887.9578	F	R	257	274
PSM	KEQGVTFPSGDIQEQLI	273	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7453	28.089	2	1887.9578	1887.9578	F	R	257	274
PSM	KESDVGFIPTSGLSGENLIT	274	sp|Q9Y450-4|HBS1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7638	28.871	2	2063.0423	2063.0423	F	R	393	413
PSM	KGAEAANVTGPDGVPVEGS	275	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5013	21.773	2	1753.8483	1753.8483	E	R	150	169
PSM	KGDVEEDETIPDSEQDI	276	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5738	23.548	2	1917.8327	1917.8327	L	R	277	294
PSM	KGVNLPGAAVDLPAVSE	277	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7120	26.878	2	1635.8832	1635.8832	K	K	192	209
PSM	KIIPLYSTLPPQQQQ	278	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6573	25.414	2	1752.9774	1752.9774	I	R	384	399
PSM	KLAAAQGQAPLEPTQDGSAIETCP	279	sp|Q7Z2Z2-2|EFL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	23-UNIMOD:4	ms_run[2]:scan=5735	23.543	3	2452.1904	2452.1904	E	K	401	425
PSM	KLESVSEDPTQLEEVE	280	sp|Q96KG9-5|SCYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6111	24.336	2	1830.8735	1830.8735	S	K	536	552
PSM	KLGLPPLTPEQQEALQ	281	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7029	26.624	2	1760.9672	1760.9672	A	K	10	26
PSM	KLPPPTPPGPPGDAC	282	sp|Q96GY3|LIN37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:4	ms_run[2]:scan=4956	21.587	2	1499.7442	1499.7443	Y	R	162	177
PSM	KNPSTNFQEPVQPLTQQQVAQMQL	283	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	22-UNIMOD:35	ms_run[2]:scan=6670	25.64	3	2769.3756	2769.3756	S	K	253	277
PSM	KPSALAQETSLGAPEPLSGEQLVGSPQD	284	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7126	26.9	3	2805.4032	2805.4032	S	K	1164	1192
PSM	KPVTTPEEIAQVATISANGD	285	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7078	26.758	2	2040.0375	2040.0375	S	K	160	180
PSM	KQCQVLGIVTPGIVVTPMGSGSN	286	sp|Q8NEZ5-3|FBX22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=7408	27.908	3	2357.2083	2357.2083	P	R	141	164
PSM	KQLQEETPPGGPLTEALPPA	287	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6777	25.941	2	2072.079	2072.0790	V	R	138	158
PSM	KQLQEETPPGGPLTEALPPA	288	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6792	25.983	3	2072.079	2072.0790	V	R	138	158
PSM	KQQQMPPPPPPPPPPPPAGGTGG	289	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:35	ms_run[2]:scan=4857	21.291	3	2242.1205	2242.1205	S	K	623	646
PSM	KSIEGTADDEEEGVSPDTAI	290	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5682	23.439	2	2061.9226	2061.9226	N	R	637	657
PSM	KSITILSTPEGTSAAC	291	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:4	ms_run[2]:scan=5889	23.852	2	1634.8185	1634.8185	E	K	242	258
PSM	KSPEPEVLSTQEDLFDQSN	292	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7100	26.821	2	2162.0015	2162.0015	Q	K	293	312
PSM	KSSEDDAASESFLPSEGASSDPVTL	293	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7387	27.825	3	2525.1293	2525.1293	N	R	600	625
PSM	KSVDAIGGESMPIPTIDTS	294	sp|Q9BWT3|PAPOG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=6237	24.612	2	1932.935	1932.9350	R	R	683	702
PSM	KSVTIQPPTGEPLLGNDST	295	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6588	25.447	2	1953.0055	1953.0055	E	R	44	63
PSM	KSYELPDGQVITIGNE	296	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7160	27.004	2	1761.8785	1761.8785	E	R	238	254
PSM	KTDDVEAMSSQPALALDE	297	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6676	25.653	2	1918.883	1918.8830	K	R	1477	1495
PSM	KTQPSMVSNPGSCSDPQPSPEM	298	sp|Q9H000-2|MKRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:35,13-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=4165	18.487	3	2391.9981	2391.9981	R	K	78	100
PSM	KTTTTNTQVEGDDEAAFLE	299	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6234	24.605	2	2068.9437	2068.9437	A	R	74	93
PSM	KTVIESSPESPVTITEPY	300	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6743	25.844	2	1975.999	1975.9990	L	R	615	633
PSM	KTVYSLQPPSALSGGQPADTQT	301	sp|Q9Y448-3|SKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6348	24.857	3	2245.1226	2245.1226	V	R	84	106
PSM	KVVAPTISSPVCQEQLVEAG	302	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	12-UNIMOD:4	ms_run[2]:scan=6594	25.461	3	2111.0933	2111.0933	T	R	721	741
PSM	KYEEDYYEDDEEDDPDAL	303	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6240	24.618	2	2251.8441	2251.8441	S	K	978	996
PSM	RDLDSASGPQVSNFTQTVDAPNSMGLEQN	304	sp|Q03164-2|KMT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	24-UNIMOD:35	ms_run[2]:scan=6644	25.58	3	3093.3945	3093.3945	Q	K	3432	3461
PSM	RDPDAQPGGELMLGGTDS	305	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	12-UNIMOD:35	ms_run[2]:scan=5549	23.161	2	1830.8054	1830.8054	S	K	235	253
PSM	RDPDAQPGGELMLGGTDS	306	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6193	24.522	2	1814.8105	1814.8105	S	K	235	253
PSM	RDPGPDPGPGPDPAA	307	sp|Q6PJ69|TRI65_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4465	19.827	2	1414.6477	1414.6477	A	R	79	94
PSM	READIDGDGQVNYEEFVQMMTA	308	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	19-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=7224	27.216	3	2549.0686	2549.0686	I	K	127	149
PSM	RPVTVEPMDQLDDEEGLPE	309	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	8-UNIMOD:35	ms_run[2]:scan=6157	24.449	2	2183.9892	2183.9892	P	K	131	150
PSM	RSALLPTIPDTEDEISPD	310	sp|Q96SW2-2|CRBN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7314	27.545	2	1967.9688	1967.9688	T	K	418	436
PSM	KYVVVTGITPTPLGEG	311	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6879	26.204767229333335	2	1629.897027	1629.897774	G	K	370	386
PSM	KNVIVNGLVLASDGQ	312	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6865	26.167275584	2	1525.846344	1525.846407	F	K	585	600
PSM	KAAAPAPEEEMDECEQALAAEP	313	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=5498	23.049	3	2372.0148	2372.0148	K	K	253	275
PSM	KAASADSTTEGTPADGFTVLST	314	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6417	25.027	2	2126.0015	2126.0015	S	K	167	189
PSM	KAGPDPSPVEDGQPDIS	315	sp|Q9UL03-3|INT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4954	21.58	2	1707.7952	1707.7952	E	R	224	241
PSM	KAIGAVPLIQGEYMIPCE	316	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	14-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=7429	27.989	2	2004.006	2004.0060	Q	K	313	331
PSM	KAPAQTPAEPTPGYEVGQ	317	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4935	21.53	2	1839.9003	1839.9003	S	R	1660	1678
PSM	KAPDMSSSEEFPSFGAQVAP	318	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:35	ms_run[2]:scan=7045	26.661	2	2096.9361	2096.9361	E	K	1207	1227
PSM	KAPEDAGPQPGSYEI	319	sp|Q9Y5Z4|HEBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5673	23.419	2	1557.7311	1557.7311	W	R	26	41
PSM	KDAPPLLPSDTGQGY	320	sp|Q9NPF5|DMAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6190	24.513	2	1557.7675	1557.7675	K	R	66	81
PSM	KDDPVTNLNNAFEVAE	321	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7215	27.182	2	1774.8374	1774.8374	R	K	217	233
PSM	KDLYANTVLSGGTTMYPGIAD	322	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:35	ms_run[2]:scan=7984	30.441	2	2202.0514	2202.0515	R	R	291	312
PSM	KDLYANTVLSGGTTMYPGIAD	323	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:35	ms_run[2]:scan=8178	31.131	2	2202.0514	2202.0515	R	R	291	312
PSM	KDPFDTLATMTDQQ	324	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:35	ms_run[2]:scan=6423	25.042	2	1625.7243	1625.7243	E	R	993	1007
PSM	KDPGMGAMGGMGGGMGGGMF	325	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=6326	24.809	2	1833.6977	1833.6977	E	-	554	574
PSM	KDPLLASGTDGVGT	326	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5405	22.846	2	1329.6776	1329.6776	F	K	485	499
PSM	KDTPDSLSPETYGNFDSQS	327	sp|Q96ED9-2|HOOK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6312	24.766	2	2086.8967	2086.8967	T	R	156	175
PSM	KEAAEAESGMAPGGPGEGDGSLVNAS	328	sp|Q7L2E3-2|DHX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:35	ms_run[2]:scan=4942	21.553	3	2403.0496	2403.0496	T	R	46	72
PSM	KEDGSEVGVGGAQVTGSNT	329	sp|Q13618-3|CUL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4528	20.09	2	1790.8282	1790.8282	K	R	503	522
PSM	KEDGTFYEFGEDIPEAPE	330	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7536	28.416	2	2071.8898	2071.8898	K	R	407	425
PSM	KEDPTAVACTFSCMM	331	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5602	23.264	2	1778.6984	1778.6984	P	K	714	729
PSM	KEEQTILPGDNLITEC	332	sp|Q6UVY6-2|MOXD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:4	ms_run[2]:scan=7044	26.658	2	1858.8982	1858.8982	L	R	360	376
PSM	KEPGVEDTEWSNTQTEEAIQT	333	sp|Q99986|VRK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6131	24.384	3	2391.0714	2391.0714	S	R	366	387
PSM	KEVEPALELLEPIDQ	334	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7828	29.773	2	1721.9087	1721.9087	E	K	364	379
PSM	KEVIAVSCGPAQCQETI	335	sp|P38117|ETFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5829	23.73	2	1888.9023	1888.9023	V	R	59	76
PSM	KGAEAANVTGPGGVPVQGS	336	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4780	21.019	2	1694.8588	1694.8588	E	K	118	137
PSM	KGEVYPFGIVGMAN	337	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:35	ms_run[2]:scan=7194	27.126	2	1496.7334	1496.7334	M	K	597	611
PSM	KGLLSDSMTDVPVDTGVAA	338	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:35	ms_run[2]:scan=6468	25.164	2	1890.9245	1890.9245	N	R	15	34
PSM	KGLLSDSMTDVPVDTGVAA	339	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7221	27.205	2	1874.9295	1874.9295	N	R	15	34
PSM	KGPVFAPPYEPLPENV	340	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7377	27.784	2	1752.9087	1752.9087	H	K	223	239
PSM	KGQCPPPPGLPCPCTGVSDCSGGTD	341	sp|Q9NPF0-2|CD320_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:4,12-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=5523	23.099	3	2600.0764	2600.0764	Q	K	55	80
PSM	KGQMAMMEPGTEAMEPVEPEM	342	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,6-UNIMOD:35,7-UNIMOD:35,14-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=4521	20.065	3	2401.9456	2401.9456	E	K	334	355
PSM	KLELFLPEEYPMAAP	343	sp|P61088|UBE2N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:35	ms_run[2]:scan=7781	29.543	2	1762.8852	1762.8852	F	K	53	68
PSM	KLLSPYSPQTQETDSAVQ	344	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5651	23.371	2	1990.9848	1990.9848	S	K	47	65
PSM	KLPTPVNQATLSQTQGSE	345	sp|Q86T24|KAISO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5434	22.91	2	1897.9745	1897.9745	Q	K	248	266
PSM	KLSPPYSSPQEFAQDVG	346	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6816	26.04	2	1848.8894	1848.8894	E	R	668	685
PSM	KLTDSEDEFPEITEEME	347	sp|Q9P0U3-2|SENP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:35	ms_run[2]:scan=6788	25.973	2	2056.8671	2056.8671	H	K	412	429
PSM	KLVQAIFPTPDPAAL	348	sp|Q92793-2|CBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7740	29.347	2	1579.8974	1579.8974	H	K	569	584
PSM	KMDAPDGCPPAVYEVM	349	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6674	25.649	2	1794.7627	1794.7627	Y	K	404	420
PSM	KPEDWDEDMDGEWEAPQIANP	350	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:35	ms_run[2]:scan=7162	27.011	3	2487.0172	2487.0172	E	R	338	359
PSM	KPGPPQPAPAPEGQDL	351	sp|A8CG34|P121C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5032	21.816	2	1597.81	1597.8100	G	R	130	146
PSM	KQEPEVNGGSGDAVPSGNEVSENMEEEAENQAES	352	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	24-UNIMOD:35	ms_run[2]:scan=5065	21.901	3	3562.4762	3562.4762	A	R	397	431
PSM	KQLQEETPPGGPLTEALPPA	353	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6948	26.391	2	2072.079	2072.0790	V	R	138	158
PSM	KQPLPDEFGSSPLEPGACNGS	354	sp|Q13107-2|UBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	18-UNIMOD:4	ms_run[2]:scan=6684	25.679	2	2185.995	2185.9950	V	R	585	606
PSM	KSAEPSANTTLVSETEEEGSVPAFGAAA	355	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7047	26.667	3	2749.293	2749.2930	R	K	159	187
PSM	KSEGQEESFVPQSSVQPPEGDSET	356	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5692	23.459	3	2577.1355	2577.1354	C	K	514	538
PSM	KSGTAETEPVEQDSSQPSLPLV	357	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6847	26.111	2	2298.1227	2298.1227	L	R	817	839
PSM	KSPFVVQVGEACNPNAC	358	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6309	24.761	2	1875.8608	1875.8608	P	R	270	287
PSM	KSSASAPDVDDPEAFPALA	359	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7034	26.634	2	1886.8898	1886.8898	D	-	369	388
PSM	KTAQETSTMTMNVSQVDDVVSS	360	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5104	22.027	3	2389.0625	2389.0625	F	K	1716	1738
PSM	KTLSPGDSFSTFDTPYC	361	sp|Q9NQR4|NIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:4	ms_run[2]:scan=7157	26.999	2	1921.8404	1921.8404	S	R	130	147
PSM	KTVTNAVVTVPAYFNDSQ	362	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6853	26.125	2	1952.9844	1952.9844	G	R	137	155
PSM	KVASVDSAVAATTPTSMATVQ	363	sp|Q96C57|CSTOS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5950	23.972	2	2034.0303	2034.0303	K	K	199	220
PSM	KVSYIPDEQIAQGPENG	364	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5903	23.873	2	1843.8952	1843.8952	L	R	150	167
PSM	KVTAQGPGLEPSGNIAN	365	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5009	21.766	2	1651.8529	1651.8529	S	K	383	400
PSM	RAPESPPSADPALVAGPAEEAECPPP	366	sp|Q6EEV4-2|GL1AD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	23-UNIMOD:4	ms_run[2]:scan=6275	24.693	3	2611.2224	2611.2224	A	R	6	32
PSM	RDADEEGEGDEETPTSAPGSSLAG	367	sp|P36915-2|GNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4899	21.435	3	2375.9837	2375.9837	D	R	395	419
PSM	RDLQCPVLQSSELEGTPEVSC	368	sp|O75818-2|RPP40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6736	25.825	3	2403.1046	2403.1046	L	R	192	213
PSM	REEVDLSPAPESEVEAM	369	sp|Q9Y312|AAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:35	ms_run[2]:scan=5606	23.274	2	1902.8517	1902.8517	L	R	95	112
PSM	RLPEQPVDVPSEIADSSMT	370	sp|P18583-8|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7116	26.866	2	2069.9939	2069.9939	L	R	338	357
PSM	RPVTVEPMDQLDDEEGLPE	371	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7006	26.563	2	2167.9943	2167.9943	P	K	131	150
PSM	RVMTIPYQPMPASSPVICAGGQD	372	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=6209	24.555	3	2506.1655	2506.1655	G	R	177	200
PSM	RVMTIPYQPMPASSPVICAGGQD	373	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=6728	25.809	3	2490.1705	2490.1705	G	R	177	200
PSM	RPGVATPLVSSSDYMPMAPQNVSAS	374	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	15-UNIMOD:35	ms_run[1]:scan=6540	25.329791587200003	3	2578.222574	2577.220324	M	K	704	729
PSM	KAGEAPTENPAPPTQQSSAE	375	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4198	18.635330203466665	2	2009.921308	2008.933778	A	-	353	373
PSM	KEAAPDAGAEPITADSDPAYSS	376	sp|Q8N163|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5224	22.380213434666665	2	2161.969347	2161.965138	E	K	287	309
PSM	RWDYPEGTPNGGSTTLPSAPPPASAGL	377	sp|A0A0U1RRE5|NBDY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7179	27.066553111733334	3	2696.280320	2695.287809	P	K	33	60
PSM	KADVLTTGAGNPVGD	378	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5012	21.771	2	1413.71	1413.7100	Q	K	23	38
PSM	KAGEVINQPMMMAA	379	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=4225	18.76	2	1537.6939	1537.6939	Q	R	889	903
PSM	KALQDMSSTAPPAPQPST	380	sp|O15357-2|SHIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:35	ms_run[2]:scan=4320	19.17	2	1841.8829	1841.8829	L	R	42	60
PSM	KAPAGQEEPGTPPSSPLSAEQLD	381	sp|P13051-2|UNG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5927	23.925	3	2305.1074	2305.1074	K	R	41	64
PSM	KAQYYLPDGSTIEIGPS	382	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7553	28.487	2	1837.9098	1837.9098	E	R	238	255
PSM	KATEPPSPDAGELSLAS	383	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5758	23.594	2	1668.8206	1668.8206	S	R	719	736
PSM	KDATNVGDEGGFAPNILEN	384	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8090	30.817	2	1959.9174	1959.9174	G	K	202	221
PSM	KDATNVGDEGGFAPNILEN	385	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8189	31.17	2	1959.9174	1959.9174	G	K	202	221
PSM	KDATNVGDEGGFAPNILEN	386	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8302	31.569	2	1959.9174	1959.9174	G	K	202	221
PSM	KDGVLVDEFGLPQIPAS	387	sp|Q9NZZ3|CHMP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7885	30.049	2	1783.9356	1783.9356	N	-	203	220
PSM	KDILGPPMYEMEVSQ	388	sp|Q86WA8-2|LONP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6051	24.212	2	1767.8059	1767.8059	L	R	591	606
PSM	KDNTTLLTQVQTTM	389	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:35	ms_run[2]:scan=5770	23.613	2	1608.8029	1608.8029	L	R	365	379
PSM	KDPQQPAQQQQPAQQP	390	sp|O75909-1|CCNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3706	16.377	3	1815.8864	1815.8864	Q	K	305	321
PSM	KEADTDVQVCPNYSIPQ	391	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:4	ms_run[2]:scan=5911	23.888	2	1962.8993	1962.8993	L	K	230	247
PSM	KEAQAVPATLPELEAT	392	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6718	25.774	2	1666.8778	1666.8778	L	K	1081	1097
PSM	KEAVAPVQEESDLE	393	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5055	21.874	2	1542.7413	1542.7413	K	K	41	55
PSM	KEENPESDGEPVVEDGTSV	394	sp|Q13439-5|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5160	22.192	2	2015.8807	2015.8807	T	K	282	301
PSM	KEESDDEAAVEEEEEE	395	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4616	20.425	2	1865.7174	1865.7174	E	K	303	319
PSM	KELFPVLCQPDNPSV	396	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:4	ms_run[2]:scan=7430	27.993	2	1741.8709	1741.8709	L	R	116	131
PSM	KEPNPPIDEVISTPGVVA	397	sp|P52294|IMA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7125	26.897	2	1860.9833	1860.9833	S	R	112	130
PSM	KGELLGCFGLTEPNSGSDPSSMET	398	sp|Q92947-2|GCDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=7365	27.734	3	2528.1047	2528.1047	A	R	170	194
PSM	KIEPGVDPDDTYNETPYE	399	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5804	23.682	2	2080.9113	2080.9113	V	K	398	416
PSM	KIFQNAPTDPTQDFSTQVA	400	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6694	25.707	3	2107.0222	2107.0222	E	K	360	379
PSM	KIPDEFDNDPILVQQL	401	sp|Q3ZCQ8|TIM50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7813	29.696	2	1882.9676	1882.9676	A	R	97	113
PSM	KLEEDINSSMTNSTAAS	402	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:35	ms_run[2]:scan=4364	19.372	2	1812.8047	1812.8047	D	R	78	95
PSM	KLLGPDAAINLTDPDGALA	403	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7593	28.664	2	1863.9942	1863.9942	E	K	156	175
PSM	KLVTEMGTYATQSALSSS	404	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:35	ms_run[2]:scan=5373	22.773	2	1888.9088	1888.9088	Q	R	513	531
PSM	KNAVITVPAYFNDSQ	405	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7033	26.633	2	1665.8362	1665.8362	A	R	187	202
PSM	KPPAPPSLPAGPPGV	406	sp|Q15428|SF3A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6269	24.681	2	1380.7765	1380.7765	E	K	216	231
PSM	KPQEVPQENGMEDPSISFS	407	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=5871	23.809	3	2133.9525	2133.9525	Q	K	486	505
PSM	KPSTAYAPEGSPILMPAYT	408	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:35	ms_run[2]:scan=6506	25.256	2	2008.9816	2008.9816	L	R	47	66
PSM	KPVAVPEEQPVAESGLLA	409	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6692	25.702	2	1832.9884	1832.9884	S	R	320	338
PSM	KPVLMALAEGPGAEGP	410	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:35	ms_run[2]:scan=6515	25.273	2	1551.7967	1551.7967	T	R	493	509
PSM	KQPAIMPGQSYGLEDGSCSY	411	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	18-UNIMOD:4	ms_run[2]:scan=6521	25.283	3	2186.9613	2186.9613	S	K	322	342
PSM	KQQQMPPPPPPPPPPPPAGGTGG	412	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5215	22.358	3	2226.1256	2226.1256	S	K	623	646
PSM	KQQVTILATPLPEESM	413	sp|Q12846-2|STX4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:35	ms_run[2]:scan=6769	25.922	2	1799.9339	1799.9339	E	K	62	78
PSM	KSEDAEVLDATPSGIM	414	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:35	ms_run[2]:scan=5809	23.691	2	1677.7767	1677.7767	E	K	781	797
PSM	KSMPTVTQIPLEGSNVPQQPQY	415	sp|Q9NW08-2|RPC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:35	ms_run[2]:scan=6538	25.325	3	2457.221	2457.2210	N	K	772	794
PSM	KTAVDGPDLEMLTGQE	416	sp|Q14318|FKBP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=6604	25.483	2	1718.8033	1718.8033	L	R	201	217
PSM	KTCVPSTSAEDMSENVPIAEDTTEQP	417	sp|P24386|RAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=5511	23.069	3	2851.2375	2851.2375	D	K	185	211
PSM	KTELEDTLDSTAAQQEL	418	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6966	26.459	2	1890.9058	1890.9058	L	R	1145	1162
PSM	KTIDQFEYDGCDNCDAYLQM	419	sp|P63272|SPT4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=6661	25.622	3	2500.9821	2500.9821	V	K	23	43
PSM	KVAYIPDEMAAQQNPLQQP	420	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6886	26.223	3	2140.0623	2140.0623	L	R	150	169
PSM	KVFVGGLSPDTSEEQI	421	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6702	25.735	2	1704.857	1704.8570	K	K	115	131
PSM	KVLPMNTGVEAGETAC	422	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=4650	20.565	2	1691.7859	1691.7859	H	K	135	151
PSM	KVTGPQATTGTPLVTM	423	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6204	24.544	2	1600.8494	1600.8494	L	R	419	435
PSM	KYLLVPAFQGALTM	424	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:35	ms_run[2]:scan=7799	29.628	2	1566.848	1566.8480	L	K	77	91
PSM	RAVYDEQGTVDEDSPVLTQD	425	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5837	23.746	3	2236.0132	2236.0131	Q	R	75	95
PSM	RELPYDPVDTEGFGEGGDMQE	426	sp|Q8NC60|NOA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	19-UNIMOD:35	ms_run[2]:scan=6882	26.213	3	2355.9801	2355.9801	G	R	50	71
PSM	RPPLPSEGPGNIPPPPPTN	427	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5555	23.175	3	1933.0058	1933.0058	L	-	446	465
PSM	RSGPTDDGEEEMEEDTVTNGS	428	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:35	ms_run[2]:scan=4359	19.346	2	2269.8765	2269.8765	R	-	235	256
PSM	RSLDGAPIGVMDQSLM	429	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=5806	23.687	2	1720.8124	1720.8124	S	K	549	565
PSM	RTCETGEPMEAESGDTSSEGPAQVYLPG	430	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=6645	25.585	3	2954.2546	2954.2546	R	R	9	37
PSM	RVLVEPDAGAGVAVM	431	sp|P42126-2|ECI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:35	ms_run[2]:scan=5662	23.395	2	1498.7814	1498.7814	Q	K	46	61
PSM	KSDVLQPGAEVTTDD	432	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5010	21.767126096000002	2	1574.747421	1573.747146	L	R	913	928
PSM	KDDGISFSNQTGPAWAGSE	433	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6810	26.02666611333333	2	1967.880020	1965.870449	K	R	153	172
PSM	KTYITDPVSAPCAPPLQP	434	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	12-UNIMOD:4	ms_run[1]:scan=6785	25.961143616	2	1954.994974	1953.987000	K	K	353	371
PSM	RGFGDGYNGYGGGPGGGNFGGSPGYGGG	435	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6606	25.487417656266665	3	2495.018255	2494.032263	G	R	238	266
PSM	KDVDVSEDSPPPLPE	436	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5632	23.327519593066665	2	1622.758009	1622.767547	E	R	665	680
PSM	KAAAPAPEEEMDECEQALAAEP	437	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=6666	25.632	3	2356.0199	2356.0199	K	K	253	275
PSM	KAADIGVAMGQTGTDVC	438	sp|P98194-2|AT2C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=4774	20.999	2	1708.776	1708.7760	L	K	653	670
PSM	KAGAPPPSGSAVSTAPQQ	439	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3948	17.526	2	1649.8373	1649.8373	Q	K	241	259
PSM	KALDLVSDPEYINLM	440	sp|Q9H8M7|MINY3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:35	ms_run[2]:scan=7465	28.127	2	1735.8702	1735.8702	M	K	333	348
PSM	KAMDPQDLQNTEVPIATTA	441	sp|Q9H2M9|RBGPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6443	25.096	2	2041.999	2041.9990	L	K	1340	1359
PSM	KAVASLPPEQMFELM	442	sp|P33240-2|CSTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=6673	25.647	2	1721.8368	1721.8368	S	K	130	145
PSM	KAVETDVMNQETDPLCAEC	443	sp|Q8IZ73-2|RUSD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:35,16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5501	23.054	3	2224.9286	2224.9286	E	R	423	442
PSM	KAVTEGAQAVEEPSIC	444	sp|P28331-3|NDUS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	16-UNIMOD:4	ms_run[2]:scan=5191	22.281	2	1687.8087	1687.8087	V	-	601	617
PSM	KAVTVMMDPNSTQ	445	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=3777	16.719	2	1452.6589	1452.6589	V	R	15	28
PSM	KDEILPTTPISEQ	446	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6081	24.275	2	1469.7613	1469.7613	P	K	214	227
PSM	KDIDDDLEGEVTEECG	447	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=6219	24.575	2	1822.7415	1822.7415	P	K	413	429
PSM	KDLGVFIPAPMAQGM	448	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=6903	26.273	2	1605.7895	1605.7895	V	R	332	347
PSM	KDLYLIPLSAQDPVPS	449	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7633	28.851	2	1754.9455	1754.9455	V	K	1157	1173
PSM	KDPVTTGTPQPPQ	450	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4333	19.229	2	1364.6936	1364.6936	N	R	96	109
PSM	KDVQDSLTVSNEAQTA	451	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4735	20.868	2	1704.8166	1704.8166	H	K	210	226
PSM	KEDEIPETVSLEMLDAA	452	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:35	ms_run[2]:scan=7311	27.536	2	1904.8925	1904.8925	K	K	79	96
PSM	KEDPTAVACTFSCMM	453	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=6534	25.315	2	1762.7034	1762.7035	P	K	714	729
PSM	KEDVSTLIGDDLASC	454	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=7214	27.179	2	1621.7505	1621.7505	I	K	194	209
PSM	KEEETEAAIGAPPTATEGPET	455	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5140	22.13	3	2126.9855	2126.9855	V	K	472	493
PSM	KEEGITFPPAGSQTVSAAA	456	sp|O75886-2|STAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6797	25.992	2	1859.9265	1859.9265	M	K	137	156
PSM	KEELANAEYSPEEMPQLT	457	sp|Q8WW35|TC1D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=5795	23.661	2	2093.9463	2093.9463	L	K	53	71
PSM	KEFLPEGQDIGAFVAEQ	458	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7561	28.522	2	1876.9207	1876.9207	W	K	1208	1225
PSM	KEFQQYLPVVMGPLM	459	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=7517	28.333	2	1810.8998	1810.8998	G	K	557	572
PSM	KEIFEQPESVVNTM	460	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=6003	24.098	2	1665.792	1665.7920	Q	R	327	341
PSM	KELLELDSVETGGQDSV	461	sp|O95429-2|BAG4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7040	26.648	2	1817.8895	1817.8895	T	R	382	399
PSM	KEPGPIAPSTNSSPVL	462	sp|Q14674-2|ESPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5840	23.752	2	1592.841	1592.8410	A	K	789	805
PSM	KESLPPAAEPSPVS	463	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4868	21.325	2	1407.7246	1407.7246	M	K	310	324
PSM	KETPDTLSDPQTVPEEE	464	sp|O94822-2|LTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5130	22.097	2	1913.8742	1913.8742	I	R	200	217
PSM	KIFVGGLSPDTPEE	465	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6385	24.938	2	1487.7508	1487.7508	K	K	164	178
PSM	KITENIGCVMTGMTADS	466	sp|P60900-2|PSA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4,10-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=5025	21.799	2	1858.8111	1858.8111	F	R	52	69
PSM	KLAMQEFMILPVGAANF	467	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=7896	30.107	2	1910.9634	1910.9634	N	R	162	179
PSM	KLILPAPQIPPPNNA	468	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6864	26.163	2	1581.9243	1581.9243	G	R	1076	1091
PSM	KLLEPVVSMSDML	469	sp|O75351|VPS4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6554	25.364	2	1492.7517	1492.7517	D	R	403	416
PSM	KLSAFPEPPEDGTLLSEA	470	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7492	28.227	2	1899.9466	1899.9466	G	K	507	525
PSM	KLVDEDFPEDSSSQ	471	sp|A6NDU8|CE051_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5475	22.997	2	1594.6999	1594.6999	N	K	81	95
PSM	KMLLDPMGGIVMTNDGNAIL	472	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:35,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=7274	27.401	3	2150.0421	2150.0421	M	R	48	68
PSM	KPGMVVTFAPVNVTTEV	473	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35	ms_run[2]:scan=7263	27.356	2	1803.9441	1803.9441	L	K	273	290
PSM	KPQQASQAPTAPSVIPPAVE	474	sp|Q5T0F9-3|C2D1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6014	24.121	3	2015.0688	2015.0688	L	R	33	53
PSM	KQPAIMPGQSYGLEDGSCSY	475	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=5934	23.939	3	2202.9562	2202.9562	S	K	322	342
PSM	KSPDASSAFSPASPATPNGT	476	sp|Q53GS7-2|GLE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5180	22.245	2	1888.8803	1888.8803	P	K	87	107
PSM	KSPDLAPTPAPQSTP	477	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4855	21.283	2	1505.7726	1505.7726	D	R	291	306
PSM	KSSDDTTDAQMDEQDLNEPLA	478	sp|Q14BN4-4|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35	ms_run[2]:scan=5509	23.066	3	2337.9754	2337.9754	E	K	51	72
PSM	KSTAPETAIECTQAPAPASEDE	479	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:4	ms_run[2]:scan=5063	21.897	3	2302.0271	2302.0271	V	K	1584	1606
PSM	KTITYQAVPSEVPNEEP	480	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5802	23.679	2	1900.9418	1900.9418	A	K	210	227
PSM	KTPEVGPGPPPGPLS	481	sp|O15054|KDM6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5556	23.177	2	1428.7613	1428.7613	P	K	636	651
PSM	KTPPGVSAPTEPLLC	482	sp|P29558-2|RBMS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=6167	24.466	2	1565.8123	1565.8123	I	K	207	222
PSM	KTPPGVSAPTEPLLC	483	sp|P29558-2|RBMS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=6347	24.851	2	1565.8123	1565.8123	I	K	207	222
PSM	KTTTPGPSLSQGVSVDE	484	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5369	22.765	2	1701.8421	1701.8421	L	K	334	351
PSM	KVAYIPDEMAAQQNPLQQP	485	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:35	ms_run[2]:scan=6213	24.562	3	2156.0572	2156.0572	L	R	150	169
PSM	KVDNSSLTGESEPQT	486	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4372	19.409	2	1590.7373	1590.7373	C	R	181	196
PSM	KVGDGDLSAEEIPENEVSL	487	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7065	26.717	2	1999.9586	1999.9586	T	R	220	239
PSM	KVGLDPSQLPVGENGIV	488	sp|Q96GX9-3|MTNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7310	27.534	2	1720.9359	1720.9359	K	-	188	205
PSM	KVIGVLEPLDPEDYT	489	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7730	29.3	2	1686.8716	1686.8716	G	K	551	566
PSM	KVLAGETLSVNDPPDVLD	490	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6980	26.485	2	1880.9731	1880.9731	E	R	182	200
PSM	KVQEETTLVDDPFQM	491	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:35	ms_run[2]:scan=6973	26.472	2	1794.8346	1794.8346	E	K	57	72
PSM	RAIVDALPPPCESACTVPTDVD	492	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6757	25.885	3	2382.1195	2382.1195	A	K	260	282
PSM	RIPSAVGYQPTLATDMGTMQE	493	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	19-UNIMOD:35	ms_run[2]:scan=6649	25.593	3	2281.0719	2281.0719	G	R	324	345
PSM	RLLSMPGAQGAAAAGSEPPPATTSPEGQP	494	sp|Q96KQ7-3|EHMT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:35	ms_run[2]:scan=5285	22.544	3	2761.3341	2761.3341	M	K	150	179
PSM	RTQPSSGVDSAVGTLPATSPQSTSVQA	495	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5717	23.507	3	2628.2991	2628.2991	A	K	1016	1043
PSM	KDPGMGAMGGMGGGMGGGMF	496	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35	ms_run[1]:scan=5077	21.936676879733334	2	1865.689380	1865.687483	E	-	554	574
PSM	KTDMDNQIVVSDYAQMD	497	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	4-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=5505	23.061032188000002	2	2003.843925	2003.845223	P	R	257	274
PSM	KTDLNPDNLQGGDDLD	498	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35		ms_run[1]:scan=5650	23.368600582933333	2	1728.7795	1728.7797	H	P	107	123
PSM	RAIAELGIYPAVDPLDSTS	499	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7737	29.330990052266667	2	1987.018499	1987.026222	S	R	387	406
PSM	RQQPPQQPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQPQQF	500	sp|O95104|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35		ms_run[1]:scan=5218	22.3644513064	5	5140.5006	5140.4995	G	R	940	984
PSM	KPSQVNGAPGSPTEPAGQ	501	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4038	17.929153778933333	2	1721.823993	1720.838027	Q	K	1257	1275
PSM	KFVEEEDDDEEEEEENLDDQDEQGNL	502	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6177	24.483066049333335	3	3141.223340	3140.222547	K	K	29	55
PSM	KQDLPNAMNAAEITD	503	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	8-UNIMOD:35	ms_run[1]:scan=5156	22.17943560586667	2	1645.754146	1645.761751	N	K	127	142
PSM	KQDLPNAMNAAEITD	504	sp|P84077|ARF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	8-UNIMOD:35	ms_run[1]:scan=5186	22.265908131733333	2	1645.754146	1645.761751	N	K	127	142
PSM	KEITGIGPSTTTETETIA	505	sp|O75436|VP26A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=5712	23.49407058746667	2	1847.957067	1847.936404	K	K	214	232
PSM	KAAATGLPEGPAVPVPS	506	sp|Q8N1S5-2|S39AB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6084	24.28	2	1560.8512	1560.8512	K	R	156	173
PSM	KAAPEPQQPMELYQPSAESL	507	sp|Q96BH1|RNF25_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6958	26.424	3	2213.0674	2213.0674	L	R	213	233
PSM	KAAYPDLENPPLLVTPSQQA	508	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7332	27.612	3	2151.1212	2151.1212	I	K	17	37
PSM	KAENGPIDWSGDMPVSCSLS	509	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=6787	25.968	2	2164.9405	2164.9405	Q	R	251	271
PSM	KAPDGQTVAGEVMGPQ	510	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=4683	20.685	2	1599.7563	1599.7563	G	R	298	314
PSM	KAPPPSLTDCIGTVDS	511	sp|Q9NZZ3|CHMP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:4	ms_run[2]:scan=5900	23.869	2	1656.8029	1656.8029	P	R	11	27
PSM	KDDVAQTDLLQIDPNFGS	512	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7694	29.128	2	1974.9535	1974.9535	Q	K	168	186
PSM	KDEVDGGPPCAPGGTA	513	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:4	ms_run[2]:scan=4418	19.617	2	1526.6671	1526.6671	A	K	8	24
PSM	KDGDSVMVLPTIPEEEA	514	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35	ms_run[2]:scan=6912	26.302	2	1844.8714	1844.8714	W	K	182	199
PSM	KDLYANTVLSGGTTMYPGIAD	515	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	15-UNIMOD:35	ms_run[2]:scan=7876	30.006	3	2202.0514	2202.0515	R	R	291	312
PSM	KDSSSTNLESMDTS	516	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=3801	16.83	2	1516.6199	1516.6199	Q	-	1049	1063
PSM	KDVQDSLTVSNEAQTA	517	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5064	21.9	2	1704.8166	1704.8166	H	K	210	226
PSM	KEATNTTSEPSAPSQDLLDLSPSP	518	sp|O75674-2|TM1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7145	26.968	3	2484.1868	2484.1868	Q	R	301	325
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEG	519	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	25-UNIMOD:4	ms_run[2]:scan=4802	21.098	3	3412.3605	3412.3605	R	K	110	144
PSM	KESPPTVDSTQQPNPLPL	520	sp|Q15154-2|PCM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6500	25.242	2	1946.9949	1946.9949	H	R	1834	1852
PSM	KGCDESVDEVTAPCSCQDCSIVCGP	521	sp|O15118|NPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=6053	24.218	3	2829.102	2829.1020	T	K	225	250
PSM	KGPEDYPEEGVEESSGEAS	522	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4925	21.501	2	1994.8229	1994.8229	A	K	1121	1140
PSM	KGSVSLTTGQPVDQPTTESCSTL	523	sp|Q9H582-2|ZN644_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	20-UNIMOD:4	ms_run[2]:scan=5681	23.438	3	2392.1428	2392.1428	N	K	133	156
PSM	KGVDIVMDPLGGSDTA	524	sp|Q99536-2|VAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35	ms_run[2]:scan=6469	25.165	2	1589.7607	1589.7607	P	K	121	137
PSM	KIEDVPAPSTSAD	525	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4658	20.594	2	1328.646	1328.6460	D	K	20	33
PSM	KILDSVGIEADDD	526	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5910	23.885	2	1388.6671	1388.6671	K	R	25	38
PSM	KIMVGSTDDPSVFSLPDS	527	sp|O43741|AAKB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35	ms_run[2]:scan=7302	27.504	2	1909.8979	1909.8979	H	K	34	52
PSM	KLDEMEFNPVQQPQLNE	528	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:35	ms_run[2]:scan=6475	25.175	3	2073.9677	2073.9677	E	K	59	76
PSM	KLEAEGEAMEDAAAPGDD	529	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=4494	19.942	2	1833.7575	1833.7575	L	R	399	417
PSM	KLEEDISSSMTNSTAAS	530	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:35	ms_run[2]:scan=4447	19.749	2	1785.7938	1785.7938	D	R	78	95
PSM	KLLQTCFSSPADDSMD	531	sp|Q9NZL4-2|HPBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=5958	23.992	2	1829.7812	1829.7812	E	R	240	256
PSM	KLLSPVVPQISAPQSN	532	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6705	25.742	2	1676.9461	1676.9461	N	K	521	537
PSM	KLLTECPPMMDTEYT	533	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6231	24.6	2	1843.8042	1843.8042	T	K	792	807
PSM	KLPEEVATPTTDEE	534	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5092	21.981	2	1557.741	1557.7410	Q	K	350	364
PSM	KLPGQEGAAAPGEAGAVCL	535	sp|Q7Z2K8-2|GRIN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	18-UNIMOD:4	ms_run[2]:scan=6186	24.504	2	1794.8934	1794.8934	T	K	641	660
PSM	KLPSTDQQESCSSTPGLEEPLF	536	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4	ms_run[2]:scan=7380	27.797	3	2449.1319	2449.1319	G	K	1172	1194
PSM	KLQDLAGGIFPEDEIPE	537	sp|P56182|RRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7803	29.646	2	1869.936	1869.9360	R	K	330	347
PSM	KLVFGEDGAPAPPPPGS	538	sp|Q12968-5|NFAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6034	24.166	2	1634.8304	1634.8304	F	R	15	32
PSM	KPADVYLIDEPSAYLDSEQ	539	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7576	28.586	2	2152.0212	2152.0212	G	R	478	497
PSM	KPEPVLEETAPEDAQ	540	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5074	21.928	2	1651.7941	1651.7941	E	K	214	229
PSM	KPLEPVSTVQVEPAV	541	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6163	24.46	2	1591.8821	1591.8821	E	K	1105	1120
PSM	KPMDTSVLSEEGGEPFQ	542	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35	ms_run[2]:scan=6201	24.538	2	1865.8353	1865.8353	D	K	390	407
PSM	KPSTAYAPEGSPILMPAYT	543	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7211	27.17	2	1992.9867	1992.9867	L	R	47	66
PSM	KQLPLEPESPSGQVGP	544	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5803	23.68	2	1661.8625	1661.8625	S	R	62	78
PSM	KSLGEGPPANPPVPVLQS	545	sp|Q5HYK7-3|SH319_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6370	24.909	2	1785.9625	1785.9625	Y	K	180	198
PSM	KSLTINGVADDDALAEE	546	sp|O75190-4|DNJB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6408	25	2	1759.8476	1759.8476	L	R	176	193
PSM	KSPSPPDGSPAATPEI	547	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5286	22.546	2	1549.7624	1549.7624	N	R	264	280
PSM	KSQLLAPPPPSAPPGN	548	sp|P49750-3|YLPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5287	22.548	2	1569.8515	1569.8515	S	K	241	257
PSM	KSSDDTTDAQMDEQDLNEPLA	549	sp|Q14BN4-4|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5994	24.073	3	2321.9805	2321.9805	E	K	51	72
PSM	KSVPLATAPMAEQ	550	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:35	ms_run[2]:scan=4603	20.381	2	1357.6912	1357.6912	L	R	577	590
PSM	KTETVEEPMEEEEAA	551	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=4361	19.356	2	1736.7298	1736.7298	S	K	285	300
PSM	KTFEGVDPQTTSM	552	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=4766	20.973	2	1455.6552	1455.6552	P	R	156	169
PSM	KTILDPLTLVQGNQNED	553	sp|Q5W0B1|OBI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7732	29.311	2	1896.9793	1896.9793	I	K	125	142
PSM	KTITLEVEPSDTIENV	554	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6969	26.464	2	1786.92	1786.9200	G	K	11	27
PSM	KTLEPICDADPSALA	555	sp|Q5T8P6-2|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=6339	24.839	2	1599.7814	1599.7814	S	K	19	34
PSM	KTQTPPVSPAPQPTEE	556	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4472	19.852	2	1705.8523	1705.8523	A	R	361	377
PSM	KTVDSQGPTPVCTPTFLE	557	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:4	ms_run[2]:scan=6924	26.332	2	1975.9561	1975.9561	E	R	226	244
PSM	KTVQGPPTSDDIFE	558	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6218	24.573	2	1532.7359	1532.7359	K	R	32	46
PSM	KVAMPVELNEPLNTLQ	559	sp|Q9H4L5-8|OSBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:35	ms_run[2]:scan=6752	25.874	2	1810.9499	1810.9499	S	R	475	491
PSM	KVTDDMYAEQTENPENPL	560	sp|Q2TAL8|QRIC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:35	ms_run[2]:scan=5674	23.421	2	2108.9208	2108.9208	Q	R	682	700
PSM	KVVPSFLPVDQGGSLVG	561	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7575	28.58	2	1697.9352	1697.9352	D	R	667	684
PSM	RAEPGQQQPAAEPPPAEGLL	562	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6430	25.058	3	2055.0385	2055.0385	E	R	16	36
PSM	RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA	563	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5519	23.085	4	3327.6789	3327.6789	N	R	214	245
PSM	REVPVPTPAPVEVPVPE	564	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6983	26.492	2	1810.9829	1810.9829	P	R	1082	1099
PSM	RFELPMGTTEQPPLPQQTQPPA	565	sp|O95639-3|CPSF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:35	ms_run[2]:scan=6726	25.803	3	2478.2213	2478.2213	P	K	168	190
PSM	RITPEPAVSNTEEPSTTSTASNYPDVLT	566	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6523	25.286	3	2976.42	2976.4200	G	R	100	128
PSM	RLILPVGPAGGNQMLEQYD	567	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:35	ms_run[2]:scan=7293	27.471	3	2086.0517	2086.0517	G	K	178	197
PSM	RPGAEGAPLLPPPLPPPSPPGSG	568	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7203	27.151	3	2157.1582	2157.1582	E	R	26	49
PSM	RPGAEGAPLLPPPLPPPSPPGSG	569	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7313	27.543	3	2157.1582	2157.1582	E	R	26	49
PSM	RTPSAFPQTPAAPPATLGEGSADTED	570	sp|Q9H9B1-4|EHMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6300	24.742	3	2583.2089	2583.2089	G	R	163	189
PSM	RTVSLPPPDLGTGTDGPAGSDTSPF	571	sp|Q96FX7|TRM61_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7187	27.105	3	2441.171	2441.1710	V	R	241	266
PSM	RYFEADPPGQVAASPDPTT	572	sp|O43598|DNPH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5684	23.443	2	2017.9381	2017.9381	D	-	156	175
PSM	KTIGGGDDSFNTFFSETGAG	573	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7356	27.70408216986667	2	2007.871240	2006.885765	D	K	40	60
PSM	KNVIVNGLVLASDGQ	574	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7000	26.541304721333333	2	1526.833490	1525.846407	F	K	585	600
PSM	KEAYMGNVLQGGEGQAPT	575	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5831	23.73443573706667	2	1850.869643	1848.867613	V	R	87	105
PSM	KTAENATSGETLEENEAGD	576	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4328	19.204128544533333	2	1965.830739	1964.844688	S	-	376	395
PSM	KAISALVPQGGPVLC	577	sp|Q13330|MTA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	15-UNIMOD:4	ms_run[1]:scan=6872	26.182125493333334	2	1508.835958	1508.838485	S	R	267	282
PSM	KEILVGDVGQTVDD	578	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34		ms_run[1]:scan=5913	23.891117958133336	2	1486.7522	1486.7510	G	P	53	67
PSM	KVAPGPSSGSTPGQVPGSSALSSP	579	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5320	22.649159692	3	2152.068732	2151.080777	L	R	1360	1384
PSM	KAGTATSPAGSSPAVAGGTQ	580	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3968	17.615	2	1714.8486	1714.8486	R	R	591	611
PSM	KAILAGAQPIEEM	581	sp|Q8WWK9-6|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:35	ms_run[2]:scan=5406	22.848	2	1385.7225	1385.7225	E	R	437	450
PSM	KALAPEPPVSQELPCSSEGS	582	sp|Q66K89|E4F1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:4	ms_run[2]:scan=5742	23.56	2	2081.9939	2081.9939	M	R	347	367
PSM	KALDIAENEMPGLM	583	sp|P23526|SAHH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=5614	23.29	2	1562.732	1562.7320	R	R	20	34
PSM	KAMDQEITVNPQFVQ	584	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35	ms_run[2]:scan=6158	24.451	2	1762.856	1762.8560	L	K	371	386
PSM	KAMSTLVPQGGPVLC	585	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=6070	24.253	2	1572.8004	1572.8004	A	R	74	89
PSM	KAMSTLVPQGGPVLC	586	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:4	ms_run[2]:scan=6625	25.532	2	1556.8055	1556.8055	A	R	74	89
PSM	KCISEVQANNVVLGQYVGNPDGEGEAT	587	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=6842	26.1	3	2847.3345	2847.3345	L	K	293	320
PSM	KDAGMPIQGQPCFC	588	sp|Q9H9G7-2|AGO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:35,12-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5255	22.47	2	1623.6844	1623.6844	S	K	246	260
PSM	KDASVPLIDVTNLPTP	589	sp|Q96A65-2|EXOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7731	29.305	2	1678.9142	1678.9142	V	R	223	239
PSM	KDDAAPAPPVADA	590	sp|Q92667-2|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4558	20.209	2	1236.5986	1236.5986	A	K	281	294
PSM	KDGDSVMVLPTIPEEEA	591	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7457	28.103	2	1828.8764	1828.8764	W	K	182	199
PSM	KDGEEVVESPALLLQ	592	sp|O75147-2|OBSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7434	28.012	2	1625.8512	1625.8512	T	K	933	948
PSM	KDGLNDDDFEPYLSPQA	593	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7264	27.358	2	1922.8534	1922.8534	Q	R	26	43
PSM	KDLGVFIPAPMAQGM	594	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=7352	27.692	2	1589.7946	1589.7946	V	R	332	347
PSM	KDLGVFIPAPMAQGM	595	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7809	29.679	2	1573.7997	1573.7997	V	R	332	347
PSM	KDPFDTLATMTDQQ	596	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7555	28.497	2	1609.7294	1609.7294	E	R	993	1007
PSM	KDVEGSTSPQIGD	597	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4234	18.806	2	1331.6205	1331.6205	A	K	444	457
PSM	KEEAPDILCLQET	598	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:4	ms_run[2]:scan=6955	26.412	2	1544.7392	1544.7392	V	K	85	98
PSM	KEEPADFPVEQPEEN	599	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5411	22.856	2	1756.7792	1756.7792	A	-	362	377
PSM	KEGPTLSVPMVQGECLL	600	sp|Q9BQ52-3|RNZ2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=7470	28.143	2	1872.9325	1872.9325	A	K	35	52
PSM	KEMASLSAAAITVPPSVPS	601	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35	ms_run[2]:scan=6567	25.4	2	1870.971	1870.9710	K	R	551	570
PSM	KEPAPPNGSAAEPPTEAAS	602	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4351	19.307	3	1819.8588	1819.8588	P	R	294	313
PSM	KEPEGEEQEPQEMDIDEIL	603	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:35	ms_run[2]:scan=7172	27.039	3	2272.9893	2272.9893	F	K	978	997
PSM	KEQVLEPMLNGTD	604	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=5374	22.775	2	1488.713	1488.7130	Y	K	952	965
PSM	KEQVLEPMLNGTE	605	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=5418	22.868	2	1502.7287	1502.7287	Y	K	936	949
PSM	KETDGTEGTVEIETV	606	sp|Q8WY54|PPM1E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5597	23.253	2	1606.7574	1606.7574	P	K	185	200
PSM	KFQSCLSPEEPAPESPQVPEAPGGSAV	607	sp|Q99576-4|T22D3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:4	ms_run[2]:scan=6474	25.173	3	2794.312	2794.3120	E	-	96	123
PSM	KIETTVPPSGLNLN	608	sp|P26358-3|DNMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6798	25.996	2	1481.809	1481.8090	N	R	194	208
PSM	KIGQQPQQPGAPPQQDYT	609	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4725	20.837	3	1979.9701	1979.9701	K	K	628	646
PSM	KIIPLYSTLPPQQQQ	610	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7213	27.176	2	1752.9774	1752.9774	I	R	384	399
PSM	KILDQGEDFPASEMT	611	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:35	ms_run[2]:scan=5574	23.213	2	1695.7662	1695.7662	G	R	208	223
PSM	KILDSVGIEADDD	612	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6102	24.317	2	1388.6671	1388.6671	K	R	25	38
PSM	KILIANTGMDTD	613	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35	ms_run[2]:scan=4910	21.457	2	1306.6439	1306.6439	A	K	189	201
PSM	KIVLTNPVCTEVGE	614	sp|Q2VIR3|IF2GL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:4	ms_run[2]:scan=6388	24.942	2	1557.8072	1557.8072	G	K	426	440
PSM	KLDFIESDSPCSSEALS	615	sp|O43432-4|IF4G3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=6759	25.891	2	1883.8459	1883.8459	Q	K	1121	1138
PSM	KLDQLDGSFDDPNTVVA	616	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6878	26.202	2	1832.8792	1832.8792	E	K	186	203
PSM	KLEEDISSSMTNSTAAS	617	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5310	22.62	2	1769.7989	1769.7989	D	R	78	95
PSM	KLEEGGPVYSPPAEVVV	618	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6832	26.077	2	1768.9247	1768.9247	K	K	133	150
PSM	KLEESSTIGQDQTLME	619	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35	ms_run[2]:scan=5136	22.116	2	1823.8459	1823.8459	E	R	313	329
PSM	KLGGAVPFAPPEVSPEQA	620	sp|Q6ZSR9|YJ005_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7011	26.581	2	1792.9359	1792.9359	G	K	80	98
PSM	KLGPPGLPPLPGP	621	sp|Q15637-5|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7334	27.62	2	1238.7387	1238.7387	G	K	12	25
PSM	KLLTECPPMMDTEYT	622	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4,9-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5409	22.853	2	1859.7991	1859.7991	T	K	792	807
PSM	KLLTECPPMMDTEYT	623	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=6043	24.185	2	1843.8042	1843.8042	T	K	792	807
PSM	KLPSIPLVPVSAQ	624	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7458	28.107	2	1347.8126	1347.8126	L	K	143	156
PSM	KLTITSNPEMTFPGE	625	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=6308	24.758	2	1679.8076	1679.8076	A	R	699	714
PSM	KLVSTATTAPPSTAPSGPGSVQ	626	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4904	21.443	3	2053.0691	2053.0691	V	K	573	595
PSM	KMDAPDGCPPAVYEVM	627	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=5853	23.771	2	1794.7627	1794.7627	Y	K	404	420
PSM	KMIIEDVLSPDTCVC	628	sp|Q92917|GPKOW_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7121	26.881	2	1794.8202	1794.8202	T	R	380	395
PSM	KNIDDESLPSSIQTMSC	629	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=5631	23.324	2	1939.8503	1939.8503	A	K	404	421
PSM	KPAPVPAEPFDNTTY	630	sp|P56181|NDUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6241	24.62	2	1645.7988	1645.7988	K	K	57	72
PSM	KPQPLQQPSQPQQPPPTQQAVA	631	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4789	21.051	3	2392.2499	2392.2499	L	R	3	25
PSM	KSAEIDSDDTGGSAAQ	632	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3715	16.422	2	1550.6696	1550.6696	K	K	813	829
PSM	KSLLDIISDPDAGTPED	633	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7908	30.164	2	1784.868	1784.8680	D	K	344	361
PSM	KSSGPTSLFAVTVAPPGA	634	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7455	28.097	2	1685.8988	1685.8988	G	R	186	204
PSM	KTAVVVGTITDDV	635	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6245	24.628	2	1316.7187	1316.7187	N	R	49	62
PSM	KTGQATVASGIPAGWMGLDCGPESS	636	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=7025	26.616	3	2492.1312	2492.1312	A	K	269	294
PSM	KTLIPPQPPDVASP	637	sp|Q9H0E3-2|SP130_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5961	24.003	2	1458.8082	1458.8082	R	R	214	228
PSM	KTTTLSGTAPAAGVVPS	638	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5230	22.399	2	1556.841	1556.8410	K	R	698	715
PSM	KTVGIDDLTGEPLIQ	639	sp|Q9UIJ7-2|KAD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7355	27.701	2	1597.8563	1597.8563	P	R	76	91
PSM	KTVTLPENEDELESTN	640	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5545	23.154	2	1817.8531	1817.8531	G	R	869	885
PSM	KVAALTGLPFVTAPN	641	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7648	28.912	2	1497.8555	1497.8555	A	K	253	268
PSM	KVAAPDVVVPTLDTV	642	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7300	27.495	2	1522.8607	1522.8607	H	R	2561	2576
PSM	KVAQMPQEEVELLPPAP	643	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:35	ms_run[2]:scan=6894	26.243	2	1890.9761	1890.9761	Q	K	136	153
PSM	KVEYTLGEESEAPGQ	644	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5273	22.515	2	1635.7628	1635.7628	Q	R	1225	1240
PSM	KVIVVGNPANTNCLTAS	645	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:4	ms_run[2]:scan=5624	23.311	2	1756.9142	1756.9142	V	K	36	53
PSM	KVLEQLTGQTPVFS	646	sp|P62913-2|RL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6870	26.177	2	1545.8403	1545.8403	A	K	37	51
PSM	KVPSALAPASQEPSPAASAEADG	647	sp|O00429-7|DNM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5268	22.503	3	2150.0491	2150.0491	S	K	332	355
PSM	KVPSPLEGSEGDGDTD	648	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5002	21.742	2	1601.7057	1601.7057	A	-	384	400
PSM	RLASEPQDPAAVSLPTSSVPET	649	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6405	24.991	3	2251.1332	2251.1332	Q	R	84	106
PSM	RPGVATPLVSSSDYMPMAPQNVSAS	650	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=6060	24.234	3	2593.2152	2593.2152	M	K	704	729
PSM	RSAELEFPLDEPDSMGADPGPPDE	651	sp|Q8WYQ5-3|DGCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35	ms_run[2]:scan=7272	27.394	3	2586.1068	2586.1068	S	K	384	408
PSM	RTDASSASSFLDSDELE	652	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7133	26.927	2	1828.7963	1828.7963	E	R	307	324
PSM	RTVLVNADGEEVAM	653	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:35	ms_run[2]:scan=5087	21.968	2	1518.7348	1518.7348	F	R	561	575
PSM	RVELPGTAVPSVPEDAAPAS	654	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6460	25.15	2	1962.0058	1962.0058	A	R	31	51
PSM	KDATNVGDEGGFAPNILEN	655	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7998	30.490865387733333	2	1960.920454	1959.917400	G	K	202	221
PSM	KDYEEVGVDSVEGEGEEEGEEY	656	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8258	31.409419627466665	2	2476.992771	2475.992534	E	-	430	452
PSM	KDSEDMGVVVSLGTGN	657	sp|P55265|DSRAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	6-UNIMOD:35	ms_run[1]:scan=5664	23.400548312	2	1622.758009	1622.745767	K	R	876	892
PSM	KSTAPETAIECTQAPAPASEDE	658	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	11-UNIMOD:4	ms_run[1]:scan=5050	21.866025211733334	3	2302.026864	2302.027086	V	K	1584	1606
PSM	RQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSE	659	sp|Q06587|RING1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	25-UNIMOD:4	ms_run[1]:scan=6975	26.475963157866666	4	4603.949911	4603.950193	R	K	308	359
PSM	KEGEEEEENTEEPPQGEEEESMETQE	660	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4799	21.089432565600003	3	3052.181866	3051.178239	K	-	365	391
PSM	KADIGVAMGIAGSDVS	661	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:35	ms_run[2]:scan=5464	22.972	2	1505.7396	1505.7396	K	K	696	712
PSM	KAEDEDIVLTPDGT	662	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5816	23.703	2	1501.7148	1501.7148	L	R	557	571
PSM	KALLGPAPEDEDE	663	sp|Q96EK5|KBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5131	22.1	2	1382.6565	1382.6565	V	R	47	60
PSM	KAPVSYPNTLPESFT	664	sp|Q8WX92|NELFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6805	26.012	2	1649.8301	1649.8301	E	K	398	413
PSM	KAVGTPGGGGGGAVPGISAMS	665	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	20-UNIMOD:35	ms_run[2]:scan=5071	21.92	2	1742.8621	1742.8621	P	R	1336	1357
PSM	KAYVDDTPAEQM	666	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=4129	18.312	2	1382.6024	1382.6024	G	K	288	300
PSM	KDIELSDDPYDCI	667	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:4	ms_run[2]:scan=6928	26.341	2	1581.6869	1581.6869	S	R	178	191
PSM	KDVSGPMPDSYSP	668	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5279	22.527	2	1378.6075	1378.6075	K	R	290	303
PSM	KECEGIVPVPLAE	669	sp|P82932|RT06_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:4	ms_run[2]:scan=6893	26.24	2	1439.733	1439.7330	L	K	103	116
PSM	KEEDGSLSLDGADSTGVVA	670	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6099	24.314	2	1848.8589	1848.8589	L	K	594	613
PSM	KEEDGSLSLDGADSTGVVA	671	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7847	29.868	2	1848.8589	1848.8589	L	K	594	613
PSM	KEELQANGSAPAAD	672	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3997	17.741	2	1399.6579	1399.6579	A	K	55	69
PSM	KEEPGSDSGTTAVVALI	673	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7267	27.374	2	1672.8519	1672.8519	G	R	320	337
PSM	KEPELLEPIPYEFMA	674	sp|P46778|RL21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=7862	29.941	2	1820.8906	1820.8906	G	-	146	161
PSM	KEPIEEEPTGAGLN	675	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4980	21.658	2	1482.7202	1482.7202	S	K	232	246
PSM	KETIPLQETSLYTQD	676	sp|P50897-2|PPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6482	25.191	2	1764.8782	1764.8782	A	R	150	165
PSM	KETSEELLPPPVQTQI	677	sp|Q8N183|NDUF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7060	26.703	2	1807.9567	1807.9567	S	K	114	130
PSM	KEVNVSPCPTQPCQLS	678	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5068	21.91	2	1842.8604	1842.8604	I	K	35	51
PSM	KFIQQTYPSGGEEQAQYC	679	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	18-UNIMOD:4	ms_run[2]:scan=5391	22.817	3	2132.9473	2132.9473	V	R	23	41
PSM	KGAEEMETVIPVDVM	680	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=6175	24.481	2	1678.7794	1678.7794	A	R	12	27
PSM	KGDGPVQGIINFEQ	681	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7231	27.241	2	1500.7573	1500.7573	L	K	10	24
PSM	KGDILVVATGQPEMV	682	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=6497	25.232	2	1571.8229	1571.8229	N	K	208	223
PSM	KGIINDDEDDEDLMMASG	683	sp|O75717-2|WDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5366	22.756	2	1998.8034	1998.8034	S	R	228	246
PSM	KIGPILDNSTLQSEV	684	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7002	26.549	2	1612.8672	1612.8672	Q	K	546	561
PSM	KIISNASCTTNCLAPLA	685	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6187	24.507	2	1832.9125	1832.9125	L	K	103	120
PSM	KLGIYDADGDGDFDVDDA	686	sp|Q12797-7|ASPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7134	26.928	2	1899.801	1899.8010	G	K	101	119
PSM	KLLEPVVCMSDML	687	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:4,9-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6620	25.522	2	1565.7503	1565.7503	D	R	396	409
PSM	KLLGASELPIVTPAL	688	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7833	29.796	2	1520.9178	1520.9178	V	R	300	315
PSM	KLQPLSPVPSDIEIS	689	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7149	26.98	2	1621.8927	1621.8927	L	R	352	367
PSM	KLVVECVMNNVTCT	690	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=5437	22.917	2	1681.7837	1681.7837	G	R	115	129
PSM	KMEEVAEAAPQELDTIALASE	691	sp|Q8IZ73-2|RUSD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=7400	27.873	3	2260.0781	2260.0781	Q	K	402	423
PSM	KMIIEDVLSPDTCVC	692	sp|Q92917|GPKOW_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7122	26.884	2	1794.8202	1794.8202	T	R	380	395
PSM	KNTPSPDVTLGTNPGTEDIQFPIQ	693	sp|Q8IX01-4|SUGP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7501	28.263	3	2568.2708	2568.2708	Q	K	273	297
PSM	KPEGLPPISDVVLD	694	sp|O43432-4|IF4G3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7513	28.316	2	1477.8028	1477.8028	Q	K	361	375
PSM	KPQPPVVQPPEEAMSGQQS	695	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=4815	21.147	3	2048.9837	2048.9837	A	R	752	771
PSM	KPVGSDPDFQPELSGAGS	696	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5855	23.775	2	1786.8374	1786.8374	V	R	5	23
PSM	KPVPDEEPNSTDVEETLE	697	sp|P28289-2|TMOD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5860	23.784	2	2026.9219	2026.9219	Y	R	44	62
PSM	KPVVPSVPMASPAPG	698	sp|Q9BTC0-1|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=5283	22.539	2	1448.7697	1448.7697	R	R	640	655
PSM	KQQEVVVAGSSLPTSS	699	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5250	22.455	2	1615.8417	1615.8417	Q	K	306	322
PSM	KSDIGEVILVGGMT	700	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35	ms_run[2]:scan=6824	26.063	2	1433.7436	1433.7436	S	R	377	391
PSM	KSLDDDLDGVPLDATEDS	701	sp|O15042-3|SR140_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6889	26.229	2	1903.8535	1903.8535	I	K	321	339
PSM	KSPDSVNGSEPSIPQSGDTQSFAQ	702	sp|Q13439-5|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5515	23.078	3	2462.1197	2462.1197	S	K	62	86
PSM	KTAESQTPTPSATSFFSG	703	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6713	25.765	2	1842.8636	1842.8636	E	K	300	318
PSM	KTAFQEALDAAGD	704	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5823	23.715	2	1335.6307	1335.6307	S	K	8	21
PSM	KTAQETSTMTMNVSQVDDVVSS	705	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5109	22.04	3	2389.0625	2389.0625	F	K	1716	1738
PSM	KTDMDNQIVVSDYAQMD	706	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:35	ms_run[2]:scan=6336	24.833	2	1987.8503	1987.8503	P	R	227	244
PSM	KTEDGGEFEEGASENNA	707	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4469	19.844	2	1782.718	1782.7180	E	K	433	450
PSM	KTGIDQLVVTPISQAQA	708	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7032	26.63	2	1767.9731	1767.9731	S	K	868	885
PSM	KTLIDDDNPPVSFV	709	sp|P61964|WDR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7330	27.607	2	1558.7879	1558.7879	L	K	207	221
PSM	KTMQFEPSTMVYDAC	710	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,10-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=5495	23.044	2	1838.7525	1838.7525	V	R	15	30
PSM	KTTLPTFQSPEFSVT	711	sp|Q9Y5X3|SNX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7358	27.711	2	1681.8563	1681.8563	T	R	52	67
PSM	KTTYLEDLPPPPEYELAPS	712	sp|Q12849|GRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7441	28.042	3	2159.0674	2159.0674	S	K	122	141
PSM	KVEDVSAVEIVGGAT	713	sp|Q92598-3|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6373	24.916	2	1472.7722	1472.7722	L	R	290	305
PSM	KVIPDDLAQQNLIVSNTEAPGDD	714	sp|Q02487-2|DSC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6990	26.509	3	2451.2129	2451.2129	P	K	726	749
PSM	KVIVVGNPANTNCLTAS	715	sp|P40925-2|MDHC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:4	ms_run[2]:scan=5615	23.292	2	1756.9142	1756.9142	V	K	36	53
PSM	KVLELDPALAPVVS	716	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7397	27.864	2	1449.8443	1449.8443	A	R	290	304
PSM	KVLGMDPLPQMSQ	717	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5185	22.263	2	1474.716	1474.7160	H	R	1028	1041
PSM	KVPEVPTAPATDAAP	718	sp|Q9UHD8-3|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5351	22.717	2	1462.7668	1462.7668	S	K	7	22
PSM	KVVDLLAQDADIVC	719	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4	ms_run[2]:scan=7410	27.914	2	1557.8072	1557.8072	G	R	45	59
PSM	RAAVEDINPADDPNNQGEDEFEEAEQV	720	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6851	26.12	3	3000.2857	3000.2857	D	R	542	569
PSM	RDPGVITYDLPTPPGE	721	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7035	26.636	2	1725.8574	1725.8574	K	K	273	289
PSM	RPGDTTSTFCGTPNYIAPEIL	722	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:4	ms_run[2]:scan=7726	29.282	3	2309.0998	2309.0998	L	R	405	426
PSM	RPPAPESVGTEEMPEDGEPDAAEL	723	sp|Q86TM6-2|SYVN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35	ms_run[2]:scan=5915	23.896	3	2538.1068	2538.1068	E	R	528	552
PSM	KEEDGSLSLDGADSTGVVA	724	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8307	31.587687428	2	1849.855564	1848.858882	L	K	676	695
PSM	KEEDGSLSLDGADSTGVVA	725	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8000	30.497775934666667	2	1849.861537	1848.858882	L	K	676	695
PSM	KDYEEVGVDSVEGEGEEEGEEY	726	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8156	31.051169996533336	2	2478.004490	2475.992534	E	-	430	452
PSM	KSDVLQPGAEVTTDD	727	sp|P53992|SC24C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5019	21.78608866293333	2	1574.747421	1573.747146	L	R	913	928
PSM	KETEPTVTTSDAAVDLSSF	728	sp|O75970|MPDZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7248	27.30505138133333	2	1996.952851	1996.947697	N	K	1460	1479
PSM	KDTIIDVVGAPLTPNS	729	sp|Q9NPF5|DMAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7363	27.728834075199998	2	1638.891172	1638.882852	P	R	433	449
PSM	KLMTIMDSMNDQELDSTDGA	730	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=5808	23.689646366133335	3	2246.941111	2245.938866	K	K	374	394
PSM	KQPQPPPPPPPAAAQPPPGAP	731	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5280	22.532145813066666	3	2036.084014	2036.084346	N	R	16	37
PSM	KDIAGSGDGTQEVS	732	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3866	17.151748914666666	2	1362.626651	1362.626303	E	K	196	210
PSM	KLLVDVDESTLSPEEQ	733	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6754	25.8786234512	2	1801.917232	1800.899290	D	K	477	493
PSM	KEDEIPETVSLEMLDAA	734	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	13-UNIMOD:35	ms_run[1]:scan=7304	27.51502294133333	2	1904.894237	1904.892490	K	K	79	96
PSM	KAFDLVPPEAVPEQ	735	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7014	26.59	2	1538.7981	1538.7981	F	K	129	143
PSM	KAGDTVSYVICQDGSNLTASQ	736	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=6533	25.312	3	2213.027	2213.0270	V	R	1170	1191
PSM	KALELSGTAVPPDLE	737	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6664	25.627	2	1538.8192	1538.8192	I	K	736	751
PSM	KALTLPGSSENEYIM	738	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=6364	24.898	2	1667.8076	1667.8076	F	K	503	518
PSM	KAQGGTVLPTEPQSEEQLS	739	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5477	23.003	2	1997.9906	1997.9906	M	K	76	95
PSM	KASIPFSVVGSNQLIEA	740	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7588	28.641	2	1758.9516	1758.9516	L	K	232	249
PSM	KATESGAQSAPLPMEGVDISP	741	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=5972	24.028	3	2100.0045	2100.0045	M	K	7	28
PSM	KAVGTPVAAAPSSGFAPGFL	742	sp|P47974|TISD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7573	28.572	2	1843.9832	1843.9832	K	R	34	54
PSM	KDDVAPESGDTTV	743	sp|O76021-2|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4327	19.201	2	1332.6045	1332.6045	S	K	98	111
PSM	KDLLPGPVTLVME	744	sp|Q86U90|YRDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:35	ms_run[2]:scan=7403	27.887	2	1426.7742	1426.7742	L	R	142	155
PSM	KDMEPEMVCIDSCG	745	sp|Q9NQT5|EXOS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5719	23.511	2	1685.6405	1685.6405	N	R	172	186
PSM	KEALTYDGALLGD	746	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6605	25.486	2	1364.6824	1364.6824	L	R	96	109
PSM	KEAMEDGEIDGN	747	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4169	18.505	2	1306.5347	1306.5347	A	K	627	639
PSM	KEAYMGNVLQGGEGQAPT	748	sp|P24752-2|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=5077	21.937	2	1864.8625	1864.8625	V	R	87	105
PSM	KEDTSEQVVPVLV	749	sp|P33527-8|MRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6986	26.499	2	1441.7664	1441.7664	N	K	246	259
PSM	KEESPSTLQVLPDSESLP	750	sp|P43363|MAGAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7202	27.148	2	1954.9735	1954.9735	Q	R	113	131
PSM	KEEVEVAQVQVPTPA	751	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6058	24.229	2	1622.8516	1622.8516	E	R	14	29
PSM	KEGDDYEVIPNSNFYVS	752	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7235	27.258	2	1974.8847	1974.8847	D	R	170	187
PSM	KEGPTLSVPMVQGECLL	753	sp|Q9BQ52-3|RNZ2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=7477	28.159	2	1872.9325	1872.9325	A	K	35	52
PSM	KEIEIGVPNAQD	754	sp|Q8NB90-3|AFG2H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5565	23.196	2	1311.667	1311.6670	D	R	517	529
PSM	KEIMAEDDQVFLM	755	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=6306	24.753	2	1599.716	1599.7160	E	K	365	378
PSM	KELLVPLTSSMYVPG	756	sp|Q99471|PFD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=7241	27.284	2	1648.8746	1648.8746	G	K	60	75
PSM	KEPIMPAPGQEETV	757	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=4836	21.22	2	1540.7443	1540.7443	C	R	540	554
PSM	KEQTADGVAVIPVLQ	758	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7168	27.026	2	1566.8617	1566.8617	R	R	55	70
PSM	KETGDPGGQLVLAGDP	759	sp|Q9HCE1-2|MOV10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5947	23.967	2	1552.7733	1552.7733	V	R	666	682
PSM	KEVGSPPLDPTE	760	sp|Q96EK5|KBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4824	21.177	2	1267.6296	1267.6296	M	R	174	186
PSM	KGAEEMETVIPVDVM	761	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=6968	26.463	2	1662.7845	1662.7845	A	R	12	27
PSM	KGSAPPGPVPEGSI	762	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5259	22.484	2	1291.6772	1291.6772	G	R	11	25
PSM	KIESETPVDLASSMPSS	763	sp|Q9UHB7-2|AFF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=5484	23.021	2	1792.8401	1792.8401	L	R	583	600
PSM	KILETTMTPTGIDTA	764	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=5439	22.922	2	1606.8124	1606.8124	K	K	227	242
PSM	KIPPSSAPTVLSVPAGTTIV	765	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7521	28.35	2	1934.1088	1934.1088	Q	K	489	509
PSM	KLETEETVPETDVET	766	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5241	22.426	2	1718.8098	1718.8098	K	K	659	674
PSM	KLGTLSLPLPPAQTSD	767	sp|Q9GZS1|RPA49_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7283	27.433	2	1636.9036	1636.9036	H	R	395	411
PSM	KLMEALEPPLEEQQI	768	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=6885	26.218	2	1782.9074	1782.9074	K	-	798	813
PSM	KLTGQQGEEPSLVSPSTSCGSLTE	769	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	19-UNIMOD:4	ms_run[2]:scan=5943	23.957	3	2491.1748	2491.1748	Q	R	3513	3537
PSM	KLTPITYPQGLAMA	770	sp|P63000|RAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:35	ms_run[2]:scan=6703	25.738	2	1518.8116	1518.8116	K	K	133	147
PSM	KMELDLEPDTSYGGTL	771	sp|Q7Z309-4|F122B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=6952	26.402	2	1783.8186	1783.8186	E	R	5	21
PSM	KNDVLPLSNSVPEDVG	772	sp|Q96EQ0|SGTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6693	25.705	2	1681.8523	1681.8523	C	K	68	84
PSM	KNVCLPPEMEVALTEDQVPAL	773	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=7511	28.305	3	2368.1654	2368.1654	I	K	532	553
PSM	KPEPELNAAIPSANPA	774	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5698	23.47	2	1617.8362	1617.8362	C	K	525	541
PSM	KPGAIVIDCGINYVPDD	775	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:4	ms_run[2]:scan=7026	26.617	2	1844.8978	1844.8979	I	K	228	245
PSM	KPPDEGPSEYQTIPLN	776	sp|Q92905|CSN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5970	24.024	2	1783.8628	1783.8628	Y	K	194	210
PSM	KPQDGDVIAPLITPQ	777	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7063	26.713	2	1590.8617	1590.8617	T	K	510	525
PSM	KPSTPIPPQEGEEVGESSEEQDNAP	778	sp|Q9UDY2-6|ZO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5144	22.14	3	2650.1882	2650.1882	L	K	1018	1043
PSM	KPVNPVFCMPEEVLQ	779	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6961	26.438	2	1801.8743	1801.8743	I	R	307	322
PSM	KQEPEVNGGSGDAVPSGNEVSENMEEEAENQAES	780	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6328	24.813	3	3546.4812	3546.4812	A	R	397	431
PSM	KSAEPSPTVMSTSLGSNLSELD	781	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35	ms_run[2]:scan=6623	25.528	3	2265.0682	2265.0682	Q	R	125	147
PSM	KSGSLDDSFSDFQELPASS	782	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7294	27.474	2	2015.896	2015.8960	S	K	305	324
PSM	KSSDASTAQPPESQPLPASQTPASNQP	783	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4829	21.194	3	2720.2889	2720.2889	P	K	96	123
PSM	KSSSLEMTPYNTPQLSPATTPAN	784	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=5801	23.677	3	2450.1635	2450.1635	G	K	451	474
PSM	KTAPYVVTGSVDQTV	785	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5729	23.531	2	1563.8144	1563.8144	H	K	390	405
PSM	KTEDSLMPEEEFL	786	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=7175	27.048	2	1582.7073	1582.7073	L	R	621	634
PSM	KTETVEEPMEEEEAA	787	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4981	21.66	2	1720.7349	1720.7349	S	K	285	300
PSM	KTGADTTAAGPLFQQ	788	sp|O60828-5|PQBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5807	23.688	2	1504.7522	1504.7522	A	R	128	143
PSM	KTLEEAPSAPPQGVTVS	789	sp|Q9Y6N7-6|ROBO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5126	22.086	2	1709.8836	1709.8836	A	K	733	750
PSM	KTLFVGLPPPAD	790	sp|O15381-3|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6957	26.42	2	1253.702	1253.7020	D	R	545	557
PSM	KTLLVSTSAVDNNEAQ	791	sp|Q5T8P6-2|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5281	22.534	2	1688.8581	1688.8581	Q	K	685	701
PSM	KTPADCPVIAIDSF	792	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=7502	28.268	2	1532.7545	1532.7545	Q	R	313	327
PSM	KTPLPPELADVQA	793	sp|Q9Y5V0|ZN706_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6739	25.832	2	1377.7504	1377.7504	P	-	64	77
PSM	KTVTNAVVTVPAYFNDSQ	794	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7098	26.811	2	1952.9844	1952.9844	G	R	137	155
PSM	KTYDPSGDSTLPTCS	795	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4	ms_run[2]:scan=4848	21.262	2	1627.7036	1627.7036	V	K	426	441
PSM	KVALVYGQMNEPPGA	796	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=5408	22.851	2	1588.7919	1588.7919	S	R	264	279
PSM	KVEGFPTIYFAPSGD	797	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7714	29.229	2	1626.793	1626.7930	Y	K	596	611
PSM	KVPADTEVVCAPPTAYIDFA	798	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:4	ms_run[2]:scan=7671	29.023	3	2163.0558	2163.0558	A	R	33	53
PSM	KVPDSTYEMIGGLD	799	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=6097	24.31	2	1539.7127	1539.7127	E	K	134	148
PSM	KVPGFADDPTELAC	800	sp|Q9P2B2|FPRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4	ms_run[2]:scan=6550	25.356	2	1518.7024	1518.7024	S	R	416	430
PSM	KYDPPLEDGAMPSA	801	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=4939	21.543	2	1505.6708	1505.6708	N	R	78	92
PSM	MKLNISFPATGCQ	802	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6520	25.281	2	1481.7007	1481.7007	-	K	1	14
PSM	MKPDETPMFDPSLL	803	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=7375	27.778	2	1651.7473	1651.7473	-	K	1	15
PSM	MKPDETPMFDPSLL	804	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7866	29.957	2	1619.7575	1619.7575	-	K	1	15
PSM	PAYHSSLMDPDT	805	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:35	ms_run[2]:scan=4593	20.345	2	1348.5605	1348.5605	M	K	2	14
PSM	PSKGPLQSVQVFG	806	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6922	26.327	2	1342.7245	1342.7245	M	R	2	15
PSM	RAIVDALPPPCESACTVPTDVD	807	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6901	26.269	3	2382.1195	2382.1195	A	K	260	282
PSM	RDAEDAMDAMDGAVLDG	808	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4753	20.932	2	1782.7036	1782.7036	K	R	66	83
PSM	RDSLLATVPDEQDCVTQEVPDS	809	sp|Q96RS0|TGS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:4	ms_run[2]:scan=6869	26.175	3	2473.1279	2473.1279	E	R	589	611
PSM	REPFDLGEPEQSNGGFPCTTAP	810	sp|Q99961-3|SH3G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	18-UNIMOD:4	ms_run[2]:scan=7250	27.312	3	2405.0594	2405.0594	P	K	196	218
PSM	RGAPEPAQTQPQPQPQPAAPEGPEQP	811	sp|A0A0U1RRL7|MMPOS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4861	21.305	3	2702.3049	2702.3049	G	R	9	35
PSM	RGTEAGQVGEPGIPTGEAGPSCSSASD	812	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	22-UNIMOD:4	ms_run[2]:scan=5188	22.27	3	2573.13	2573.1300	E	K	220	247
PSM	RLPLCSLPGEPGNGPDQQLQ	813	sp|Q96GX2|A7L3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4	ms_run[2]:scan=7037	26.641	3	2175.0743	2175.0743	C	R	71	91
PSM	RPTPAPTATPTAPSPLQATAGPSYP	814	sp|O00330-3|ODPX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6355	24.874	3	2446.2492	2446.2492	S	R	217	242
PSM	RTDDYLDQPCLETVN	815	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:4	ms_run[2]:scan=6425	25.047	2	1837.8152	1837.8152	Y	R	193	208
PSM	RTGSETPQAPMSGVGPVSGGPGGFG	816	sp|Q8WXF1|PSPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=5858	23.781	3	2302.0648	2302.0648	S	R	482	507
PSM	RTLTIVDTGIGMT	817	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	12-UNIMOD:35	ms_run[1]:scan=6386	24.9392567432	2	1392.727532	1392.728266	D	K	27	40
PSM	KDYEEVGVDSVEGEGEEEGEEY	818	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8141	30.9998558072	2	2478.005955	2475.992534	E	-	430	452
PSM	KVLQATVVAVGSGS	819	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5356	22.729940282133335	2	1314.749964	1314.750716	G	K	40	54
PSM	KALTSETNGTDSNGSNSSNIQ	820	sp|Q08209|PP2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4065	18.0419195776	2	2124.940248	2123.956698	N	-	501	522
PSM	KDFGPIDPECTCPTCQ	821	sp|Q9BXR0|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	10-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=5842	23.7555625888	2	1923.777639	1923.780120	E	K	308	324
PSM	RQLLSDYGPPSLGYTQGTGNSQVPQS	822	sp|O14519|CDKA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6964	26.454377855466664	3	2750.335653	2749.330737	Y	K	36	62
PSM	KETPPPLVPPAA	823	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5516	23.07988201466667	2	1215.686006	1215.686324	R	R	3	15
PSM	ARHVFLTGPPGVG	824	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=6636	25.561	2	1348.7252	1348.7252	M	K	2	15
PSM	KAAAPAPVSEAVC	825	sp|P20810-3|ICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=4632	20.492	2	1269.6387	1269.6387	S	R	278	291
PSM	KALDELMDGDIIVFQ	826	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=7693	29.122	2	1721.8546	1721.8546	D	K	739	754
PSM	KALEEGLTPQEICD	827	sp|P56192-2|SYMC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=5904	23.875	2	1601.7607	1601.7607	T	K	321	335
PSM	KAMSTLVPQGGPVLC	828	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:4	ms_run[2]:scan=6597	25.467	2	1556.8055	1556.8055	A	R	74	89
PSM	KATGSDSSGVIDLTMDDEESGASQDP	829	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:35	ms_run[2]:scan=5946	23.965	3	2627.1028	2627.1028	G	K	956	982
PSM	KCDFTGTLIVVPDVS	830	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=7628	28.83	2	1649.8335	1649.8335	D	K	241	256
PSM	KDAGTIAGLNVM	831	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=5691	23.457	2	1204.6122	1204.6122	T	R	185	197
PSM	KDDPLTNLNTAFDVAE	832	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7662	28.982	2	1761.8421	1761.8421	R	K	198	214
PSM	KDDPPPPEDDEN	833	sp|P63208-2|SKP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3459	15.202	2	1366.5525	1366.5525	H	K	66	78
PSM	KDEDEDEDVASPDGLG	834	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5045	21.851	2	1689.6853	1689.6853	F	R	539	555
PSM	KDGGPVTSQESGQ	835	sp|Q9BXW9-3|FACD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3492	15.35	2	1288.5895	1288.5895	A	K	710	723
PSM	KDLTPAVTDNDEAD	836	sp|P57772-2|SELB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4617	20.429	2	1502.6736	1502.6736	S	K	355	369
PSM	KDMGEDLECLCQIM	837	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,9-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=6504	25.252	2	1772.7089	1772.7089	L	R	245	259
PSM	KDMYLIPLGATD	838	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=7112	26.853	2	1351.6694	1351.6694	V	K	1221	1233
PSM	KDVEFEVVGDAPE	839	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6318	24.782	2	1432.6722	1432.6722	G	K	444	457
PSM	KDYEEVGVDSVEGEGEEEGEEY	840	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7806	29.663	3	2475.9925	2475.9925	E	-	314	336
PSM	KEADASPASAGIC	841	sp|Q9BW27-2|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=4296	19.065	2	1275.5765	1275.5765	S	R	50	63
PSM	KEADPGETPSEAPSEA	842	sp|Q9NQ66|PLCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4107	18.219	2	1613.7057	1613.7057	K	R	840	856
PSM	KEAEFQAPPEPIQQEVE	843	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6139	24.406	2	1967.9476	1967.9476	H	R	310	327
PSM	KEALQDVEDENQ	844	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4339	19.253	2	1416.6369	1416.6369	N	-	222	234
PSM	KEALTYDGALLGD	845	sp|Q15056-2|IF4H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6698	25.716	2	1364.6824	1364.6824	L	R	96	109
PSM	KEAMEDGEIDGN	846	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35	ms_run[2]:scan=3491	15.345	2	1322.5296	1322.5296	A	K	627	639
PSM	KEEDGSLSLDGADSTGVVA	847	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8095	30.839	2	1848.8589	1848.8589	L	K	594	613
PSM	KELGPLPDDDDMASP	848	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=5499	23.05	2	1614.7083	1614.7083	R	K	623	638
PSM	KELLVPLTSSMYVPG	849	sp|Q99471|PFD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7675	29.041	2	1632.8797	1632.8797	G	K	60	75
PSM	KELSDPAGAIIYTS	850	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6362	24.894	2	1463.7508	1463.7508	L	R	527	541
PSM	KELTAEPTIVAQLC	851	sp|Q9BU02-2|THTPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:4	ms_run[2]:scan=6931	26.353	2	1571.8229	1571.8229	Y	K	80	94
PSM	KELTAEPTIVAQLC	852	sp|Q9BU02-2|THTPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:4	ms_run[2]:scan=6942	26.378	2	1571.8229	1571.8229	Y	K	80	94
PSM	KELVGPPLAETVFTP	853	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7681	29.069	2	1596.8763	1596.8763	N	K	1383	1398
PSM	KEPEQEPVPAQFQ	854	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5399	22.833	2	1525.7413	1525.7413	C	K	464	477
PSM	KEPVPQPLPSDDT	855	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5027	21.804	2	1421.7038	1421.7038	E	R	454	467
PSM	KEVGSPPLDPTE	856	sp|Q96EK5|KBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4887	21.391	2	1267.6296	1267.6296	M	R	174	186
PSM	KFPSSGPVTPQPTALTFA	857	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7253	27.318	2	1844.9672	1844.9672	S	K	359	377
PSM	KGLLPEPNPVQIM	858	sp|Q9HCJ3-2|RAVR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:35	ms_run[2]:scan=6764	25.907	2	1450.7854	1450.7854	Q	K	332	345
PSM	KGLQVGGCEPEPQVC	859	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5252	22.46	2	1656.76	1656.7600	S	-	675	690
PSM	KGVVDSDDLPLNVS	860	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6494	25.225	2	1456.7409	1456.7409	V	R	434	448
PSM	KIPPSSAPTVLSVPAGTTIV	861	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7256	27.33	2	1934.1088	1934.1088	Q	K	489	509
PSM	KLAPALATGNTVVM	862	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=5537	23.136	2	1400.7697	1400.7697	W	K	195	209
PSM	KLDQPVSAPPSP	863	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4860	21.302	2	1234.6558	1234.6558	E	R	234	246
PSM	KLFPDTPLALDAN	864	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7539	28.426	2	1413.7504	1413.7504	E	K	587	600
PSM	KLGDEDEEIDGDTN	865	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4680	20.678	2	1548.6427	1548.6427	Q	K	815	829
PSM	KLGGIPDALPTVAAP	866	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7285	27.437	2	1418.8133	1418.8133	S	R	31	46
PSM	KLIAPVAEEEATVPNN	867	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5734	23.541	2	1693.8887	1693.8887	E	K	7	23
PSM	KLMTIMDSMNDQELDSTDGA	868	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5149	22.163	3	2261.9338	2261.9338	K	K	374	394
PSM	KLMTIMDSMNDQELDSTDGA	869	sp|P61011|SRP54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5996	24.081	3	2245.9389	2245.9389	K	K	374	394
PSM	KLNEAQPSTIATSM	870	sp|P56537-2|IF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=4595	20.355	2	1505.7396	1505.7396	F	R	204	218
PSM	KLPGELEPVQATQN	871	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5547	23.157	2	1522.7991	1522.7991	E	K	195	209
PSM	KLPGELEPVQATQN	872	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5724	23.521	2	1522.7991	1522.7991	E	K	195	209
PSM	KLPYLVELSPDGSDS	873	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7475	28.155	2	1618.809	1618.8090	E	R	382	397
PSM	KLTDQLPLIIVCD	874	sp|P53675-2|CLH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4	ms_run[2]:scan=7886	30.057	2	1526.8378	1526.8378	A	R	767	780
PSM	KLTEEPPLPPPPP	875	sp|Q6PCT2-2|FXL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5861	23.786	2	1410.7759	1410.7759	W	R	181	194
PSM	KLYTLVLTDPDAPS	876	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7199	27.141	2	1531.8134	1531.8134	G	R	62	76
PSM	KMDATANDVPSPYEV	877	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=5736	23.545	2	1651.74	1651.7400	A	R	433	448
PSM	KMGQAVPAPTGAPPGGQPDYSAAWAEYY	878	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=7462	28.12	3	2895.3174	2895.3174	K	R	592	620
PSM	KMMDLEEVIPLDCC	879	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35,3-UNIMOD:35,13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7225	27.22	2	1783.7501	1783.7501	Y	R	555	569
PSM	KMPGAPETAPGDGAGAS	880	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=3814	16.891	2	1528.6828	1528.6828	G	R	9	26
PSM	KPAAVVAPITTGYTV	881	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6549	25.355	2	1486.8395	1486.8395	E	K	16	31
PSM	KPEDVLDDDDAGSAPL	882	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6361	24.892	2	1655.7526	1655.7526	R	K	141	157
PSM	KPEEEITVGPVQ	883	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5341	22.691	2	1324.6874	1324.6874	L	K	501	513
PSM	KPLAGTDDSVVSED	884	sp|Q9ULF5-2|S39AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4696	20.741	2	1431.6729	1431.6729	L	R	112	126
PSM	KPMCVESFSDYPPLG	885	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=6938	26.368	2	1741.7691	1741.7691	G	R	408	423
PSM	KPNYIVPDYMPVVYD	886	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:35	ms_run[2]:scan=7090	26.789	2	1827.8753	1827.8753	E	K	3117	3132
PSM	KPVVGIIYPPPEV	887	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7190	27.112	2	1406.8173	1406.8173	S	R	37	50
PSM	KPYPMYPATTSLVNVVP	888	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=7360	27.72	2	1891.9754	1891.9754	Y	K	205	222
PSM	KQIDAPGDPFPLNP	889	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7143	26.962	2	1507.7671	1507.7671	M	R	300	314
PSM	KQVVEEPSPQLPAD	890	sp|P52564-2|MP2K6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5261	22.487	2	1535.7831	1535.7831	L	K	212	226
PSM	KSDAYYCTGDVTAWT	891	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=6896	26.252	2	1736.7352	1736.7352	F	K	305	320
PSM	KSDISQPSGPLLPELS	892	sp|Q9H2Y7|ZN106_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7220	27.202	2	1666.8778	1666.8778	Q	K	705	721
PSM	KSLLQMVPLDEGASE	893	sp|Q01968-2|OCRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35	ms_run[2]:scan=6857	26.137	2	1631.8076	1631.8076	E	R	707	722
PSM	KSPFTVGVAAPLDLS	894	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7564	28.536	2	1500.8188	1500.8188	P	K	762	777
PSM	KSPQPDPVDTPAST	895	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4295	19.059	2	1438.694	1438.6940	C	K	1983	1997
PSM	KSSEPVVTMSVEYQM	896	sp|P18583-8|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5030	21.811	2	1745.7852	1745.7852	L	K	258	273
PSM	KSVGMIAGGTGITPMLQVI	897	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=7304	27.515	2	1904.0111	1904.0111	V	R	150	169
PSM	KTDGEPGPQGWSP	898	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5586	23.233	2	1354.6153	1354.6153	W	R	74	87
PSM	KTDLVPAFQNLM	899	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=7204	27.153	2	1391.7119	1391.7119	T	K	280	292
PSM	KTEEMPNDSVLEN	900	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=4553	20.188	2	1520.6665	1520.6665	D	K	150	163
PSM	KTFEISEPVITPSQ	901	sp|Q9NXX6|NSE4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6585	25.442	2	1574.8192	1574.8192	V	R	365	379
PSM	KTILEEEITPTIQ	902	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7071	26.738	2	1513.8239	1513.8239	I	K	196	209
PSM	KTLEDIDLGPTE	903	sp|Q8N0X4-2|CLYBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6260	24.655	2	1329.6664	1329.6664	V	K	92	104
PSM	KTPLFSDGVEMDTPQLD	904	sp|Q15751|HERC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=6859	26.144	2	1907.8823	1907.8823	M	K	1174	1191
PSM	KTPPGALLGAPPPLVPAP	905	sp|Q9HAH7|FBRS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7411	27.918	2	1691.9974	1691.9974	S	R	427	445
PSM	KTPVEEVPAAIAPFQG	906	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7159	27.003	2	1652.8774	1652.8774	H	R	942	958
PSM	KTQTPPVSPAPQPTEE	907	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4573	20.278	2	1705.8523	1705.8523	A	R	361	377
PSM	KVATPLPDPMAS	908	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6116	24.347	2	1225.6377	1225.6377	Q	R	919	931
PSM	KVNQIGSVTESLQAC	909	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:4	ms_run[2]:scan=5866	23.801	2	1632.8141	1632.8141	L	K	343	358
PSM	KVPGLPTPIENMIL	910	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=7585	28.625	2	1536.8586	1536.8586	W	R	727	741
PSM	KVSFTGSVPTGM	911	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=5275	22.519	2	1225.6013	1225.6013	A	K	157	169
PSM	KVVLEAPDETTL	912	sp|Q6GMV3|PTRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6334	24.828	2	1313.7078	1313.7078	R	K	80	92
PSM	PGSAAKGSELSE	913	sp|P49770|EI2BB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3796	16.815	2	1131.5408	1131.5408	M	R	2	14
PSM	RAELAPPAPPLPPLPPE	914	sp|O14641|DVL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7337	27.633	2	1760.9825	1760.9825	P	R	107	124
PSM	RALLAPLVAPEAGEAEPGSQE	915	sp|Q9H0B6-2|KLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7158	27.001	3	2104.08	2104.0800	H	R	36	57
PSM	RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA	916	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5694	23.463	4	3327.6789	3327.6789	N	R	214	245
PSM	RDPAAPEPEEQEE	917	sp|Q969T4|UB2E3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4087	18.137	2	1495.6427	1495.6427	Q	R	25	38
PSM	READGSETPEPFAAEA	918	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5696	23.466	2	1675.7326	1675.7326	R	K	233	249
PSM	RGPIPSGMQGPSPINMGAVVPQGS	919	sp|P33240-2|CSTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=5726	23.524	3	2365.1518	2365.1519	P	R	458	482
PSM	RIEDVTPIPSDST	920	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5404	22.844	2	1428.7096	1428.7096	G	R	128	141
PSM	RIEEVPELPLVVED	921	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7728	29.291	2	1635.872	1635.8720	H	K	143	157
PSM	RMDTDLETMDLDQGGEALAP	922	sp|O75643-2|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6452	25.126	3	2208.9515	2208.9515	S	R	386	406
PSM	RVLYVGGLAEEVDD	923	sp|Q9UNP9-2|PPIE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6827	26.069	2	1533.7675	1533.7675	K	K	6	20
PSM	KDPGMGAMGGMGGGMGGGMF	924	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=4433	19.69004625013333	2	1850.679879	1849.692568	E	-	554	574
PSM	KVVSQYSSLLSPMSVNAVM	925	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	13-UNIMOD:35,19-UNIMOD:35	ms_run[1]:scan=6900	26.267197869866667	3	2072.0792	2071.0322	S	K	174	193
PSM	KPLENGTGFQAQDISGQ	926	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5445	22.935516239466665	2	1788.874185	1788.864242	E	K	1914	1931
PSM	KNAVITVPAYFNDSQ	927	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7135	26.932782978133332	2	1666.819507	1665.836236	A	R	187	202
PSM	KNAVITVPAYFNDSQ	928	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7144	26.966053704533334	2	1666.819507	1665.836236	A	R	187	202
PSM	KVEPLEEAIPLPPT	929	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7362	27.72654852453333	2	1531.852276	1531.849761	V	K	314	328
PSM	KIGGDAGTSLNSNDYGYGGQ	930	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5440	22.9240203032	2	1973.858126	1972.876263	A	K	44	64
PSM	KLGLPPLTPEQQEALQ	931	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7005	26.5583230176	2	1760.968014	1760.967250	A	K	53	69
PSM	KLSEEVVVAPNQESGM	932	sp|Q6PJT7|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	16-UNIMOD:35	ms_run[1]:scan=5208	22.32938462346667	2	1733.826635	1731.834916	P	K	473	489
PSM	RTDYNASVSVPDSSGPE	933	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5162	22.195225347466664	2	1780.779286	1779.791136	L	R	69	86
PSM	KTIIPLISQCTP	934	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	10-UNIMOD:4	ms_run[1]:scan=7176	27.054707592266666	2	1369.764548	1369.763923	G	K	203	215
PSM	RGAFMLEPEGMSPMEPAGVSPMPGTQ	935	sp|Q6IBW4|CNDH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=6302	24.745318498933333	3	2768.200524	2767.196160	P	K	189	215
PSM	KEGPTLSVPMVQGECLL	936	sp|Q9BQ52|RNZ2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	10-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=7466	28.130191636266666	2	1872.930750	1872.932522	K	K	407	424
PSM	KTLIDDDNPPVSFV	937	sp|P61964|WDR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7322	27.575147480533335	2	1558.789486	1558.787889	L	K	207	221
PSM	KEGEEEEENTEEPPQGEEEESMETQE	938	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4912	21.4611800568	3	3052.181866	3051.178239	K	-	365	391
PSM	KSPEMSMQEDCISDIAPMQTDEQTN	939	sp|O60502|OGA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=5397	22.8275104568	3	2932.170593	2932.171856	S	K	510	535
PSM	KAAAVLPVLDLAQ	940	sp|P19404|NDUV2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7705	29.181	2	1307.7813	1307.7813	H	R	75	88
PSM	KAPVPTGEVYFADSFD	941	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7165	27.016	2	1741.8199	1741.8199	Y	R	61	77
PSM	KDDVAQTDLLQIDPNFGS	942	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7684	29.082	3	1974.9535	1974.9535	Q	K	168	186
PSM	KDEPDTNLVALM	943	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=5945	23.962	2	1360.6544	1360.6544	A	K	125	137
PSM	KDIQYPFLGPVPT	944	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7587	28.636	2	1473.7868	1473.7868	E	R	747	760
PSM	KDMEPEMVCIDSCG	945	sp|Q9NQT5|EXOS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4907	21.45	2	1701.6354	1701.6354	N	R	172	186
PSM	KDMQPSMESDMALV	946	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4888	21.394	2	1628.6732	1628.6732	A	K	290	304
PSM	KDVIELTDDSFD	947	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6871	26.18	2	1395.6406	1395.6406	K	K	157	169
PSM	KDVSGPMPDSYSP	948	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=4662	20.605	2	1394.6024	1394.6024	K	R	290	303
PSM	KDVTPPPETEVVLI	949	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7252	27.316	2	1535.8447	1535.8447	G	K	518	532
PSM	KEDEDPQDGGSLASTLS	950	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5517	23.082	2	1747.7748	1747.7748	K	K	281	298
PSM	KEDGLAQQQTQLNL	951	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6120	24.356	2	1584.8107	1584.8107	P	R	2206	2220
PSM	KEDLPGFVFESN	952	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7433	28.006	2	1380.6561	1380.6561	L	R	782	794
PSM	KEFQQYLPVVMGPLM	953	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:35	ms_run[2]:scan=7893	30.091	2	1794.9048	1794.9049	G	K	557	572
PSM	KEGEEAGPGDPLLEAVP	954	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7318	27.562	2	1706.8363	1706.8363	A	K	352	369
PSM	KEIDDSVLGQTGPY	955	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5999	24.089	2	1520.7359	1520.7359	K	R	188	202
PSM	KELLPVLISAM	956	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=7530	28.389	2	1228.7101	1228.7101	V	K	199	210
PSM	KEPFEDGFANGEESTPT	957	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6089	24.291	2	1853.7956	1853.7956	E	R	252	269
PSM	KEQEFPVEPVGE	958	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5835	23.742	2	1386.6667	1386.6667	K	K	1240	1252
PSM	KESPQEEEIDPFDVDSG	959	sp|Q9UJK0|TSR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7051	26.678	2	1919.8272	1919.8272	A	R	226	243
PSM	KETVYCLNDDDETEVL	960	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4	ms_run[2]:scan=6717	25.772	2	1941.8514	1941.8514	Q	K	291	307
PSM	KEVPLAQTAQPTSAIV	961	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6000	24.091	2	1651.9145	1651.9145	E	R	149	165
PSM	KEVTPEGLQMV	962	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35	ms_run[2]:scan=5361	22.744	2	1245.6275	1245.6275	L	K	235	246
PSM	KFGDPVVQSDM	963	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=4965	21.615	2	1237.5649	1237.5649	R	K	77	88
PSM	KFPSSGPVTPQPTALTFA	964	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7366	27.738	2	1844.9672	1844.9672	S	K	359	377
PSM	KGDILVVATGQPEMV	965	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7138	26.944	2	1555.828	1555.8280	N	K	208	223
PSM	KGLVVDMDGFEEE	966	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=5977	24.038	2	1482.6548	1482.6548	E	R	432	445
PSM	KGMDADPYNPVLPTN	967	sp|Q9H6T3-2|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=5779	23.629	2	1646.761	1646.7610	T	R	158	173
PSM	KGSDALLSNTVGTPAFMAPESLSET	968	sp|Q96RR4-6|KKCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:35	ms_run[2]:scan=7411	27.918	3	2538.2159	2538.2159	F	R	338	363
PSM	KGSLLIDSSTIDPAVS	969	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6991	26.512	2	1601.8512	1601.8512	K	K	125	141
PSM	KGVLFGVPGAFTPGCS	970	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:4	ms_run[2]:scan=7639	28.873	2	1592.8021	1592.8021	K	K	34	50
PSM	KIDLPEYQGEPDEISIQ	971	sp|Q9BY32-2|ITPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7222	27.208	2	1972.963	1972.9630	Q	K	22	39
PSM	KIEILAPPNGSVPGD	972	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6530	25.303	2	1505.809	1505.8090	E	R	235	250
PSM	KIIPLYSTLPPQQQQ	973	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6730	25.813	2	1752.9774	1752.9774	I	R	384	399
PSM	KILDDTEDTVVSQ	974	sp|P42696-2|RBM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5263	22.492	2	1461.7199	1461.7199	R	R	156	169
PSM	KLATQLTGPVMPV	975	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=5976	24.036	2	1369.7639	1369.7639	L	R	98	111
PSM	KLGDEDEEIDGDTN	976	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4568	20.257	2	1548.6427	1548.6427	Q	K	815	829
PSM	KLGDTPGVSYSDIAA	977	sp|Q9H269-2|VPS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6200	24.536	2	1492.7409	1492.7409	Q	R	366	381
PSM	KLLTGELLPTDGMI	978	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=7522	28.355	2	1515.8218	1515.8218	L	R	441	455
PSM	KLSVFSTVDAPVAPSD	979	sp|Q5JRX3-3|PREP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6935	26.362	2	1631.8407	1631.8407	A	K	858	874
PSM	KMVVPGLDGAQIP	980	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:35	ms_run[2]:scan=6622	25.526	2	1339.717	1339.7170	L	R	1158	1171
PSM	KNVIVNGLVLASDGQ	981	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6881	26.212	2	1525.8464	1525.8464	F	K	585	600
PSM	KPDVMYADIGGMDIQ	982	sp|P43686-2|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5798	23.672	2	1683.7484	1683.7484	Q	K	128	143
PSM	KPGVAAPPEVAPAP	983	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5043	21.846	2	1299.7187	1299.7187	P	K	105	119
PSM	KPTPIQTQAIPAIMSG	984	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=5925	23.921	2	1667.8916	1667.8916	E	R	394	410
PSM	KPVETIGFDSIM	985	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=6617	25.514	2	1351.6694	1351.6694	N	K	109	121
PSM	KQMTDVLLTPATDAL	986	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=7113	26.856	2	1631.844	1631.8440	V	K	105	120
PSM	KQQPPEPEWIGDGESTSPSD	987	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6038	24.176	3	2182.9655	2182.9655	P	K	6	26
PSM	KSSSLEMTPYNTPQLSPATTPAN	988	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=5780	23.632	3	2450.1635	2450.1635	G	K	451	474
PSM	KTSSAETPTIPLGSAVEAI	989	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7466	28.13	2	1870.9888	1870.9888	M	K	549	568
PSM	KTVMDEGPQVFAPLSEES	990	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35	ms_run[2]:scan=6967	26.461	2	1978.9194	1978.9194	C	K	687	705
PSM	KTVTNAVVTVPAYFNDSQ	991	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6939	26.372	2	1952.9844	1952.9844	G	R	137	155
PSM	KTVTNAVVTVPAYFNDSQ	992	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8202	31.215	2	1952.9844	1952.9844	G	R	137	155
PSM	KVDATEESDLAQQYGV	993	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6839	26.093	2	1751.8214	1751.8214	A	R	81	97
PSM	KVDFSPQPPYNYAVTASS	994	sp|Q8TED0|UTP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6765	25.91	2	1969.9422	1969.9422	S	R	43	61
PSM	KVDLSQPLIATC	995	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=6496	25.23	2	1343.7119	1343.7119	K	R	237	249
PSM	KVDVTEQPGLSG	996	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4769	20.98	2	1228.6299	1228.6299	A	R	82	94
PSM	KVEIIANDQGN	997	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4557	20.205	2	1199.6146	1199.6146	G	R	25	36
PSM	KVIDPATATSVDL	998	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6354	24.872	2	1328.7187	1328.7187	M	R	163	176
PSM	KVITDIAGVIPAE	999	sp|P35249|RFC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7062	26.71	2	1324.7602	1324.7602	E	K	260	273
PSM	KVLISDSLDPCC	1000	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6254	24.647	2	1405.6581	1405.6581	R	R	8	20
PSM	KVLLISDPTTD	1001	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5980	24.043	2	1200.6602	1200.6602	I	K	74	85
PSM	KVLQDMGLPTGAEG	1002	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35	ms_run[2]:scan=5110	22.042	2	1430.7075	1430.7075	V	R	460	474
PSM	KVLSVPESTPFTAVL	1003	sp|P61960|UFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7762	29.45	2	1586.892	1586.8920	Y	K	19	34
PSM	KVMQPLVQQPILPVV	1004	sp|Q5T8P6-2|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=7498	28.249	2	1704.0008	1704.0008	P	K	618	633
PSM	KYDPPLEDGAMPSA	1005	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=5078	21.938	2	1505.6708	1505.6708	N	R	78	92
PSM	PSKGPLQSVQVFG	1006	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6780	25.949	2	1342.7245	1342.7245	M	R	2	15
PSM	RADGYEPPVQESV	1007	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5235	22.409	2	1445.6787	1445.6787	E	-	252	265
PSM	RDAEDAMDAMDGAVLDG	1008	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4917	21.477	2	1782.7036	1782.7036	K	R	66	83
PSM	RDMIILPEMVGSMVGVYNG	1009	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,9-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7164	27.014	3	2128.0003	2128.0003	L	K	81	100
PSM	RDMIILPEMVGSMVGVYNG	1010	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7698	29.148	3	2112.0054	2112.0054	L	K	81	100
PSM	RDQDLEPGAPSMGA	1011	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=4410	19.588	2	1458.6409	1458.6409	A	K	1463	1477
PSM	RDYMDTLPPTVGDDVG	1012	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35	ms_run[2]:scan=5949	23.969	2	1765.7829	1765.7829	D	K	50	66
PSM	RGAFMLEPEGMSPMEPAGVSPMPGTQ	1013	sp|Q6IBW4-5|CNDH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35,14-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=6818	26.048	3	2751.2012	2751.2012	P	K	189	215
PSM	RPAPVAQPPAAAPPSAVGSSAAAP	1014	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5165	22.201	3	2137.128	2137.1280	P	R	27	51
PSM	RSGDSEVYQLGDVSQ	1015	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5783	23.636	2	1638.7485	1638.7485	W	K	66	81
PSM	RSLLVNPEGPTLM	1016	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=6455	25.133	2	1441.7599	1441.7599	L	R	2220	2233
PSM	KEEDGSLSLDGADSTGVVA	1017	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8192	31.182033664266665	2	1849.861424	1848.858882	L	K	676	695
PSM	KVPTEENEMSSEADMECLNQ	1018	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35,15-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=4560	20.218169635200002	3	2371.945803	2371.945408	E	R	500	520
PSM	KIIAEGANGPTTPEAD	1019	sp|P00367|DHE3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4767	20.976394232	2	1583.767874	1582.783866	A	K	399	415
PSM	KDLSIGNPIPTVVSGA	1020	sp|O95104|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=7168	27.0259260944	2	1566.8606	1566.8612	T	R	777	793
PSM	KALTLPGSSENEYIM	1021	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	15-UNIMOD:35	ms_run[1]:scan=6343	24.845528200266664	2	1667.808117	1667.807639	F	K	559	574
PSM	RSGPTDDGEEEMEEDTVTNGS	1022	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:35	ms_run[1]:scan=4263	18.9167428832	2	2270.861189	2269.876459	R	-	235	256
PSM	KGESASPANEEITEEQNGTANGFSEINS	1023	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5951	23.9743944384	3	2910.260603	2909.279883	E	K	690	718
PSM	RTLNAEGTDALGPNVDGTSVSPGDTEPMI	1024	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	28-UNIMOD:35	ms_run[1]:scan=6785	25.961143616	3	2929.358978	2929.361111	K	R	198	227
PSM	KCDSSPDSAEDV	1025	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=3967	17.609583030133333	2	1308.512988	1308.513976	A	R	131	143
PSM	KEGDDYEVIPNSNFYVS	1026	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7222	27.207910446666666	2	1974.882569	1974.884703	D	R	170	187
PSM	KDIVVQETMEDID	1027	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35	ms_run[1]:scan=5372	22.770708824266666	2	1549.716785	1549.718155	M	K	189	202
PSM	RLPDDDPTAVAGSFSCTM	1028	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=6438	25.080070437333333	2	1954.839347	1954.840078	V	K	708	726
PSM	KAAPEPQQPMELYQPSAESL	1029	sp|Q96BH1|RNF25_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=6287	24.719	3	2229.0623	2229.0623	L	R	213	233
PSM	KAFDSGIIPMEFVN	1030	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=7413	27.927	2	1582.7701	1582.7701	S	K	677	691
PSM	KATNESEDEIPQLVPIG	1031	sp|O76021-2|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7392	27.847	2	1838.9262	1838.9262	V	K	136	153
PSM	KDAGTIAGLNVL	1032	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7257	27.333	2	1170.6608	1170.6608	T	R	159	171
PSM	KDEDEGEPPAQAPVA	1033	sp|Q5T0F9-3|C2D1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4389	19.495	2	1551.7053	1551.7053	D	K	174	189
PSM	KDIELVMSQANVS	1034	sp|E9PAV3|NACAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=5197	22.297	2	1448.7181	1448.7181	V	R	2042	2055
PSM	KDMAQLPETEIAPA	1035	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=5559	23.182	2	1528.7443	1528.7443	V	K	476	490
PSM	KDVIELTDDSFD	1036	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7010	26.579	2	1395.6406	1395.6406	K	K	157	169
PSM	KDVSGPLPPAYSP	1037	sp|Q5ST30|SYVM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5710	23.491	2	1326.682	1326.6820	K	R	94	107
PSM	KDYEEVGVDSVEGEGEEEGEEY	1038	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7894	30.097	3	2475.9925	2475.9925	E	-	314	336
PSM	KEAELLEPLMPAI	1039	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=7464	28.124	2	1468.7847	1468.7847	L	R	128	141
PSM	KEEPGSDSGTTAVVALI	1040	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7296	27.481	2	1672.8519	1672.8519	G	R	320	337
PSM	KEIESEIDSEEELIN	1041	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6062	24.24	2	1775.8313	1775.8313	L	K	754	769
PSM	KELALPGELTQS	1042	sp|O75436-2|VP26A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6341	24.843	2	1284.6925	1284.6925	V	R	93	105
PSM	KELEALMPSAAGQE	1043	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=5127	22.089	2	1488.713	1488.7130	L	K	147	161
PSM	KELLITDLLPDN	1044	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7918	30.213	2	1382.7657	1382.7657	F	R	290	302
PSM	KELMDEEDVLQEC	1045	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=5641	23.347	2	1652.691	1652.6910	L	K	25	38
PSM	KFPLTTESAM	1046	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=5339	22.687	2	1139.5533	1139.5533	I	K	78	88
PSM	KGVGDGTVSWGLEDDEDMTLT	1047	sp|Q13404-8|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	18-UNIMOD:35	ms_run[2]:scan=7238	27.273	2	2239.9791	2239.9791	Q	R	26	47
PSM	KIDDMTAAPMDV	1048	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=5318	22.644	2	1321.5894	1321.5894	Y	R	93	105
PSM	KILQDGGLQVVE	1049	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6198	24.533	2	1297.7242	1297.7242	R	K	21	33
PSM	KLADPVTPVETILQ	1050	sp|Q9NVN8|GNL3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7431	27.997	2	1522.8607	1522.8607	Q	R	327	341
PSM	KLAGEELAGEEAPQE	1051	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5145	22.143	2	1569.7522	1569.7522	E	K	574	589
PSM	KLATQSNEITIPVTFES	1052	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7374	27.774	2	1876.9782	1876.9782	P	R	171	188
PSM	KLDYDEDASAML	1053	sp|Q8NFI4|F10A5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=5675	23.423	2	1385.6021	1385.6021	C	K	210	222
PSM	KLLDAVDTYIPVPA	1054	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7770	29.489	2	1513.8392	1513.8392	Q	R	238	252
PSM	KLMIEMDGTEN	1055	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=4915	21.469	2	1295.5737	1295.5737	D	K	92	103
PSM	KLTGQQGEEPSLVSPSTSCGSLTE	1056	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	19-UNIMOD:4	ms_run[2]:scan=5937	23.943	3	2491.1748	2491.1748	Q	R	3513	3537
PSM	KLVTDCVAAMNPDAVL	1057	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=6505	25.254	2	1731.8535	1731.8535	N	R	146	162
PSM	KLVVECVMNNVTCT	1058	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=5454	22.953	2	1681.7837	1681.7837	G	R	115	129
PSM	KMFVLDEADEMLS	1059	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6285	24.714	2	1558.6895	1558.6895	I	R	177	190
PSM	KNVVLPTETEVAPA	1060	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5697	23.468	2	1466.7981	1466.7981	A	K	332	346
PSM	KPEAYAGPEAAAPGLPEL	1061	sp|P52952-3|NKX25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7261	27.349	2	1779.9043	1779.9043	F	R	52	70
PSM	KPEPPAMPQPVPTA	1062	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=4645	20.55	2	1474.749	1474.7490	G	-	230	244
PSM	KPFLLPVEAVYSVPG	1063	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7914	30.192	2	1614.9021	1614.9021	E	R	256	271
PSM	KPGMVVTFAPVNVTTEV	1064	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7586	28.631	2	1787.9492	1787.9492	L	K	273	290
PSM	KPLLVEPEGLE	1065	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6527	25.296	2	1222.6809	1222.6809	I	K	901	912
PSM	KQILVPFPPQTAASPDEQ	1066	sp|Q9NVU0-2|RPC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6813	26.034	3	1965.0207	1965.0207	C	K	617	635
PSM	KQLPTPVGAVQQDPALSSN	1067	sp|Q9Y6M4-6|KC1G3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5851	23.769	3	1949.0218	1949.0218	G	R	216	235
PSM	KQMEELIEEPGLTCCIC	1068	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6876	26.196	2	2124.92	2124.9200	L	R	4801	4818
PSM	KQPVTDPLLTPVE	1069	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6652	25.599	2	1435.7922	1435.7922	N	K	28	41
PSM	KSDGEMVLPGFPDADSFV	1070	sp|Q01780-2|EXOSX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=7895	30.102	2	1925.8717	1925.8717	T	K	19	37
PSM	KSIDGTADDEDEGVPTDQAI	1071	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5583	23.229	2	2074.9179	2074.9179	N	R	627	647
PSM	KSIDGTADDEDEGVPTDQAI	1072	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5575	23.214	3	2074.9179	2074.9179	N	R	627	647
PSM	KSTEQQQAAPEPDPSTMTPQEQQQYWY	1073	sp|P49750-3|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:35	ms_run[2]:scan=6510	25.263	3	3211.404	3211.4040	N	R	272	299
PSM	KSYELPDGQVITIGNE	1074	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7005	26.558	2	1761.8785	1761.8785	E	R	238	254
PSM	KTDPTTLTDEEIN	1075	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4854	21.281	2	1475.6991	1475.6991	E	R	504	517
PSM	KTEAFTSPEALQPGGTALAP	1076	sp|Q7Z5J4-3|RAI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6854	26.13	2	1985.0106	1985.0106	F	K	1425	1445
PSM	KTELEDTLDSTAAQQEL	1077	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6406	24.993	2	1890.9058	1890.9058	L	R	1145	1162
PSM	KTPVAPAQNGIQPPISNS	1078	sp|Q8NG68|TTL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5233	22.404	3	1817.9636	1817.9636	L	R	106	124
PSM	KTSDIFGSPVTATS	1079	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6113	24.339	2	1409.7038	1409.7038	G	R	74	88
PSM	KTVLPTVPESPEEEV	1080	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6512	25.267	2	1652.8509	1652.8509	S	K	99	114
PSM	KTVPIDDSSETLEPVC	1081	sp|Q9Y5T5-5|UBP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4	ms_run[2]:scan=5778	23.627	2	1788.8451	1788.8451	G	R	9	25
PSM	KTVTNAVVTVPAYFNDSQ	1082	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8107	30.877	2	1952.9844	1952.9844	G	R	137	155
PSM	KVATPLPDPMAS	1083	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=5053	21.872	2	1241.6326	1241.6326	Q	R	919	931
PSM	KVDATEESDLAQQYGV	1084	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6377	24.923	2	1751.8214	1751.8214	A	R	81	97
PSM	KVELVPPTPAEIP	1085	sp|O75964|ATP5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7068	26.728	2	1388.7915	1388.7915	A	R	35	48
PSM	KVIGVLEPLDPEDYT	1086	sp|Q96RP9|EFGM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7712	29.223	2	1686.8716	1686.8716	G	K	551	566
PSM	KVVPCLVTPVTG	1087	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4	ms_run[2]:scan=6202	24.54	2	1268.7162	1268.7162	R	R	818	830
PSM	KYIAENGTDPINNQPLSEEQLIDI	1088	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7729	29.295	3	2713.3447	2713.3447	E	K	32	56
PSM	KYPDLYPQEDEDEEEE	1089	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5880	23.832	2	2026.8167	2026.8167	Q	R	100	116
PSM	MKPDETPMFDPSLL	1090	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35	ms_run[2]:scan=7516	28.331	2	1635.7524	1635.7524	-	K	1	15
PSM	MKPDETPMFDPSLL	1091	sp|Q96EK6|GNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=7760	29.44	2	1635.7524	1635.7524	-	K	1	15
PSM	RAAPLAAPPPAPAAPPAVAPPAGP	1092	sp|Q6SPF0|SAMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6255	24.648	3	2124.1844	2124.1844	Q	R	173	197
PSM	RDPAQPMSPGEATQSGA	1093	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=3968	17.615	2	1714.7581	1714.7581	S	R	4	21
PSM	REAGVEMGDEDDLSTPNE	1094	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=4808	21.127	2	1978.8062	1978.8062	L	K	256	274
PSM	RELDALDANDELTPLG	1095	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7210	27.168	2	1740.853	1740.8530	L	R	837	853
PSM	RESAAPAAAPTAEAPPPSVVT	1096	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5214	22.353	2	1989.0167	1989.0167	E	R	35	56
PSM	RIEEVPELPLVVED	1097	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7723	29.27	2	1635.872	1635.8720	H	K	143	157
PSM	RPGVATPLVSSSDYMPMAPQNVSAS	1098	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:35	ms_run[2]:scan=6782	25.953	3	2577.2203	2577.2203	M	K	704	729
PSM	RVLAPASTLQSSYQIPTENSMTA	1099	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	21-UNIMOD:35	ms_run[2]:scan=6512	25.267	3	2480.2217	2480.2217	E	R	1049	1072
PSM	RTLTIVDTGIGMT	1100	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:35	ms_run[1]:scan=6532	25.309583485333334	2	1392.726178	1392.728266	D	K	27	40
PSM	KTVTNAVVTVPAYFNDSQ	1101	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8074	30.771890648800003	2	1953.986164	1952.984357	G	R	137	155
PSM	KTVTNAVVTVPAYFNDSQ	1102	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8358	31.770400601866665	2	1953.987350	1952.984357	G	R	137	155
PSM	KSELVANNVTLPAGEQ	1103	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5867	23.802887426933335	2	1669.850764	1668.868265	L	R	17	33
PSM	KTVQGPPTSDDIFE	1104	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6054	24.22033665173333	2	1533.738428	1532.735853	K	R	32	46
PSM	KIDSVAAQPTATSPVVYT	1105	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=5712	23.49407058746667	2	1848.9502	1846.9672	P	R	621	639
PSM	KMINLSVPDTIDE	1106	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:35	ms_run[1]:scan=6508	25.259490005866667	2	1489.734184	1489.733411	C	R	165	178
PSM	KELLPVLISAM	1107	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:35	ms_run[1]:scan=7520	28.344686159200002	2	1228.709382	1228.710097	V	K	199	210
PSM	KPMMPQESLNGTGC	1108	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35,4-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=4213	18.705771390666666	2	1581.648812	1580.663300	M	R	706	720
PSM	KEVVAEDGTVVTI	1109	sp|Q8TBB5|KLDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6098	24.3121860712	2	1359.733320	1358.729311	V	K	386	399
PSM	RTETDSVGTPQSNGGM	1110	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:35	ms_run[1]:scan=3768	16.677666220266666	2	1652.695624	1651.710778	P	R	269	285
PSM	APKFPDSVEEL	1111	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6913	26.304	2	1230.6132	1230.6132	M	R	2	13
PSM	ATRGHVQDPND	1112	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=3629	15.997	2	1250.564	1250.5640	M	R	2	13
PSM	KAALSASEGEEVPQD	1113	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4624	20.454	2	1529.7209	1529.7209	K	K	25	40
PSM	KAAPGPGPSTFSFVPPS	1114	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7059	26.701	2	1642.8355	1642.8355	S	K	510	527
PSM	KAAVAVVPLVSED	1115	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6429	25.057	2	1296.7289	1296.7289	K	K	699	712
PSM	KAMDPQDLQNTEVPIATTA	1116	sp|Q9H2M9|RBGPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=5883	23.839	3	2057.9939	2057.9939	L	K	1340	1359
PSM	KAMGYQPLVTMDDAME	1117	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5270	22.508	2	1846.7787	1846.7787	K	R	345	361
PSM	KDASDDLDDLNFFNQ	1118	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7848	29.873	2	1755.7588	1755.7588	K	K	64	79
PSM	KDCEVVMMIGLPGAG	1119	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6449	25.115	2	1607.7357	1607.7357	K	K	476	491
PSM	KDDVMPATYCEIDLD	1120	sp|Q9HD45|TM9S3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=6502	25.249	2	1799.7594	1799.7594	F	K	99	114
PSM	KDISTTLNADEAVA	1121	sp|Q92598-3|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5514	23.075	2	1446.7202	1446.7202	G	R	319	333
PSM	KDLTIPESSTV	1122	sp|Q49A26-4|GLYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5544	23.151	2	1188.6238	1188.6238	E	K	110	121
PSM	KDPAEGDGAQPEETP	1123	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4048	17.968	2	1539.6689	1539.6689	S	R	191	206
PSM	KDPGVLQPVPLGG	1124	sp|O15014-2|ZN609_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6365	24.899	2	1275.7187	1275.7187	E	R	181	194
PSM	KDPLPPLDPQAI	1125	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7156	26.998	2	1302.7184	1302.7184	N	K	2579	2591
PSM	KDTTEVPSSTVE	1126	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4232	18.795	2	1291.6143	1291.6143	V	K	146	158
PSM	KDVDGLTSINAG	1127	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5220	22.368	2	1188.5986	1188.5986	E	R	122	134
PSM	KEAMEDGEIDGN	1128	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=3714	16.416	2	1322.5296	1322.5296	A	K	627	639
PSM	KEDEVDGEEQTQ	1129	sp|Q9UEE9-2|CFDP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3472	15.259	2	1405.5845	1405.5845	V	K	35	47
PSM	KEDSQPGEQNDQGETGSLPGQQE	1130	sp|Q9NUA8|ZBT40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4510	20.017	3	2457.0528	2457.0528	A	K	700	723
PSM	KEEDEEGEDVVTSTG	1131	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4408	19.577	2	1622.6795	1622.6795	A	R	1861	1876
PSM	KEGEEQPVLPEETESS	1132	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5046	21.854	2	1786.8109	1786.8109	K	K	2120	2136
PSM	KEITALAPSTM	1133	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=4898	21.433	2	1176.606	1176.6060	Q	K	315	326
PSM	KELEGILLPSD	1134	sp|Q13438-8|OS9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7140	26.954	2	1212.6602	1212.6602	E	R	379	390
PSM	KEQGPYETYEGSPVS	1135	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5157	22.183	2	1669.7471	1669.7471	A	K	548	563
PSM	KETTLQAPQPPQAPQPLQP	1136	sp|Q8NEY8-3|PPHLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6150	24.435	3	2068.0953	2068.0953	M	R	346	365
PSM	KEVPMVVVPPVGA	1137	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=6069	24.251	2	1336.7425	1336.7425	P	K	175	188
PSM	KEVTTLTADPPDGI	1138	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6038	24.176	2	1455.7457	1455.7457	Y	K	18	32
PSM	KGPDGLTAFEATDNQAI	1139	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7003	26.553	2	1746.8424	1746.8424	V	K	97	114
PSM	KIDDMTAAPMDV	1140	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4613	20.417	2	1337.5843	1337.5843	Y	R	93	105
PSM	KILDILGETC	1141	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=7307	27.526	2	1160.6111	1160.6111	E	K	147	157
PSM	KLAEIGAPIQGN	1142	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5419	22.87	2	1209.6717	1209.6717	A	R	35	47
PSM	KLASEEPPDDEEALATI	1143	sp|Q9UBB4-2|ATX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6729	25.811	2	1826.8786	1826.8786	L	R	224	241
PSM	KLGEPDYIPSQQDILLA	1144	sp|Q14344-2|GNA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7613	28.767	2	1898.9989	1898.9989	D	R	88	105
PSM	KLLMMAGIDDCYTSA	1145	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35,5-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=5849	23.766	2	1719.7518	1719.7518	K	R	212	227
PSM	KLMIEMDGTEN	1146	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4455	19.786	2	1311.5687	1311.5687	D	K	92	103
PSM	KLMIEMDGTEN	1147	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=5422	22.877	2	1295.5737	1295.5737	D	K	92	103
PSM	KLQETEMMDPELDYTLM	1148	sp|Q92896-3|GSLG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35,8-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=6466	25.161	3	2133.9156	2133.9156	F	R	854	871
PSM	KLSDVTLVPVSCSELE	1149	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=7277	27.41	2	1774.9023	1774.9023	Q	K	251	267
PSM	KMGQPSDPTAVVDPQT	1150	sp|Q8NE62|CHDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35	ms_run[2]:scan=4873	21.335	2	1685.7931	1685.7931	C	R	517	533
PSM	KMPGAPETAPGDGAGAS	1151	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4451	19.766	2	1512.6879	1512.6879	G	R	9	26
PSM	KPAVDDDDEGMETLEEDTEESS	1152	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=5225	22.385	3	2455.9544	2455.9544	D	R	889	911
PSM	KPEPPAMPQPVPTA	1153	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=4673	20.649	3	1474.749	1474.7490	G	-	230	244
PSM	KPEPPAMPQPVPTA	1154	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5466	22.975	2	1458.7541	1458.7541	G	-	230	244
PSM	KPLMGVIYVPLTD	1155	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=7386	27.821	2	1460.7949	1460.7949	M	K	206	219
PSM	KPLPPPPTQTEEEEDPAM	1156	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	18-UNIMOD:35	ms_run[2]:scan=4969	21.625	3	2020.9299	2020.9299	T	K	1162	1180
PSM	KPMCVESFSDYPPLG	1157	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=6796	25.99	2	1741.7691	1741.7691	G	R	408	423
PSM	KPQVVVAPVLMS	1158	sp|Q9H074-3|PAIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=5952	23.977	2	1282.7319	1282.7319	A	K	3	15
PSM	KPTDPDDPLADQNI	1159	sp|Q9NW64-2|RBM22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6079	24.27	2	1537.726	1537.7260	E	K	136	150
PSM	KSDIDEIVLVGGST	1160	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6561	25.382	2	1431.7457	1431.7457	K	R	353	367
PSM	KSIDLPIQSSLC	1161	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=6837	26.089	2	1359.7068	1359.7068	V	R	578	590
PSM	KSPGSTPTTPTSSQAPQ	1162	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3862	17.133	2	1670.8111	1670.8111	P	K	429	446
PSM	KSQLLAPPPPSAPPGN	1163	sp|P49750-3|YLPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5446	22.938	2	1569.8515	1569.8515	S	K	241	257
PSM	KTAVDGPDLEMLTGQE	1164	sp|Q14318|FKBP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7260	27.344	2	1702.8084	1702.8084	L	R	201	217
PSM	KTDPSTLTEEEVS	1165	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4850	21.269	2	1434.6726	1434.6726	N	K	547	560
PSM	KTDPTTLTDEEIN	1166	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5121	22.073	2	1475.6991	1475.6991	E	R	504	517
PSM	KTDTLEDLFPTT	1167	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7596	28.681	2	1379.682	1379.6820	E	K	469	481
PSM	KTGQATVASGIPAGWMGLDCGPESS	1168	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=7012	26.584	3	2492.1312	2492.1312	A	K	269	294
PSM	KTGQEVVFVAEPDN	1169	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5771	23.615	2	1531.7518	1531.7518	Q	K	410	424
PSM	KTLFVGLPPPAD	1170	sp|O15381-3|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7088	26.784	2	1253.702	1253.7020	D	R	545	557
PSM	KTPTLASPVPTTPFL	1171	sp|Q9NRA8-2|4ET_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7640	28.875	2	1568.8814	1568.8814	R	R	617	632
PSM	KTTDDTTTDNYIAQG	1172	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4674	20.654	2	1642.7322	1642.7322	I	K	594	609
PSM	KTVTNAVVTVPAYFNDSQ	1173	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8010	30.538	2	1952.9844	1952.9844	G	R	137	155
PSM	KTVTNAVVTVPAYFNDSQ	1174	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8228	31.306	2	1952.9844	1952.9844	G	R	137	155
PSM	KVAGQDGSVVQF	1175	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6021	24.138	2	1233.6354	1233.6354	L	K	21	33
PSM	KVIGGDDLSTLTG	1176	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6227	24.592	2	1274.6718	1274.6718	I	K	115	128
PSM	KVLEMDPLPSS	1177	sp|Q96SI9-2|STRBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=5246	22.442	2	1230.6166	1230.6166	Y	K	310	321
PSM	KVLIDPVSVQD	1178	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6066	24.247	2	1211.6762	1211.6762	L	K	785	796
PSM	KVLQATVVAVGSGS	1179	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5362	22.746	2	1314.7507	1314.7507	G	K	40	54
PSM	KVPPAVIIPPAAPLSG	1180	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6971	26.467	2	1525.9232	1525.9232	G	R	1860	1876
PSM	PGHLQEGFGCVVTN	1181	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=5844	23.759	2	1513.6984	1513.6984	M	R	2	16
PSM	PGVKLTTQAYC	1182	sp|O43402-2|EMC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4	ms_run[2]:scan=5181	22.249	2	1236.6173	1236.6173	M	K	2	13
PSM	RDMTLPPETNVILT	1183	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=6583	25.438	2	1614.8287	1614.8287	A	K	448	462
PSM	RGTGLQPGEEELPDIAPPLVTPDEP	1184	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7700	29.158	3	2626.3126	2626.3126	L	K	603	628
PSM	RLFPPDDSPLPVSS	1185	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7589	28.647	2	1525.7777	1525.7777	L	R	63	77
PSM	RLLDPEDVDVPQPDE	1186	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6708	25.749	2	1735.8265	1735.8265	T	K	202	217
PSM	RPGFTSLPGSTMTPPPSGPNPYA	1187	sp|Q92734-2|TFG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:35	ms_run[2]:scan=6445	25.104	3	2344.1158	2344.1158	P	R	356	379
PSM	RDVQGTDASLDEELD	1188	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5444	22.9333014232	2	1661.747687	1661.738038	S	R	337	352
PSM	KDLYANTVLSGGTTMYPGIAD	1189	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	15-UNIMOD:35	ms_run[1]:scan=7290	27.45710874106667	2	2204.046667	2202.051451	R	R	291	312
PSM	KSQVFSTAADGQTQVEI	1190	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6257	24.649754577866666	2	1807.900396	1807.895208	K	K	468	485
PSM	KLEEDINSSMTNSTAAS	1191	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:35	ms_run[1]:scan=4397	19.5284804864	2	1813.790573	1812.804738	D	R	78	95
PSM	KSPASDTYIVFGEA	1192	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7004	26.556723082933335	2	1483.722593	1483.719475	Y	K	1976	1990
PSM	KPADTEPPPLLVY	1193	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7203	27.151110662933334	2	1439.773031	1438.770782	I	K	941	954
PSM	KCDFTGTLIVVPDVS	1194	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:4	ms_run[1]:scan=7619	28.792816495466663	2	1649.833001	1649.833459	D	K	241	256
PSM	KLVLVGDGGTG	1195	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5455	22.954751259200002	2	1014.570466	1014.570960	F	K	12	23
PSM	RSLDGAPIGVMDQSLM	1196	sp|O43491|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	16-UNIMOD:35	ms_run[1]:scan=6895	26.2479272928	2	1706.856784	1704.817492	S	K	549	565
PSM	KLEEDISSSMTNSTAAS	1197	sp|Q15366|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:35	ms_run[1]:scan=4482	19.8928572264	2	1785.792918	1785.793839	D	R	78	95
PSM	KTSDVNETQPPQSE	1198	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3734	16.51251522826667	2	1559.700849	1558.711095	S	-	1963	1977
PSM	KDVIAINQDPLG	1199	sp|P06280|AGAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6489	25.210486271733334	2	1281.684203	1281.692866	D	K	314	326
PSM	KFMIQGGDFSNQNGTGGESIYGE	1200	sp|Q08752|PPID_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35	ms_run[1]:scan=6838	26.091080286933334	3	2452.050794	2451.064869	K	K	79	102
PSM	KEVPMVVVPPVGA	1201	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6795	25.988299728	2	1320.747804	1320.747544	P	K	175	188
PSM	KVAQMPQEEVELLPPAP	1202	sp|Q15059|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7271	27.389476036266668	2	1874.990588	1874.981186	Q	K	136	153
PSM	KSLQQPGLPSQSCSVQSSGGQPPG	1203	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4	ms_run[1]:scan=5028	21.807098613333334	3	2410.154886	2410.154687	P	R	503	527
PSM	AADKGPAAGP	1204	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3507	15.414	2	853.42938	853.4294	M	R	2	12
PSM	KAALDGTPGMIGYGMA	1205	sp|P09417-2|DHPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5507	23.064	2	1583.7324	1583.7324	A	K	107	123
PSM	KAFYPEEISSMVLT	1206	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=7201	27.146	2	1629.796	1629.7960	T	K	112	126
PSM	KAGAVEVPGDCVPSEGDY	1207	sp|O75147-2|OBSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:4	ms_run[2]:scan=5831	23.734	2	1848.82	1848.8200	E	R	571	589
PSM	KAIADTGANVVVTGG	1208	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5014	21.775	2	1371.7358	1371.7358	V	K	208	223
PSM	KAPLVPPGSPVVNALF	1209	sp|Q9NPH2-2|INO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7843	29.847	2	1604.929	1604.9290	F	R	337	353
PSM	KATTADGSSILD	1210	sp|Q9BT78-2|CSN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4770	20.983	2	1177.5826	1177.5826	Q	R	290	302
PSM	KDDEEEDPLDQLIS	1211	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7646	28.905	2	1644.7366	1644.7366	K	R	17	31
PSM	KDEEMIGPIID	1212	sp|Q9NTK5-3|OLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=6009	24.11	2	1274.6064	1274.6064	L	K	155	166
PSM	KDMTPYALPVIGEV	1213	sp|Q9H6R7-2|WDCP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=7764	29.461	2	1547.7905	1547.7905	S	R	244	258
PSM	KDPDDVVPVGQ	1214	sp|Q9Y287-2|ITM2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4876	21.343	2	1167.5772	1167.5772	C	R	39	50
PSM	KDPLPPLDPQAI	1215	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7279	27.416	2	1302.7184	1302.7184	N	K	2579	2591
PSM	KEDPDMASAVAAI	1216	sp|Q14232-2|EI2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6642	25.573	2	1316.6282	1316.6282	M	R	15	28
PSM	KEEIFGPVQPLF	1217	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7916	30.202	2	1402.7497	1402.7497	A	K	414	426
PSM	KEEPVSSGPEEAVG	1218	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4366	19.383	2	1413.6624	1413.6624	S	K	564	578
PSM	KEGLELPEDEEE	1219	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5580	23.223	2	1415.6304	1415.6304	T	K	538	550
PSM	KEITALAPSTM	1220	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=5023	21.794	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1221	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=7745	29.373	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1222	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=7931	30.279	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1223	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=8034	30.623	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1224	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=8143	31.006	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1225	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=8239	31.342	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1226	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=8333	31.68	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	1227	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5759	23.595	2	1160.6111	1160.6111	Q	K	315	326
PSM	KELASQPDVDGFLVGGASL	1228	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7532	28.396	2	1901.9735	1901.9735	C	K	219	238
PSM	KEPSPPIDEVINTP	1229	sp|O60684|IMA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6519	25.28	2	1534.7879	1534.7879	S	R	110	124
PSM	KETIDAVPNAIPG	1230	sp|O43670-2|ZN207_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5822	23.713	2	1323.7034	1323.7034	H	R	59	72
PSM	KETTLQAPQPPQAPQPLQP	1231	sp|Q8NEY8-3|PPHLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6171	24.473	3	2068.0953	2068.0953	M	R	346	365
PSM	KEVEGDDVPESIMLEM	1232	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:35	ms_run[2]:scan=6926	26.335	2	1835.8169	1835.8169	R	K	577	593
PSM	KGLTPTGMLPSGVLSGG	1233	sp|Q08209-4|PP2BA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=6586	25.444	2	1586.8338	1586.8338	L	K	192	209
PSM	KGLVVDMDGFEEE	1234	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=6146	24.421	2	1482.6548	1482.6548	E	R	432	445
PSM	KIDSVAAQPTATSPVVYT	1235	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5747	23.572	3	1846.9676	1846.9676	P	R	579	597
PSM	KIETTVPPSGLNLN	1236	sp|P26358-3|DNMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5957	23.99	2	1481.809	1481.8090	N	R	194	208
PSM	KLDPGSEETQTLV	1237	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5558	23.18	2	1415.7144	1415.7144	R	R	401	414
PSM	KLEPSTSTDQPVTPEPTSQAT	1238	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4795	21.077	3	2213.0699	2213.0699	P	R	1149	1170
PSM	KLLEGAPTEDTLVQME	1239	sp|Q8NFG4|FLCN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35	ms_run[2]:scan=6247	24.633	2	1788.8815	1788.8815	E	K	272	288
PSM	KLLTECPPMMDTEYT	1240	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6302	24.745	2	1843.8042	1843.8042	T	K	792	807
PSM	KLPDLSPVEN	1241	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5882	23.836	2	1110.5921	1110.5921	Q	K	2100	2110
PSM	KLSTPDVVSPFGTPFGSSVMN	1242	sp|Q9BTX1-4|NDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:35	ms_run[2]:scan=7649	28.917	3	2182.0616	2182.0616	S	R	437	458
PSM	KMLPTYVCATPDGTE	1243	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=5386	22.803	2	1697.7641	1697.7641	V	K	510	525
PSM	KPEDPSLLEDP	1244	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5686	23.447	2	1238.603	1238.6030	A	R	222	233
PSM	KPMEIDGEVEIPSS	1245	sp|O60907-2|TBL1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=5703	23.48	2	1545.7232	1545.7232	A	K	159	173
PSM	KPVAIQTYPILGE	1246	sp|Q8TED0|UTP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7038	26.643	2	1427.8024	1427.8024	Y	K	5	18
PSM	KSILFVPTSAP	1247	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7036	26.639	2	1158.6649	1158.6649	F	R	384	395
PSM	KSPSDLLDASAVSATS	1248	sp|O60499-2|STX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6366	24.901	2	1547.7679	1547.7679	Q	R	82	98
PSM	KSPVESTTEPPAV	1249	sp|P53992-2|SC24C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4837	21.222	2	1340.6824	1340.6824	T	R	204	217
PSM	KTAVVVGTITDDV	1250	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5850	23.768	2	1316.7187	1316.7187	N	R	49	62
PSM	KTDPSILGGMIV	1251	sp|P48047|ATPO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35	ms_run[2]:scan=6812	26.031	2	1245.6639	1245.6639	A	R	176	188
PSM	KTPEPVVPTAPEL	1252	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6511	25.265	2	1376.7551	1376.7551	V	R	892	905
PSM	KTVALDGTLFQ	1253	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6835	26.085	2	1191.6499	1191.6499	H	K	637	648
PSM	KTVFGVEPDLT	1254	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6716	25.77	2	1204.634	1204.6340	M	R	318	329
PSM	KTVTNAVVTVPAYFNDSQ	1255	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8324	31.648	2	1952.9844	1952.9844	G	R	137	155
PSM	KTVVLPPIVAS	1256	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6647	25.589	2	1122.7012	1122.7012	K	R	442	453
PSM	KVGDPQELNGIT	1257	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5349	22.711	2	1269.6565	1269.6565	T	R	298	310
PSM	KVLEVPPVVYS	1258	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6672	25.644	2	1228.7067	1228.7067	D	R	130	141
PSM	KVLLSPDYLPAM	1259	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:35	ms_run[2]:scan=6856	26.135	2	1361.7265	1361.7265	F	R	632	644
PSM	KVLPMNTGVEAGETAC	1260	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:4	ms_run[2]:scan=5325	22.661	2	1675.7909	1675.7909	H	K	135	151
PSM	KVPEESVLPLVQ	1261	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7057	26.694	2	1336.7602	1336.7602	E	K	494	506
PSM	KVPIPAPNEVLND	1262	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6484	25.196	2	1404.7613	1404.7613	N	R	512	525
PSM	KVPLPSLSPTMQAGTIA	1263	sp|P10515|ODP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=6655	25.608	2	1725.9335	1725.9335	Q	R	93	110
PSM	KVPLPSLSPTMQAGTIA	1264	sp|P10515|ODP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7195	27.13	2	1709.9386	1709.9386	Q	R	93	110
PSM	KVPQVSTPTLVEVS	1265	sp|P02768-3|ALBU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6376	24.921	2	1482.8294	1482.8294	K	R	225	239
PSM	MHRDSCPLDC	1266	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4340	19.259	2	1347.5006	1347.5006	-	K	1	11
PSM	MLGGSGSHGR	1267	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3694	16.318	2	1015.4505	1015.4505	-	R	1	11
PSM	PDPSKSAPAP	1268	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3800	16.826	2	965.48181	965.4818	M	K	2	12
PSM	RAEEPMATEPAPAGAPGDLGSQPPAA	1269	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=5334	22.676	3	2503.1649	2503.1649	D	K	1275	1301
PSM	RVPLAPITDPQQLQLSPL	1270	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7846	29.863	2	1985.131	1985.1310	L	K	5	23
PSM	SPAAAAAGAGER	1271	sp|A8CG34|P121C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3589	15.801	2	1027.5047	1027.5047	M	R	2	14
PSM	KDPGMGAMGGMGGGMGGGMF	1272	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:35,19-UNIMOD:35	ms_run[1]:scan=4398	19.533834662666667	2	1833.679018	1833.697653	E	-	554	574
PSM	RTLTIVDTGIGMT	1273	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:35	ms_run[1]:scan=6194	24.5253554456	2	1392.730456	1392.728266	D	K	27	40
PSM	KDLYANTVLSGGTTMYPGIAD	1274	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:35	ms_run[1]:scan=8123	30.936454099733332	3	2203.053881	2202.051451	R	R	291	312
PSM	KEITALAPSTM	1275	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:35	ms_run[1]:scan=7840	29.833665699466668	2	1176.608162	1176.606025	Q	K	317	328
PSM	KDIDDDLEGEVTEECG	1276	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:4	ms_run[1]:scan=6197	24.5303783768	2	1822.742795	1822.741469	P	K	473	489
PSM	RPAMEPGNGSLDLGGDSAG	1277	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:35	ms_run[1]:scan=5378	22.782748248533334	2	1816.788986	1815.805741	G	R	50	69
PSM	KPVVPSVPMASPAPG	1278	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5973	24.029966972533334	2	1432.781787	1432.774822	R	R	640	655
PSM	KILDQGEDFPASEMT	1279	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6447	25.112003512266664	2	1680.760644	1679.771253	G	R	208	223
PSM	KVTAPQPAATNGDLAS	1280	sp|P98194|AT2C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4592	20.342196192533333	2	1540.774442	1539.789286	S	R	197	213
PSM	KEIQEPDPTYEE	1281	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4795	21.076684741333334	2	1476.663175	1476.662020	Q	K	71	83
PSM	RDAEDAMDAMDGAVLDG	1282	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=5763	23.6019948392	2	1768.707384	1766.708729	K	R	66	83
PSM	KQQVTILATPLPEESM	1283	sp|Q12846|STX4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7298	27.489037701866668	2	1784.927317	1783.938987	E	K	64	80
PSM	KEADASPASAGIC	1284	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:4	ms_run[1]:scan=4266	18.931307341066667	2	1275.575811	1275.576516	S	R	218	231
PSM	PEPAKSAPAP	1285	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=3704	16.366147468266668	2	963.5012	963.5020	M	K	2	12
PSM	PEPTKSAPAP	1286	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=3749	16.588043856800002	2	993.5117	993.5126	M	K	2	12
PSM	KGDPTGAGPEASLEPGADSVSMQAFS	1287	sp|P98175|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	22-UNIMOD:35	ms_run[1]:scan=6391	24.951806764533334	3	2522.125852	2521.127863	T	R	472	498
PSM	KDDIAQVDYVEPSQNTISL	1288	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7281	27.423106764266667	2	2135.052830	2134.042994	Y	K	287	306
PSM	KEVTPEGLQMV	1289	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6313	24.770039331466666	2	1229.629548	1229.632574	L	K	235	246
PSM	KFMIQGGDFSNQNGTGGESIYGE	1290	sp|Q08752|PPID_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35	ms_run[1]:scan=6830	26.073397087466667	3	2452.050794	2451.064869	K	K	79	102
PSM	KDVNSSSPVMLAF	1291	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=7066	26.721251338133335	2	1409.683196	1409.686067	G	K	27	40
PSM	KELTVSNNDINEAGV	1292	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5486	23.023642482133333	2	1602.772488	1601.789680	F	R	173	188
PSM	MRGGGFGDRD	1293	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=4119	18.26972866	2	1124.465843	1124.466906	-	R	1	11
PSM	KQLQEETPPGGPLTEALPPA	1294	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6900	26.267197869866667	3	2073.074456	2072.078986	V	R	138	158
PSM	KADEDPALFQSV	1295	sp|P48739|PIPNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6709	25.753	2	1318.6405	1318.6405	Y	K	155	167
PSM	KAPAGQEEPGTPPSSPLSAEQLD	1296	sp|P13051-2|UNG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5907	23.88	3	2305.1074	2305.1074	K	R	41	64
PSM	KAPIAAPEPEL	1297	sp|P11171-7|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5820	23.709	2	1134.6285	1134.6285	L	K	129	140
PSM	KASEVMGPVEAAPEY	1298	sp|Q8WWY3-2|PRP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=5264	22.494	2	1592.7392	1592.7392	A	R	76	91
PSM	KATNPFEDDEEEEPAVPEVEEE	1299	sp|Q8IYI6|EXOC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6815	26.039	3	2531.0711	2531.0711	S	K	307	329
PSM	KDGNGYISAAEL	1300	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6424	25.044	2	1236.5986	1236.5986	D	R	95	107
PSM	KDLYANTVLSGGTTMYPGIAD	1301	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:35	ms_run[2]:scan=7789	29.581	3	2202.0514	2202.0515	R	R	291	312
PSM	KDMFQETMEAM	1302	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4220	18.733	2	1407.5356	1407.5356	D	R	316	327
PSM	KDPDPEFPTV	1303	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6274	24.69	2	1143.5448	1143.5448	Q	K	143	153
PSM	KDTGEIYTTSVTLD	1304	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6154	24.444	2	1541.7461	1541.7461	N	R	215	229
PSM	KDVDGVTDINLG	1305	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5962	24.005	2	1244.6248	1244.6248	E	K	177	189
PSM	KEDPDMASAVAAI	1306	sp|Q14232-2|EI2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=5328	22.667	2	1332.6231	1332.6231	M	R	15	28
PSM	KEDPTAVACTFSCMM	1307	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5609	23.279	3	1778.6984	1778.6984	P	K	714	729
PSM	KEEEAGGFIANLEPVSLAD	1308	sp|Q13868-3|EXOS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7793	29.596	2	1987.9739	1987.9739	H	R	182	201
PSM	KEELDDVIALD	1309	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7127	26.905	2	1258.6293	1258.6293	Q	-	534	545
PSM	KEEPEPLSPELEYIP	1310	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7584	28.62	2	1768.8771	1768.8771	G	R	50	65
PSM	KEIVPVLVST	1311	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6539	25.327	2	1083.654	1083.6540	D	R	200	210
PSM	KELLLQPVTIS	1312	sp|P59998|ARPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7056	26.693	2	1239.7438	1239.7438	S	R	44	55
PSM	KELQPIVYTPEDC	1313	sp|Q8NI77|KI18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4	ms_run[2]:scan=6059	24.231	2	1590.76	1590.7600	S	R	698	711
PSM	KENGPVVETVQVPLS	1314	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6427	25.052	2	1594.8566	1594.8566	R	K	601	616
PSM	KEPIQPETPQP	1315	sp|P49643|PRI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4686	20.701	2	1262.6507	1262.6507	K	K	463	474
PSM	KESVTDYTTPSSSLPNTVATNNT	1316	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5757	23.592	3	2426.1449	2426.1449	A	K	2184	2207
PSM	KEVDEQMLNVQN	1317	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=4416	19.61	2	1461.677	1461.6770	M	K	324	336
PSM	KGAEEMETVIPVDVM	1318	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=7198	27.137	2	1662.7845	1662.7845	A	R	12	27
PSM	KGDNITLLQSVSN	1319	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6607	25.489	2	1387.7307	1387.7307	L	-	80	93
PSM	KGIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNS	1320	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6815	26.039	4	3375.608	3375.6080	A	R	642	678
PSM	KGIVVTAYSPLGSPD	1321	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6761	25.896	2	1502.7981	1502.7981	S	R	203	218
PSM	KGLSEDTTEETL	1322	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5070	21.916	2	1321.6249	1321.6249	V	K	577	589
PSM	KIDIIPNPQE	1323	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6018	24.13	2	1165.6343	1165.6343	L	R	72	82
PSM	KIDIIPNPQE	1324	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6181	24.492	2	1165.6343	1165.6343	L	R	72	82
PSM	KIETIEVMED	1325	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=5091	21.978	2	1221.5799	1221.5799	G	R	129	139
PSM	KLPIGDVATQYFAD	1326	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7456	28.1	2	1536.7824	1536.7824	S	R	88	102
PSM	KLTLPLFGAM	1327	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=7808	29.673	2	1105.6206	1105.6206	K	K	602	612
PSM	KPEPPAMPQPVPTA	1328	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=5534	23.129	2	1474.749	1474.7490	G	-	230	244
PSM	KPGEPEPQILDFQTQQY	1329	sp|Q15067-3|ACOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7357	27.708	2	2016.9793	2016.9793	I	K	275	292
PSM	KPVVEMDGDEMT	1330	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=3806	16.855	2	1381.5741	1381.5741	A	R	48	60
PSM	KSAPWNSFLPPPPPMPGP	1331	sp|Q16637-4|SMN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:35	ms_run[2]:scan=7756	29.422	3	1931.9604	1931.9604	P	R	186	204
PSM	KSPFVVNVAPPLDLS	1332	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7722	29.264	2	1581.8766	1581.8766	P	K	953	968
PSM	KSVIGTPEFMAPEMYEE	1333	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=6631	25.545	2	1988.8747	1988.8747	A	K	381	398
PSM	KTEPVSILQPQTTVNPD	1334	sp|P51513-2|NOVA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6249	24.637	2	1865.9735	1865.9735	A	R	129	146
PSM	KTEQDLALGTDAEGQ	1335	sp|O00186|STXB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5010	21.767	2	1574.7424	1574.7424	C	K	367	382
PSM	KTGDLGDINAEQLPG	1336	sp|Q9Y263|PLAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6203	24.542	2	1526.7577	1526.7577	S	R	325	340
PSM	KTPSSDVLVFDYT	1337	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7412	27.923	2	1470.7242	1470.7242	T	K	108	121
PSM	KTPVPSDIDIS	1338	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5625	23.313	2	1170.6132	1170.6132	L	R	313	324
PSM	KTVEVLEPEVT	1339	sp|Q96F07-2|CYFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5626	23.315	2	1242.6707	1242.6707	E	K	110	121
PSM	KVAEVLQVPPM	1340	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=5553	23.17	2	1225.674	1225.6740	N	R	100	111
PSM	KVASPSPSGSVLFTDEGVP	1341	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7106	26.838	2	1872.9469	1872.9469	R	K	95	114
PSM	KVFDGIPPPYD	1342	sp|Q6NVV1|R13P3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6643	25.576	2	1246.6234	1246.6234	L	K	17	28
PSM	KVGDDVEFEVSSD	1343	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5819	23.707	2	1424.6307	1424.6307	L	R	64	77
PSM	PAYHSSLMDPDT	1344	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5324	22.659	2	1332.5656	1332.5656	M	K	2	14
PSM	PDPAKSAPAP	1345	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3838	17.014	2	949.4869	949.4869	M	K	2	12
PSM	PDPAKSAPAP	1346	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3920	17.404	2	949.4869	949.4869	M	K	2	12
PSM	PGHLQEGFGCVVTN	1347	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:4	ms_run[2]:scan=8041	30.647	2	1513.6984	1513.6984	M	R	2	16
PSM	PTTSRPALDV	1348	sp|Q99966|CITE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5175	22.228	2	1055.5611	1055.5611	M	K	2	12
PSM	RAAEDDEDDDVDT	1349	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3697	16.334	2	1464.5488	1464.5488	K	K	89	102
PSM	RDGEDQTQDTELVET	1350	sp|P10321-2|HLAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4987	21.681	2	1734.7544	1734.7544	Q	R	243	258
PSM	REPFDLGEPEQSNGGFPCTTAP	1351	sp|Q99961-3|SH3G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	18-UNIMOD:4	ms_run[2]:scan=7364	27.732	3	2405.0594	2405.0594	P	K	196	218
PSM	RGAPAAAAAAAPPPTPAPPPPPAPVAAAAPA	1352	sp|Q6SPF0|SAMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6062	24.24	3	2661.4391	2661.4391	P	R	116	147
PSM	KMVVPGLDGAQIP	1353	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:35	ms_run[1]:scan=6575	25.418116101333332	2	1339.719492	1339.716973	L	R	1158	1171
PSM	KEELQANGSAPAAD	1354	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4075	18.08565286026667	2	1400.641327	1399.657937	A	K	55	69
PSM	KDATNVGDEGGFAPNILEN	1355	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7880	30.027035199733334	2	1960.920454	1959.917400	G	K	202	221
PSM	KEITALAPSTM	1356	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:35	ms_run[1]:scan=7863	29.943508914400002	2	1176.608162	1176.606025	Q	K	317	328
PSM	KDAGTIAGLNVM	1357	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:35	ms_run[1]:scan=5672	23.41687320533333	2	1204.609848	1204.612173	T	R	185	197
PSM	KMTNGFSGADLTEICQ	1358	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=6582	25.436120259733332	2	1787.770241	1786.786586	A	R	677	693
PSM	KQSFLFGTQNTSPSSPAAPAASSAPPMF	1359	sp|Q96HA1|P121A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	27-UNIMOD:35	ms_run[1]:scan=7426	27.9814616312	3	2839.350546	2839.348696	P	K	701	729
PSM	KPADTEPPPLLVY	1360	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7230	27.23852894346667	2	1439.773031	1438.770782	I	K	941	954
PSM	KEDPLLTPVPASENPF	1361	sp|P59768|GBG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7473	28.150150072	2	1752.908318	1752.893417	A	R	46	62
PSM	KNSGMPPGAAAIAVLPVTLDTPMN	1362	sp|P09417|DHPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=7597	28.68624003253333	3	2396.217280	2396.207969	G	R	167	191
PSM	PEPAKSAPAP	1363	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=3617	15.937191966933334	2	963.5012	963.5020	M	K	2	12
PSM	KLAPITYPQGLAMA	1364	sp|P60763|RAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	13-UNIMOD:35	ms_run[1]:scan=6695	25.70838078106667	2	1488.805747	1488.801037	K	R	133	147
PSM	KGLVVDMDGFEEE	1365	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=5957	23.990244499466666	2	1482.653221	1482.654826	E	R	432	445
PSM	PAYHSSLMDPDT	1366	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=5328	22.6668929512	2	1332.5643	1332.5651	M	K	2	14
PSM	KEDPDMASAVAAI	1367	sp|Q14232|EI2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:35	ms_run[1]:scan=5324	22.659192821866668	2	1332.621563	1332.623132	M	R	15	28
PSM	RDPSESSFSSATLTPSSTCPSLVDS	1368	sp|O60333|KIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	19-UNIMOD:4	ms_run[1]:scan=6740	25.8339384616	3	2616.173107	2614.170456	G	R	1617	1642
PSM	KGVINIIPGSGGIAGQ	1369	sp|Q3SY69|AL1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=6985	26.49722772426667	2	1479.8112	1479.8402	P	R	641	657
PSM	KASLNGADIYSGCCTL	1370	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=6479	25.18468220853333	2	1729.764327	1728.781106	A	K	248	264
PSM	KPVPDEEPNSTDVEETLE	1371	sp|P28289|TMOD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5880	23.832016234666664	2	2026.923432	2026.921876	Y	R	171	189
PSM	AANYSSTSTR	1372	sp|Q9BTV4|TMM43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3458	15.197	2	1056.4836	1056.4836	M	R	2	12
PSM	KADTLTPEECQQF	1373	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=5543	23.149	2	1565.7032	1565.7032	A	K	194	207
PSM	KADTTSTVTPVPGQE	1374	sp|Q9H9B1-4|EHMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4467	19.838	2	1529.7573	1529.7573	A	K	644	659
PSM	KAGPPASIVPLM	1375	sp|O96013-2|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=6044	24.188	2	1195.6635	1195.6635	A	R	409	421
PSM	KALSTDPAAPNL	1376	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5355	22.727	2	1196.6401	1196.6401	A	K	1320	1332
PSM	KDDPENDNSELPTA	1377	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4738	20.878	2	1543.6638	1543.6638	Q	K	754	768
PSM	KDDVSTFPLIAA	1378	sp|Q7Z7C8|TAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7496	28.242	2	1275.6711	1275.6711	F	R	205	217
PSM	KDEPDTNLVALM	1379	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7439	28.034	2	1344.6595	1344.6595	A	K	125	137
PSM	KDLEPTTPQEYIL	1380	sp|A0AVF1-2|IFT56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7177	27.058	2	1545.7926	1545.7926	I	K	309	322
PSM	KDLFDPIIED	1381	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7494	28.233	2	1203.6023	1203.6023	F	R	86	96
PSM	KDLFDPIIED	1382	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7590	28.652	2	1203.6023	1203.6023	F	R	86	96
PSM	KDLFDPIIED	1383	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7682	29.073	2	1203.6023	1203.6023	F	R	86	96
PSM	KDLFDPIIED	1384	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7889	30.073	2	1203.6023	1203.6023	F	R	86	96
PSM	KDLYANTVLSGGTTMYPGIAD	1385	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:35	ms_run[2]:scan=8370	31.809	2	2202.0514	2202.0515	R	R	291	312
PSM	KDSYVGDEAQS	1386	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3953	17.546	2	1197.515	1197.5150	Q	K	50	61
PSM	KDTVYAVIPAE	1387	sp|Q5TC12-2|ATPF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6126	24.371	2	1204.634	1204.6340	A	K	21	32
PSM	KEAMEDGEIDGN	1388	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=3584	15.777	2	1322.5296	1322.5296	A	K	627	639
PSM	KEAPPPVLLTP	1389	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6422	25.038	2	1160.6805	1160.6805	D	K	1325	1336
PSM	KEDGAISTIVL	1390	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7018	26.602	2	1144.634	1144.6340	E	R	294	305
PSM	KEDLENGEDVATCPSCSLII	1391	sp|Q96FX2|DPH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=7278	27.413	2	2249.0192	2249.0192	T	K	36	56
PSM	KEDQTEYLEE	1392	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4877	21.346	2	1282.5565	1282.5565	L	R	186	196
PSM	KEEIDILSDACS	1393	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=6517	25.276	2	1378.6286	1378.6286	T	K	542	554
PSM	KEGLELPEDEEE	1394	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5792	23.655	2	1415.6304	1415.6304	T	K	538	550
PSM	KEIEIDIEPTD	1395	sp|Q15843|NEDD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6259	24.653	2	1300.6398	1300.6398	G	K	11	22
PSM	KEIGNIISDAM	1396	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=5672	23.417	2	1205.5962	1205.5962	D	K	180	191
PSM	KELVYPPDYNPEG	1397	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5800	23.674	2	1519.7195	1519.7195	F	K	485	498
PSM	KENPVLDVVSNPEQTAGEE	1398	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6544	25.34	3	2053.9804	2053.9804	H	R	54	73
PSM	KFLDGIYVSE	1399	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6793	25.985	2	1169.5968	1169.5968	R	K	174	184
PSM	KGLPLGSAVSSPVLFSPVG	1400	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7814	29.701	2	1811.0193	1811.0193	R	R	35	54
PSM	KIPDEFDNDPILVQQL	1401	sp|Q3ZCQ8|TIM50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7794	29.602	2	1882.9676	1882.9676	A	R	97	113
PSM	KLATQLTGPVMPV	1402	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6890	26.232	2	1353.769	1353.7690	L	R	98	111
PSM	KLDDDGLIAPGV	1403	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6634	25.556	2	1211.6398	1211.6398	D	R	847	859
PSM	KLEAEGVPEVSE	1404	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5277	22.524	2	1285.6402	1285.6402	V	K	67	79
PSM	KMFVLDEADEMLS	1405	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6476	25.176	2	1558.6895	1558.6895	I	R	177	190
PSM	KMLVLDEADEMLN	1406	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5947	23.967	2	1551.716	1551.7160	I	K	182	195
PSM	KMNLPGEVTFLPLN	1407	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=7606	28.73	2	1587.8331	1587.8331	N	K	578	592
PSM	KPLSDDPTVSAS	1408	sp|Q969U7-2|PSMG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4304	19.104	2	1215.5983	1215.5983	L	R	201	213
PSM	KPQPLQQPSQPQQPPPTQQAVA	1409	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4903	21.442	3	2392.2499	2392.2499	L	R	3	25
PSM	KQLEPLVAPLADG	1410	sp|Q96JC1-2|VPS39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6819	26.051	2	1349.7555	1349.7555	G	K	193	206
PSM	KSGTQDIQPGPLFNNNADGVATDITST	1411	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7245	27.296	3	2760.3202	2760.3202	G	R	416	443
PSM	KSLVDLTAVDVPT	1412	sp|O75489-2|NDUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7288	27.445	2	1356.75	1356.7500	F	R	109	122
PSM	KSPDPNPIMTDTPIP	1413	sp|Q92859-3|NEO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=6124	24.366	2	1637.7971	1637.7971	D	R	1177	1192
PSM	KTEEMPNDSVLEN	1414	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=4299	19.081	2	1520.6665	1520.6665	D	K	150	163
PSM	KTETILPPESENP	1415	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5314	22.636	2	1453.73	1453.7300	S	K	731	744
PSM	KTMLESAGGLIQTA	1416	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=5955	23.983	2	1434.7388	1434.7388	A	R	1604	1618
PSM	KTPTSSPASSPLVA	1417	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4955	21.586	2	1341.714	1341.7140	L	K	709	723
PSM	KVALVYGQMNEPPGA	1418	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=5687	23.45	2	1588.7919	1588.7919	S	R	264	279
PSM	KVEEAEPEEFVVE	1419	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6383	24.934	2	1532.7246	1532.7246	K	K	21	34
PSM	KVPTTLMPVNTVAL	1420	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=6799	25.998	2	1498.8429	1498.8429	S	K	297	311
PSM	KVQIPIMLVGN	1421	sp|Q15382|RHEB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=7073	26.745	2	1226.7057	1226.7057	G	K	109	120
PSM	MDGPTRGHGL	1422	sp|Q8WXX7-2|AUTS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4412	19.599	2	1097.4924	1097.4924	-	R	1	11
PSM	PFSNSHNAL	1423	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4744	20.903	2	985.46174	985.4617	M	K	2	11
PSM	PGHLQEGFGCVVTN	1424	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=8326	31.655	2	1513.6984	1513.6984	M	R	2	16
PSM	RDGDFENPVPYTGAV	1425	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6830	26.073	2	1635.7529	1635.7529	F	K	122	137
PSM	RDMTLPPETNVILT	1426	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7137	26.94	2	1598.8338	1598.8338	A	K	448	462
PSM	RLDGLVETPTGYIESLP	1427	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7811	29.689	2	1858.9676	1858.9676	E	R	14	31
PSM	RLMTDTINEPILLC	1428	sp|O43776|SYNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=7260	27.344	2	1703.8586	1703.8586	E	R	425	439
PSM	RVPTANVSVVDLTC	1429	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=6572	25.413	2	1529.7872	1529.7872	F	R	192	206
PSM	RVTTEEFEAPMPSAVSGDDSQLTAS	1430	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=6282	24.708	3	2640.1861	2640.1861	T	R	2109	2134
PSM	KDYEEVGVDSVEGEGEEEGEEY	1431	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8677	32.94929048986667	2	2476.996702	2475.992534	E	-	430	452
PSM	PGHLQEGFGCVVTN	1432	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	10-UNIMOD:4	ms_run[1]:scan=8137	30.982901809333335	2	1514.7012	1513.6982	M	R	2	16
PSM	KLDDDGLIAPGV	1433	sp|P30876|RPB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6677	25.655810281866664	2	1211.639872	1211.639768	D	R	847	859
PSM	KINVPELPTPDEDN	1434	sp|O43264|ZW10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6528	25.298183684533335	2	1579.764274	1579.772967	S	K	430	444
PSM	KLVVECVMNNVTCT	1435	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=5427	22.8873166256	2	1682.762998	1681.783749	G	R	115	129
PSM	RPPAPESVGTEEMPEDGEPDAAEL	1436	sp|Q86TM6|SYVN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6447	25.112003512266664	3	2522.125852	2522.111878	E	R	580	604
PSM	PEPAKSAPAP	1437	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=3536	15.544298784266665	2	963.5012	963.5020	M	K	2	12
PSM	KYPDLYPQEDEDEEEE	1438	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5860	23.784335285066668	2	2026.816313	2026.816742	Q	R	100	116
PSM	KELVYPPDYNPEG	1439	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5999	24.089308659999997	2	1520.732768	1519.719475	F	K	526	539
PSM	RDVIDEPIIEEPS	1440	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6507	25.258050445333332	2	1510.752303	1510.751503	Q	R	437	450
PSM	KELPAAEPVLSPLEGT	1441	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=6989	26.506496463733335	2	1650.8792	1649.8872	P	K	265	281
PSM	KLEGTEDLSDVLV	1442	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7319	27.564433087466668	2	1416.735899	1416.734791	L	R	725	738
PSM	KDFLPVDPATSNG	1443	sp|P10586|PTPRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6378	24.92556302026667	2	1359.658004	1359.667045	F	R	170	183
PSM	KMAVLANGVMNSLQD	1444	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=5202	22.311222596533334	2	1622.764317	1621.780378	G	R	502	517
PSM	RLGEPDSAGAGEPPATPAGLGSGGD	1445	sp|Q09019|DMWD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=5525	23.102227383466666	3	2236.0422	2235.0402	V	R	100	125
PSM	KIAEENGAAFAGGTSLIQ	1446	sp|Q9BYD6|RM01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6737	25.827263720266668	2	1776.889721	1775.905378	V	K	168	186
PSM	KTAENATSGETLEENEAGD	1447	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4532	20.110466194933334	2	1965.829301	1964.844688	S	-	376	395
PSM	KAAPEPQQPMELYQPSAESL	1448	sp|Q96BH1|RNF25_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=6329	24.815	3	2229.0623	2229.0623	L	R	213	233
PSM	KAPILIATDVAS	1449	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6296	24.736	2	1197.6969	1197.6969	G	R	468	480
PSM	KAVGDGIVLC	1450	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=5593	23.245	2	1030.5481	1030.5481	F	K	113	123
PSM	KAYVDDTPAEQM	1451	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:35	ms_run[2]:scan=4254	18.878	2	1382.6024	1382.6024	G	K	288	300
PSM	KDADLTDTAQT	1452	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4010	17.804	2	1177.5463	1177.5463	S	R	44	55
PSM	KDATNVGDEGGFAPNILEN	1453	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8509	32.319	2	1959.9174	1959.9174	G	K	202	221
PSM	KDEEMIGPIID	1454	sp|Q9NTK5-3|OLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6746	25.853	2	1258.6115	1258.6115	L	K	155	166
PSM	KDIPGLTDTTVP	1455	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6356	24.876	2	1255.666	1255.6660	E	R	119	131
PSM	KDMDGVEMDETD	1456	sp|Q96PV7-2|F193B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=3620	15.954	2	1415.5068	1415.5068	P	R	398	410
PSM	KDPTEEATPTPFG	1457	sp|Q9H2M9|RBGPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5648	23.363	2	1388.646	1388.6460	V	K	1235	1248
PSM	KDVNSSSPVMLAF	1458	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=7080	26.763	2	1409.6861	1409.6861	G	K	27	40
PSM	KDVVMEPTM	1459	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3986	17.696	2	1080.4831	1080.4831	A	K	850	859
PSM	KDVVMEPTM	1460	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=4448	19.751	2	1064.4882	1064.4882	A	K	850	859
PSM	KDYEEVGVDSVEGEGEEEGEEY	1461	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8328	31.662	2	2475.9925	2475.9925	E	-	314	336
PSM	KEDDALWPPPD	1462	sp|P61326|MGN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6781	25.951	2	1281.5877	1281.5877	T	R	71	82
PSM	KEDGTFYEFGEDIPEAPE	1463	sp|O43776|SYNC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7524	28.366	3	2071.8898	2071.8898	K	R	407	425
PSM	KEGLELPEDEEE	1464	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5754	23.587	2	1415.6304	1415.6304	T	K	538	550
PSM	KEIDDSVLGQTGPY	1465	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6384	24.936	2	1520.7359	1520.7359	K	R	188	202
PSM	KELEEIVQPIIS	1466	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7166	27.02	2	1396.7813	1396.7813	K	K	621	633
PSM	KELPIEVTMVCC	1467	sp|O75970-5|MPDZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35,11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6301	24.744	2	1493.6928	1493.6928	L	R	620	632
PSM	KESEITDEDIDGILE	1468	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7191	27.116	2	1704.7942	1704.7942	S	R	665	680
PSM	KEVGEAICTDPLVS	1469	sp|P51649|SSDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=6152	24.438	2	1516.7443	1516.7443	A	K	265	279
PSM	KGCDVVVIPAGVP	1470	sp|P40926-2|MDHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4	ms_run[2]:scan=6868	26.173	2	1309.7064	1309.7064	L	R	91	104
PSM	KGEIPALPPC	1471	sp|O75439|MPPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=5688	23.452	2	1080.5638	1080.5638	H	K	268	278
PSM	KIGQQPQQPGAPPQQDYT	1472	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4808	21.127	2	1979.9701	1979.9701	K	K	628	646
PSM	KLAVNMVPFP	1473	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=6908	26.288	2	1130.6158	1130.6158	R	R	252	262
PSM	KLITPPPPPPSPE	1474	sp|Q96HE9|PRR11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5435	22.913	2	1368.7653	1368.7653	S	R	30	43
PSM	KLMIEMDGTEN	1475	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=4547	20.172	2	1311.5687	1311.5687	D	K	92	103
PSM	KLPEPSASLPNPPS	1476	sp|Q5TBB1-2|RNH2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5789	23.648	2	1432.7562	1432.7562	L	K	233	247
PSM	KLPFPIIDD	1477	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7672	29.026	2	1056.5855	1056.5855	E	R	97	106
PSM	KMGQPSDPTAVVDPQT	1478	sp|Q8NE62|CHDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=4863	21.315	2	1685.7931	1685.7931	C	R	517	533
PSM	KMVVPGLDGAQIP	1479	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=6770	25.923	2	1339.717	1339.7170	L	R	1158	1171
PSM	KNPLPPSVGVVD	1480	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5628	23.318	2	1220.6765	1220.6765	R	K	79	91
PSM	KPDMLSEYPIVDG	1481	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=6304	24.75	2	1478.6963	1478.6963	Y	K	206	219
PSM	KPGDLGVDLTS	1482	sp|P38117|ETFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5815	23.701	2	1100.5714	1100.5714	I	K	210	221
PSM	KPQPLQQPSQPQQPPPTQQAVA	1483	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4913	21.463	3	2392.2499	2392.2499	L	R	3	25
PSM	KPSLTNPFPAVEPAVV	1484	sp|Q8TEM1-2|PO210_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7545	28.455	2	1664.9138	1664.9138	N	K	727	743
PSM	KPTIVEEDDPELF	1485	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7094	26.8	2	1530.7454	1530.7454	G	K	146	159
PSM	KPTLMAAVPEIMD	1486	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6031	24.159	2	1446.7098	1446.7098	L	R	376	389
PSM	KPTLMAAVPEIMD	1487	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=6821	26.056	2	1430.7149	1430.7149	L	R	376	389
PSM	KPVTVSPTTPTSPTEGEAS	1488	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4681	20.681	2	1884.9317	1884.9317	R	-	505	524
PSM	KPVVGIIYPPPEV	1489	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7309	27.531	2	1406.8173	1406.8173	S	R	37	50
PSM	KSDTDTGVCSGTDEDPDD	1490	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4	ms_run[2]:scan=3966	17.604	2	1912.7116	1912.7116	S	K	548	566
PSM	KSEDGTPAEDGTPAATGGSQPPSMG	1491	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	24-UNIMOD:35	ms_run[2]:scan=4146	18.395	3	2360.0074	2360.0074	R	R	1185	1210
PSM	KSQVFSTAADGQTQVEI	1492	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6281	24.706	2	1807.8952	1807.8952	K	K	468	485
PSM	KSTLTDSLVC	1493	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=5112	22.047	2	1122.5591	1122.5591	G	K	32	42
PSM	KSVFDVLDGEEM	1494	sp|Q8N1G2|CMTR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:35	ms_run[2]:scan=7308	27.528	2	1383.6228	1383.6228	C	R	203	215
PSM	KTALPAQSAATLPA	1495	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5316	22.639	2	1338.7507	1338.7507	A	R	2177	2191
PSM	KTDAEATDTEATET	1496	sp|Q9Y3D3|RT16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3611	15.909	2	1481.6369	1481.6369	Q	-	124	138
PSM	KTDGFGIDTC	1497	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=5407	22.85	2	1112.4808	1112.4808	L	R	135	145
PSM	KTEEMPNDSVLEN	1498	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=4588	20.333	2	1520.6665	1520.6665	D	K	150	163
PSM	KTGAAPIIDVV	1499	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6671	25.643	2	1082.6336	1082.6336	N	R	94	105
PSM	KTIAPLVASGAVQLI	1500	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7667	29.008	2	1479.9025	1479.9025	Y	-	209	224
PSM	KTVSPPTVCTIPTVVG	1501	sp|Q9BWT3|PAPOG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4	ms_run[2]:scan=6564	25.39	2	1654.8964	1654.8964	V	R	596	612
PSM	KVDATAETDLA	1502	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4720	20.826	2	1132.5612	1132.5612	A	K	234	245
PSM	KVDSPTVTTTL	1503	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5367	22.759	2	1160.6289	1160.6289	C	K	457	468
PSM	KVEALPEQVAPES	1504	sp|Q96RE7|NACC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5266	22.498	2	1395.7246	1395.7246	E	R	318	331
PSM	KVIEEQLEPAVE	1505	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5575	23.214	2	1382.7293	1382.7293	R	K	1224	1236
PSM	KVLTMPETC	1506	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=4106	18.215	2	1093.5148	1093.5148	L	R	859	868
PSM	KVMVLDFVTPTPLGT	1507	sp|Q16881-5|TRXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35	ms_run[2]:scan=7792	29.591	2	1632.8797	1632.8797	K	R	37	52
PSM	KVPEGPIPPSTP	1508	sp|P16278-2|BGAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5134	22.11	2	1217.6656	1217.6656	E	K	228	240
PSM	KVPLPSLSPTMQAGTIA	1509	sp|P10515|ODP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=6790	25.978	2	1725.9335	1725.9335	Q	R	93	110
PSM	KVSPDMAIFITMNPGYAG	1510	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6930	26.347	2	1942.9169	1942.9169	V	R	2007	2025
PSM	KYSDPPVNFLPVPS	1511	sp|Q6P158-3|DHX57_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7508	28.289	2	1558.8031	1558.8031	H	R	329	343
PSM	MKPPGGESSNLFGSPEEATPSS	1512	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=5847	23.764	3	2220.9845	2220.9845	-	R	1	23
PSM	PAVSKGDGM	1513	sp|O94973-3|AP2A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=3369	14.816	2	876.40112	876.4011	M	R	2	11
PSM	PGHLQEGFGCVVTN	1514	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=8232	31.32	2	1513.6984	1513.6984	M	R	2	16
PSM	PGHLQEGFGCVVTN	1515	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=8464	32.155	2	1513.6984	1513.6984	M	R	2	16
PSM	RADIPLPEGEASPPAPPL	1516	sp|Q9Y487|VPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7115	26.862	2	1825.9574	1825.9574	N	K	74	92
PSM	RAPLPDLYPFGTM	1517	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35	ms_run[2]:scan=7666	29.003	2	1492.7384	1492.7384	I	R	68	81
PSM	RDPTDALSYMTIQQ	1518	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=5992	24.069	2	1653.7668	1653.7668	E	K	275	289
PSM	RLFPPDDSPLPVSS	1519	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6865	26.167	2	1525.7777	1525.7777	L	R	63	77
PSM	RPAASLAQPPTPQPPPVNGILVPNGFS	1520	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7665	28.998	3	2721.4602	2721.4602	S	K	137	164
PSM	RVLIVSEDPELPYM	1521	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:35	ms_run[2]:scan=7093	26.797	2	1675.8491	1675.8491	A	R	71	85
PSM	KEGLELPEDEEE	1522	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5558	23.179924808800003	2	1415.630190	1415.630385	T	K	411	423
PSM	KMDATANDVPSD	1523	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35	ms_run[1]:scan=3745	16.5666211016	2	1279.525094	1278.539796	A	R	582	594
PSM	KLGLPPLTPEQQEALQ	1524	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7160	27.004372276799998	2	1760.968014	1760.967250	A	K	53	69
PSM	RPAMEPGNGSLDLGGDSAG	1525	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5868	23.804260277866668	2	1800.793640	1799.810826	G	R	50	69
PSM	RDGDFENPVPYTGAV	1526	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6838	26.091080286933334	2	1635.755939	1635.752900	F	K	122	137
PSM	KILIANTGMDTD	1527	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=5060	21.890048029333332	2	1307.626930	1306.643868	A	K	236	248
PSM	AANYSSTSTR	1528	sp|Q9BTV4|TMM43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=3446	15.146426390933334	2	1056.4826	1056.4831	M	R	2	12
PSM	RGTELDDGIQADSGPINDTDANP	1529	sp|P55210|CASP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5825	23.720731585866666	3	2372.068958	2370.057141	C	R	187	210
PSM	RDPESETDNDSQEIF	1530	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5918	23.905753317866665	2	1780.751556	1780.738767	Y	K	2485	2500
PSM	RDPESETDNDSQEIF	1531	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5959	23.994813125333334	2	1780.751556	1780.738767	Y	K	2485	2500
PSM	KAETPTESVSEPEVAT	1532	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4852	21.276681285333332	2	1673.808789	1673.799576	S	K	192	208
PSM	KTMTDVVGNPEEE	1533	sp|Q96GM5|SMRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	3-UNIMOD:35	ms_run[1]:scan=4368	19.393279333333332	2	1464.6792	1463.6442	L	R	464	477
PSM	KSPAGLQVLNDYLAD	1534	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7212	27.172816862133335	2	1603.808434	1602.825337	L	K	7	22
PSM	KFMQTFVLAPEGSVPN	1535	sp|Q9UN86|G3BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35	ms_run[1]:scan=6984	26.4950276064	2	1780.889718	1779.886558	R	K	107	123
PSM	GCDGGTIPK	1536	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=3788	16.772	2	903.41202	903.4120	M	R	2	11
PSM	KADLINNLGTIA	1537	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7406	27.899	2	1241.698	1241.6980	T	K	95	107
PSM	KAPDDLVAPVV	1538	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6392	24.954	2	1122.6285	1122.6285	T	K	14	25
PSM	KAVEYGLIQPNQDGE	1539	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5937	23.943	2	1659.8104	1659.8104	D	-	915	930
PSM	KDAPISPASIASSSSTPSS	1540	sp|Q04727-4|TLE4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5445	22.936	2	1788.8741	1788.8741	K	K	262	281
PSM	KDCEECIQLEPTFI	1541	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7622	28.808	2	1780.8012	1780.8012	L	K	391	405
PSM	KDCVGPEVE	1542	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4	ms_run[2]:scan=4272	18.958	2	1031.4594	1031.4594	L	K	69	78
PSM	KDIELSPEAQA	1543	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5069	21.913	2	1199.6034	1199.6034	A	K	880	891
PSM	KDIPGLTDTTVP	1544	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6189	24.511	2	1255.666	1255.6660	E	R	119	131
PSM	KDIPGLTDTTVP	1545	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6419	25.031	2	1255.666	1255.6660	E	R	119	131
PSM	KDPADETEAD	1546	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3410	15.01	2	1089.4462	1089.4462	S	-	140	150
PSM	KDTEPLIQTA	1547	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5061	21.892	2	1114.587	1114.5870	I	K	67	77
PSM	KDVLVATDVAS	1548	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5213	22.348	2	1116.6027	1116.6027	K	K	483	494
PSM	KDVTDSFYPAM	1549	sp|P49917|DNLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=5856	23.777	2	1288.5646	1288.5646	H	R	58	69
PSM	KEAPEPGMEVV	1550	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35	ms_run[2]:scan=4587	20.33	2	1200.5696	1200.5696	S	K	440	451
PSM	KEEDEEEDVPGQA	1551	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4212	18.7	2	1473.6107	1473.6107	D	K	401	414
PSM	KEEDSAIPITVPG	1552	sp|Q99856|ARI3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6350	24.86	2	1354.698	1354.6980	K	R	399	412
PSM	KEGEEAGPGDPLLEAVP	1553	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8020	30.573	2	1706.8363	1706.8363	A	K	352	369
PSM	KEGGDSMQAVSAPEEAPTDSAPE	1554	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=4646	20.552	3	2317.9856	2317.9856	Q	K	509	532
PSM	KEIQEPDPTYEE	1555	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4810	21.134	2	1476.662	1476.6620	Q	K	71	83
PSM	KELLESLPLS	1556	sp|Q13042-4|CDC16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7315	27.551	2	1127.6438	1127.6438	E	K	88	98
PSM	KELTAPDENIPA	1557	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5176	22.23	2	1296.6561	1296.6561	L	K	603	615
PSM	KEPAEADITELC	1558	sp|Q6QNY1|BL1S2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4	ms_run[2]:scan=5737	23.547	2	1374.6337	1374.6337	A	R	30	42
PSM	KEPPIIIVPESLEADT	1559	sp|Q9BYW2-3|SETD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7635	28.862	2	1749.94	1749.9400	L	K	239	255
PSM	KEVLLFPAM	1560	sp|Q15046-2|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=6946	26.386	2	1062.5784	1062.5784	I	K	593	602
PSM	KGEVYPFGIVGMAN	1561	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7667	29.008	2	1480.7384	1480.7384	M	K	597	611
PSM	KGILAADESTGSIA	1562	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5704	23.481	2	1331.6933	1331.6933	G	K	28	42
PSM	KGLAITFVSDENDA	1563	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6941	26.375	2	1478.7253	1478.7253	T	K	383	397
PSM	KGVEAGPDLLQ	1564	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5773	23.619	2	1125.603	1125.6030	G	-	400	411
PSM	KIDATSASVLAS	1565	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5200	22.305	2	1161.6241	1161.6241	A	R	119	131
PSM	KIDTIEIITD	1566	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6616	25.511	2	1159.6336	1159.6336	G	R	125	135
PSM	KIEVIEIMTD	1567	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35	ms_run[2]:scan=6262	24.659	2	1205.6213	1205.6213	G	R	130	140
PSM	KIIDGLLVM	1568	sp|O43447-2|PPIH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=6700	25.729	2	1016.594	1016.5940	G	R	100	109
PSM	KIPDPDSDDVSEVDA	1569	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5347	22.707	2	1600.7104	1600.7104	K	R	689	704
PSM	KIPPSSAPTVLSVPAGTTIV	1570	sp|P51610-2|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7268	27.376	3	1934.1088	1934.1088	Q	K	489	509
PSM	KLDEDEDEDDADLS	1571	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4599	20.369	2	1607.6322	1607.6322	Y	K	168	182
PSM	KLITPAVVSE	1572	sp|P62851|RS25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5561	23.186	2	1055.6227	1055.6227	Y	R	66	76
PSM	KLLDPEDVNVDQPDE	1573	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6242	24.622	2	1724.8105	1724.8105	T	K	252	267
PSM	KLVQAIFPTPDPAAL	1574	sp|Q92793-2|CBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7722	29.264	2	1579.8974	1579.8974	H	K	569	584
PSM	KMDATANDVPSD	1575	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=3789	16.777	2	1278.5398	1278.5398	A	R	582	594
PSM	KNPSTNFQEPVQPLTQQQVAQMQL	1576	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	22-UNIMOD:35	ms_run[2]:scan=6714	25.767	3	2769.3756	2769.3756	S	K	253	277
PSM	KPDSEDLSSQSSAS	1577	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3719	16.443	2	1436.6267	1436.6267	L	K	537	551
PSM	KQPGPVTNGQLQQPTTGAASGGYI	1578	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5938	23.944	3	2369.1975	2369.1975	S	K	117	141
PSM	KSFYPEEVSSMVLT	1579	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=6715	25.769	2	1631.7753	1631.7753	T	K	112	126
PSM	KSGDAAIVDMVPG	1580	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=5240	22.424	2	1274.6177	1274.6177	L	K	395	408
PSM	KSGDAAIVDMVPG	1581	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6518	25.278	2	1258.6227	1258.6227	L	K	395	408
PSM	KSIPLAMAPVFEQ	1582	sp|Q9UBF2|COPG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=6741	25.836	2	1445.7588	1445.7588	M	K	577	590
PSM	KSLSQPTPPPMPILSQSEA	1583	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=5709	23.49	3	2023.0296	2023.0296	R	K	4878	4897
PSM	KSPDSATVSGYDIM	1584	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:35	ms_run[2]:scan=5215	22.358	2	1485.6657	1485.6657	E	K	938	952
PSM	KTESEPGQQPMELEN	1585	sp|Q7L8L6|FAKD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=4192	18.61	2	1731.7621	1731.7621	G	K	645	660
PSM	KTLPSTDVAQPPSDSDAVGP	1586	sp|Q8N554-2|ZN276_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5300	22.592	2	1980.964	1980.9640	T	R	225	245
PSM	KTMYPAPVTSSVYLS	1587	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6685	25.682	2	1642.8276	1642.8276	T	R	794	809
PSM	KTPPAPSPFDLPEL	1588	sp|O95239|KIF4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7869	29.973	2	1507.7922	1507.7922	K	K	1180	1194
PSM	KVGDPQELNGIT	1589	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5329	22.668	2	1269.6565	1269.6565	T	R	298	310
PSM	KVGDPVYLLGQ	1590	sp|Q5VT66-3|MARC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7085	26.777	2	1187.655	1187.6550	I	-	242	253
PSM	KVGINYQPPTVVPGGDLA	1591	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6852	26.122	2	1823.9781	1823.9781	F	K	352	370
PSM	KVIEQLGTPCPEFM	1592	sp|P45983-3|MK08_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=6342	24.845	2	1663.795	1663.7950	N	K	236	250
PSM	KVPIDGPPIDIG	1593	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6772	25.925	2	1219.6812	1219.6812	C	R	1714	1726
PSM	PEPSKSAPAP	1594	sp|Q99877|H2B1N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3685	16.274	2	979.49746	979.4975	M	K	2	12
PSM	PLVTRNIEP	1595	sp|Q9Y6W5-2|WASF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5360	22.742	2	1037.5869	1037.5869	M	R	2	11
PSM	RDNSTMGYMMA	1596	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,9-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3803	16.839	2	1323.4894	1323.4894	L	K	612	623
PSM	REEPAPEEEEPLLLQ	1597	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6919	26.319	2	1777.8734	1777.8734	Q	R	321	336
PSM	RGTELDDGIQADSGPINDTDANP	1598	sp|P55210-4|CASP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5969	24.022	3	2370.0571	2370.0571	C	R	162	185
PSM	RLMDGEEPLPMLPSY	1599	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=7193	27.123	2	1778.8219	1778.8219	R	K	878	893
PSM	RNVPGFLPTNDLSQPTGFLAQPM	1600	sp|A5YKK6-3|CNOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	23-UNIMOD:35	ms_run[2]:scan=7787	29.571	3	2515.2529	2515.2529	A	K	1572	1595
PSM	RYPDQWIVPGGGMEPEEEPGGAAV	1601	sp|Q9NZJ9|NUDT4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:35	ms_run[2]:scan=7312	27.539	3	2556.1591	2556.1591	S	R	41	65
PSM	SKAHPPEL	1602	sp|P62308|RUXG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=4865	21.319	2	919.47633	919.4763	M	K	2	10
PSM	KEEDGSLSLDGADSTGVVA	1603	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8171	31.103477925333333	2	1850.866673	1848.858882	L	K	676	695
PSM	KEGLELPEDEEE	1604	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5785	23.6402904464	2	1415.633819	1415.630385	T	K	411	423
PSM	KTVTNAVVTVPAYFNDSQ	1605	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7233	27.2498684344	2	1954.974108	1952.984357	G	R	137	155
PSM	PGHLQEGFGCVVTN	1606	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	10-UNIMOD:4	ms_run[1]:scan=8460	32.14024413253333	2	1514.7062	1513.6982	M	R	2	16
PSM	KLPSTDQQESCSSTPGLEEPLF	1607	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	11-UNIMOD:4	ms_run[1]:scan=7354	27.697209129066668	3	2449.1325	2449.1314	G	K	1247	1269
PSM	KEQVLEPMLNGTE	1608	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35	ms_run[1]:scan=5493	23.041250871466666	2	1503.711757	1502.728660	Y	K	936	949
PSM	KAAAPAPEEEMDECEQALAAEP	1609	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=5529	23.113106468	3	2372.014433	2372.014808	K	K	253	275
PSM	KALTSETNGTDSNGSNSSNIQ	1610	sp|Q08209|PP2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4140	18.362725829333332	2	2124.940248	2123.956698	N	-	501	522
PSM	KLVDEDFPEDSSSQ	1611	sp|A6NDU8|CE051_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5681	23.437848431733336	2	1594.698671	1594.699862	N	K	81	95
PSM	KEQVLEPMLNGTD	1612	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35	ms_run[1]:scan=5460	22.96543678746667	2	1489.702172	1488.713010	Y	K	957	970
PSM	AKAYDHLF	1613	sp|P51153|RAB13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=6944	26.381043041599998	2	1005.4905	1005.4915	M	K	2	10
PSM	RTPPVPDSGSANGSFFAPS	1614	sp|Q9NPA3|M1IP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=6406	24.993287837066667	2	1891.8762	1889.8902	E	R	66	85
PSM	KTEPVSILQPQTTVNPD	1615	sp|P51513|NOVA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6201	24.5375177792	2	1865.973126	1865.973458	A	R	129	146
PSM	KVIGGDDLSTLTG	1616	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6137	24.400385388266667	2	1274.671415	1274.671797	I	K	115	128
PSM	KVAGQDGSVVQF	1617	sp|P61956|SUMO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6101	24.316040119733334	2	1234.620238	1233.635351	L	K	21	33
PSM	KGEIPALPPC	1618	sp|O75439|MPPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=5761	23.59784914133333	2	1080.562305	1080.563767	H	K	268	278
PSM	KLPTVPMLGLTQ	1619	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:35	ms_run[1]:scan=7028	26.622905919199997	2	1312.734934	1312.742459	N	R	884	896
PSM	KLPTVPMLGLTQ	1620	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:35	ms_run[1]:scan=7082	26.768092456533335	2	1312.734934	1312.742459	N	R	884	896
PSM	KVEIIANDQGN	1621	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4723	20.832880320799998	2	1200.598108	1199.614616	G	R	25	36
PSM	KDLGSLNGTFVNDV	1622	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7147	26.972891078666667	2	1478.725096	1477.741273	V	R	58	72
PSM	RAEVVMQDVAPNPDDPEDFPALS	1623	sp|Q5JVS0|HABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35	ms_run[1]:scan=7084	26.7741090064	3	2527.149875	2527.153684	P	-	391	414
PSM	ARDYDHLF	1624	sp|Q15286-2|RAB35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7022	26.611	2	1077.488	1077.4880	M	K	2	10
PSM	ATAVSRPCAG	1625	sp|Q9BTX1-4|NDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=3603	15.869	2	988.47601	988.4760	M	R	2	12
PSM	KADGGTQVIDT	1626	sp|P09622-2|DLDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4244	18.842	2	1103.5459	1103.5459	T	K	67	78
PSM	KADLINNLGTIA	1627	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7270	27.385	2	1241.698	1241.6980	T	K	95	107
PSM	KAGDEIDEPSE	1628	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4154	18.434	2	1188.5146	1188.5146	L	R	150	161
PSM	KAVDPSSVALVTLGSS	1629	sp|Q8TEM1-2|PO210_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7094	26.8	2	1529.8301	1529.8301	L	K	644	660
PSM	KDAFPPLPE	1630	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6456	25.135	2	1012.5229	1012.5229	Y	K	77	86
PSM	KDDVDVALLPTIVE	1631	sp|Q9Y5B6-2|PAXB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7786	29.565	2	1525.8239	1525.8239	E	K	668	682
PSM	KDGIILCELIN	1632	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4	ms_run[2]:scan=7797	29.618	2	1286.6904	1286.6904	L	K	53	64
PSM	KDINSVAIAPND	1633	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4916	21.473	2	1255.6408	1255.6408	D	K	480	492
PSM	KDLTGQVPTPVV	1634	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6027	24.148	2	1252.7027	1252.7027	Q	K	519	531
PSM	KDNPLDPVLA	1635	sp|Q96AG4|LRC59_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6379	24.927	2	1080.5815	1080.5815	L	K	116	126
PSM	KDPLPTIAS	1636	sp|Q9BZE1|RM37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5521	23.091	2	940.52295	940.5229	T	R	233	242
PSM	KDPTVSQTFMLD	1637	sp|Q9UKN8|TF3C4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35	ms_run[2]:scan=6394	24.958	2	1396.6544	1396.6544	S	R	137	149
PSM	KEDGTLPTNN	1638	sp|Q9NXF1-2|TEX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3769	16.683	2	1087.5146	1087.5146	L	R	48	58
PSM	KEEMDFPQLM	1639	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5818	23.706	2	1298.5523	1298.5523	V	K	122	132
PSM	KEIDTDSTSQGES	1640	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3470	15.249	2	1395.6001	1395.6001	R	K	2823	2836
PSM	KEVPAVPETL	1641	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5761	23.598	2	1081.6019	1081.6019	K	K	9	19
PSM	KIDDMTAAPMDV	1642	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=5420	22.872	2	1321.5894	1321.5894	Y	R	93	105
PSM	KIIEENITSAAPSNDQDGEYCPEV	1643	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	21-UNIMOD:4	ms_run[2]:scan=6370	24.909	3	2678.2018	2678.2018	R	K	300	324
PSM	KLDDDGLPFIGA	1644	sp|Q9H9Y6-4|RPA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7656	28.954	2	1259.6398	1259.6398	Q	K	595	607
PSM	KLEENLPILQQPTE	1645	sp|O60664-4|PLIN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6989	26.506	2	1650.8829	1650.8829	D	K	102	116
PSM	KLTDCVVM	1646	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=4403	19.557	2	980.46709	980.4671	G	R	34	42
PSM	KPEVIGEALNQLVPQ	1647	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7577	28.591	2	1633.9039	1633.9039	Y	K	591	606
PSM	KPGDLESAPVL	1648	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6169	24.469	2	1124.6077	1124.6077	C	R	587	598
PSM	KSPASDTYIVFGEA	1649	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7024	26.614	2	1483.7195	1483.7195	Y	K	1976	1990
PSM	KTDTLEDLFPTT	1650	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7368	27.749	2	1379.682	1379.6820	E	K	469	481
PSM	KVEPLEEAIPLPPT	1651	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7554	28.492	2	1531.8498	1531.8498	V	K	314	328
PSM	KYITGTDILDM	1652	sp|Q9Y3A6-2|TMED5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:35	ms_run[2]:scan=6418	25.029	2	1284.6272	1284.6272	K	K	141	152
PSM	PGHLQEGFGCVVTN	1653	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=7932	30.285	2	1513.6984	1513.6984	M	R	2	16
PSM	RDSSQGPCEPLPGPLTQP	1654	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=6413	25.018	2	1934.9156	1934.9156	A	R	100	118
PSM	RQEDAPMIEPLVPEE	1655	sp|Q9Y2J2-3|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35	ms_run[2]:scan=6579	25.429	2	1767.8349	1767.8349	A	K	588	603
PSM	RVLAPILPDNFSTPTGS	1656	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7435	28.016	2	1783.9468	1783.9468	E	R	280	297
PSM	SDIRHSLL	1657	sp|Q96N11-2|CG026_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6246	24.63	2	981.52434	981.5243	M	R	2	10
PSM	SPVLHFYV	1658	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7424	27.971	2	960.5069	960.5069	M	R	2	10
PSM	VGEEKMSL	1659	sp|P35610|SOAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35	ms_run[2]:scan=4043	17.946	2	907.43208	907.4321	M	R	2	10
PSM	VVEHPEFL	1660	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6407	24.996	2	968.49673	968.4967	M	K	2	10
PSM	KEEPAAAGSGAASPSAAE	1661	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3774	16.70979936213333	2	1599.738165	1599.737644	D	K	69	87
PSM	KDYEEVGVDSVEGEGEEEGEEY	1662	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8568	32.53577464746667	2	2475.979832	2475.992534	E	-	430	452
PSM	KDLFDPIIED	1663	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8098	30.8489944416	2	1204.605210	1203.602320	F	R	86	96
PSM	KAVYMMPTEGDDSS	1664	sp|Q93009|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=4104	18.20832066053333	2	1562.641254	1561.627626	R	K	240	254
PSM	KTLETVPLE	1665	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5450	22.945964077066666	2	1028.574892	1028.575377	E	R	3	12
PSM	RPAMEPGNGSLDLGGDSAG	1666	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=5228	22.394055207199997	2	1816.788986	1815.805741	G	R	50	69
PSM	KMDSTANEVEAV	1667	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:35	ms_run[1]:scan=4586	20.324950245866667	2	1309.588949	1308.586747	A	K	424	436
PSM	KIIPLYSTLPPQQQQ	1668	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6887	26.225356758666667	2	1752.978261	1752.977421	I	R	384	399
PSM	RFLSNGYIPIPGQQD	1669	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7541	28.434364597333335	2	1704.844794	1703.863120	Y	K	308	323
PSM	KELALPGELTQS	1670	sp|O75436|VP26A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6418	25.029364700533332	2	1284.692240	1284.692532	V	R	93	105
PSM	KTVFGVEPDLT	1671	sp|Q96KP4|CNDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6688	25.6931267136	2	1204.634054	1204.633954	M	R	402	413
PSM	KEALPDGVNIS	1672	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5730	23.532728692	2	1142.600408	1141.597903	I	K	20	31
PSM	KQADVPAAVTAAAATTPAAEDAAA	1673	sp|P17677|NEUM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6270	24.682489699466664	3	2182.096621	2181.091341	P	K	166	190
PSM	KLPTPTSSVPAQ	1674	sp|Q9BTA9|WAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4818	21.158059123999998	2	1224.671430	1224.671403	S	K	290	302
PSM	KDGIVLGADT	1675	sp|Q99436|PSB7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5313	22.6306494896	2	987.522778	987.523676	Y	R	52	62
PSM	KVTETVMNGGM	1676	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=3531	15.517526154133332	2	1198.520169	1197.536960	D	K	788	799
PSM	REPPPPPFSVN	1677	sp|Q01968|OCRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5930	23.93086762933333	2	1236.634801	1235.629872	H	K	175	186
PSM	RDMYMESEGGDGYLAPENGYLMEAAPE	1678	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=7357	27.707634079733335	3	3026.219354	3026.225605	S	-	411	438
PSM	AAKGAHGSYL	1679	sp|Q9ULT0-3|TTC7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4856	21.286	2	1015.5087	1015.5087	M	K	2	12
PSM	KAAFGEEVDAVDTGIS	1680	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6001	24.092	2	1607.7679	1607.7679	S	R	213	229
PSM	KDATNVGDEGGFAPNILEN	1681	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8564	32.523	2	1959.9174	1959.9174	G	K	202	221
PSM	KDDPTLLSSG	1682	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4973	21.641	2	1031.5135	1031.5135	R	R	125	135
PSM	KDITDVDEM	1683	sp|Q6NUQ1|RINT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=4286	19.02	2	1080.4645	1080.4645	Y	K	465	474
PSM	KDMSPLSETEMALG	1684	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6480	25.188	2	1539.6797	1539.6797	L	K	504	518
PSM	KDSPSVWAAVPG	1685	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6677	25.656	2	1212.6139	1212.6139	Y	K	26	38
PSM	KEDGAISTIVL	1686	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7170	27.031	2	1144.634	1144.6340	E	R	294	305
PSM	KEIGNIISDAM	1687	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35	ms_run[2]:scan=5236	22.412	2	1205.5962	1205.5962	D	K	180	191
PSM	KFSIYPPIPGEESSL	1688	sp|P82912-2|RT11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7653	28.938	2	1662.8505	1662.8505	T	R	58	73
PSM	KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	1689	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4956	21.587	5	3752.6409	3752.6409	A	-	157	196
PSM	KGIEILTDMS	1690	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=5984	24.051	2	1121.5638	1121.5638	E	R	113	123
PSM	KGPVFAPPYEPLPENV	1691	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7473	28.15	2	1752.9087	1752.9087	H	K	223	239
PSM	KLEGTEDLSDVLV	1692	sp|Q15003-2|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7481	28.175	2	1416.7348	1416.7348	L	R	589	602
PSM	KLPEPSASLPNPPS	1693	sp|Q5TBB1-2|RNH2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5774	23.621	2	1432.7562	1432.7562	L	K	233	247
PSM	KPSCTIIPLM	1694	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=6226	24.59	2	1174.609	1174.6090	L	K	776	786
PSM	KSYELPDGQVITIGNE	1695	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8166	31.087	2	1761.8785	1761.8785	E	R	238	254
PSM	KSYELPDGQVITIGNE	1696	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7738	29.336	2	1761.8785	1761.8785	E	R	238	254
PSM	KTGDVEDSTVL	1697	sp|Q9UNN5-2|FAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5167	22.206	2	1162.5717	1162.5717	W	K	146	157
PSM	KTLEEDEEELF	1698	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6771	25.925	2	1380.6297	1380.6297	I	K	39	50
PSM	KVAGQDGSVVQF	1699	sp|P61956-2|SUMO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5852	23.77	2	1233.6354	1233.6354	L	K	21	33
PSM	KVDPGLGGPLVPDLE	1700	sp|O95630-2|STABP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7469	28.141	2	1504.8137	1504.8137	G	K	187	202
PSM	KVPDGMVGFIIG	1701	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=7171	27.035	2	1247.6584	1247.6584	Y	R	106	118
PSM	KVPGVTDCVAEIQ	1702	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4	ms_run[2]:scan=5785	23.64	2	1414.7126	1414.7126	H	K	438	451
PSM	MVTRFLGP	1703	sp|O14957|QCR10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=5762	23.599	2	935.48987	935.4899	-	R	1	9
PSM	PFAEDKTY	1704	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4731	20.857	2	969.44436	969.4444	M	K	2	10
PSM	RAGAIAPCEVTVPAQNTGLGPE	1705	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4	ms_run[2]:scan=6265	24.668	3	2207.1005	2207.1005	A	K	112	134
PSM	RDGTLDGPQM	1706	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=3914	17.379	2	1104.487	1104.4870	S	-	313	323
PSM	RDPIPYLPPLE	1707	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7642	28.884	2	1308.7078	1308.7078	P	K	16	27
PSM	RPDLPSGDGQPALDPAIAAAFA	1708	sp|Q9UKA9-5|PTBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7857	29.918	3	2149.0804	2149.0804	T	K	274	296
PSM	RTTTGLDSAVDPVQM	1709	sp|Q96TA2-3|YMEL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:35	ms_run[2]:scan=5332	22.672	2	1605.7668	1605.7668	F	K	229	244
PSM	SKAHPPEL	1710	sp|P62308|RUXG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4759	20.947	2	919.47633	919.4763	M	K	2	10
PSM	KEEDGSLSLDGADSTGVVA	1711	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8125	30.943160363199997	2	1850.862497	1848.858882	L	K	676	695
PSM	RPPLPSEGPGNIPPPPPTN	1712	sp|Q15428|SF3A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5856	23.77686681093333	3	1933.005357	1933.005761	L	-	446	465
PSM	KSAEPSPTVMSTSLGSNLSELD	1713	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7305	27.52021243733333	3	2249.089090	2249.073308	Q	R	125	147
PSM	RAPPEPAPPAEATGAPAPS	1714	sp|P84157|MXRA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4753	20.931516939733335	2	1782.890409	1782.890063	A	R	39	58
PSM	RWDYPEGTPNGGSTTLPSAPPPASAGL	1715	sp|A0A0U1RRE5|NBDY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7122	26.88446706746667	3	2696.280320	2695.287809	P	K	33	60
PSM	KMDATANDVPSPYEV	1716	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=5812	23.696440298133332	2	1652.728807	1651.739953	A	R	433	448
PSM	KSVVAQIPPATSNGSSS	1717	sp|Q5MIZ7|P4R3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4796	21.079976325333334	2	1629.822826	1628.836964	S	K	789	806
PSM	KLATQLTGPVMPV	1718	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6883	26.214983650666667	2	1353.769943	1353.769008	L	R	145	158
PSM	KDPVIASDGYSYE	1719	sp|Q8N9V3|WSDU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5490	23.035265312	2	1442.669595	1442.656540	M	K	418	431
PSM	KMEEQTEILQNGFNPEED	1720	sp|Q9H8H0|NOL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=6490	25.213475707733334	3	2166.926804	2165.942294	E	K	538	556
PSM	KDDVVTFIDA	1721	sp|Q96J01|THOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7226	27.2233061576	2	1122.567786	1121.560455	N	K	161	171
PSM	KPGAFIPGAPVQPVVL	1722	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7606	28.729998060533333	2	1588.934247	1588.934100	F	R	221	237
PSM	KLPTVPMLGLTQ	1723	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:35	ms_run[1]:scan=7074	26.749159180266666	2	1312.734934	1312.742459	N	R	884	896
PSM	KVELVPPTPAEIP	1724	sp|O75964|ATP5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7169	27.0289989936	2	1388.791089	1388.791518	A	R	35	48
PSM	KNPDEIDETTELSS	1725	sp|P17301|ITA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5096	21.995203601866667	2	1577.702024	1576.710427	T	-	1168	1182
PSM	MAPAPPPAASFSPSEVQ	1726	sp|Q7L5A8|FA2H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=6556	25.369585101600002	2	1724.789945	1724.807973	-	R	1	18
PSM	KVPDPQMSMENLVES	1727	sp|Q8NEB9|PK3C3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=5082	21.952001778666666	2	1734.782329	1734.780438	V	K	254	269
PSM	KVDFPTAIGMVVE	1728	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	10-UNIMOD:35	ms_run[1]:scan=7335	27.625165942933332	2	1420.7247	1420.7267	P	R	34	47
PSM	MLGSGFKAE	1729	sp|P53990|IST1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:35	ms_run[1]:scan=4826	21.183169478666667	2	954.446926	954.448068	-	R	1	10
PSM	MKCKPNQT	1730	sp|Q8NFP7|NUD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=3359	14.770524831733333	2	1063.478085	1063.479051	-	R	1	9
PSM	KAADLNGDLTAT	1731	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4811	21.136190723466665	2	1189.582433	1188.598632	F	R	176	188
PSM	KVNGDASPAAAESGA	1732	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3898	17.30522699813333	2	1344.615866	1343.631723	V	K	40	55
PSM	KTVQGPPTSDDIFE	1733	sp|P04181|OAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6134	24.39220414853333	2	1532.735821	1532.735853	K	R	32	46
PSM	KLVINGNPITIFQE	1734	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7827	29.767270333066666	2	1585.873553	1584.887543	G	R	66	80
PSM	KNGQVIGIGAGQQS	1735	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4970	21.6282854616	2	1356.699903	1355.715727	A	R	437	451
PSM	KAAAGPLDMSLPSTPDI	1736	sp|P17544-4|ATF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=6992	26.514	2	1698.8498	1698.8498	K	K	88	105
PSM	KDATNVGDEGGFAPNILEN	1737	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8412	31.962	2	1959.9174	1959.9174	G	K	202	221
PSM	KDATNVGDEGGFAPNILEN	1738	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8604	32.672	2	1959.9174	1959.9174	G	K	202	221
PSM	KDGDGTITT	1739	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3662	16.159	2	906.42944	906.4294	D	K	22	31
PSM	KDGVGMVEYL	1740	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=6212	24.56	2	1125.5376	1125.5376	Q	R	144	154
PSM	KDLFDPIIED	1741	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8214	31.256	2	1203.6023	1203.6023	F	R	86	96
PSM	KDMNQPSSSFFSISPTSNSSATIA	1742	sp|Q9NUL3-4|STAU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:35	ms_run[2]:scan=7336	27.629	3	2519.1486	2519.1486	P	R	222	246
PSM	KDPNCVGTVLAS	1743	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4	ms_run[2]:scan=5125	22.083	2	1259.618	1259.6180	F	R	59	71
PSM	KEEAEAPVEDGSQPPPPEP	1744	sp|Q9Y4L1|HYOU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5036	21.827	3	2001.9167	2001.9167	L	K	623	642
PSM	KENVLIGDGAGF	1745	sp|P11310|ACADM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6772	25.925	2	1218.6245	1218.6245	P	K	259	271
PSM	KESLQDTQPVGVLVDCC	1746	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=6603	25.481	3	1946.9078	1946.9078	L	K	167	184
PSM	KGAEEMETVIPVDVM	1747	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7618	28.787	2	1646.7895	1646.7895	A	R	12	27
PSM	KIDGSLEVPLE	1748	sp|Q9NVM9-2|INT13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6650	25.594	2	1198.6445	1198.6445	Y	R	335	346
PSM	KLFDAPEAPLPS	1749	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6749	25.862	2	1283.6762	1283.6762	V	R	1120	1132
PSM	KLGDASIAAPFTS	1750	sp|Q9HD20-3|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6696	25.71	2	1276.6663	1276.6663	V	K	90	103
PSM	KLPFLPTPMG	1751	sp|Q9UJ83-4|HACL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=7266	27.368	2	1115.6049	1115.6049	Y	K	215	225
PSM	KLPQLPITNFS	1752	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7509	28.295	2	1256.7129	1256.7129	N	R	179	190
PSM	KLSDGVAVL	1753	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5899	23.867	2	900.52803	900.5280	A	K	396	405
PSM	KLTDCVVM	1754	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=4561	20.223	2	980.46709	980.4671	G	R	34	42
PSM	KNLDDGIDDE	1755	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4529	20.096	2	1132.4884	1132.4884	V	R	299	309
PSM	KNVPQEEEIMPPNSLPSNNS	1756	sp|Q06787-11|FMR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:35	ms_run[2]:scan=5443	22.931	3	2239.0427	2239.0427	E	R	324	344
PSM	KPDDGISPE	1757	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3946	17.515	2	956.44509	956.4451	F	R	290	299
PSM	KPDDGTTPE	1758	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3395	14.94	2	958.42436	958.4244	F	R	312	321
PSM	KPEDTTIPSTELA	1759	sp|P48556|PSMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5415	22.863	2	1400.7035	1400.7035	Q	K	324	337
PSM	KPGAFIPGAPVQPVVL	1760	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7629	28.833	2	1588.9341	1588.9341	F	R	221	237
PSM	KPLLGGDVSAPEGT	1761	sp|Q8IY22|CMIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5541	23.144	2	1339.6983	1339.6983	T	K	20	34
PSM	KPQDIDFATTATPTQM	1762	sp|Q96Q11-2|TRNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	16-UNIMOD:35	ms_run[2]:scan=5602	23.264	2	1779.8349	1779.8349	V	K	74	90
PSM	KSDVSPIIQPVPSI	1763	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7117	26.871	2	1478.8344	1478.8344	S	K	311	325
PSM	KSLEDQVEML	1764	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=5236	22.412	2	1206.5802	1206.5802	K	R	167	177
PSM	KTDPSILGGMIV	1765	sp|P48047|ATPO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7644	28.894	2	1229.669	1229.6690	A	R	176	188
PSM	KTDTESELDLIS	1766	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6577	25.424	2	1349.6562	1349.6562	F	R	760	772
PSM	KTPTPEPAEVET	1767	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4511	20.023	2	1297.6402	1297.6402	V	R	430	442
PSM	KVAEVLQVPPM	1768	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35	ms_run[2]:scan=6587	25.446	2	1225.674	1225.6740	N	R	100	111
PSM	KVLEMDPLPSS	1769	sp|Q96SI9-2|STRBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6457	25.141	2	1214.6217	1214.6217	Y	K	310	321
PSM	KVMVAPISGSVTTGT	1770	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:35	ms_run[2]:scan=5210	22.337	2	1462.7701	1462.7701	Q	K	2074	2089
PSM	KVSYFPTVPGVYIVST	1771	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7848	29.873	2	1755.9447	1755.9447	C	K	1878	1894
PSM	MKPLVVFVLGGPGAG	1772	sp|P30085-2|KCY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=7798	29.623	2	1456.8112	1456.8112	-	K	1	16
PSM	PAYHSSLMDPDT	1773	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:35	ms_run[2]:scan=4630	20.483	3	1348.5605	1348.5605	M	K	2	14
PSM	RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA	1774	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8689	32.996	4	3327.6789	3327.6789	N	R	214	245
PSM	RDPPMFIPTPVD	1775	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35	ms_run[2]:scan=6654	25.605	2	1399.6806	1399.6806	M	R	1603	1615
PSM	RGDGPICLVLAPT	1776	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=7423	27.965	2	1367.7231	1367.7231	E	R	241	254
PSM	RMPETVPQEEMPGPPLNSESGEEAPTG	1777	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5333	22.674	3	2897.2695	2897.2695	S	R	471	498
PSM	RQPPGPVPTPPLPSE	1778	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6061	24.238	2	1567.8358	1567.8358	L	R	472	487
PSM	RVPPPPPIA	1779	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4933	21.527	2	942.56509	942.5651	A	R	62	71
PSM	RVPPPPPIA	1780	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5306	22.609	2	942.56509	942.5651	A	R	62	71
PSM	SRIYHDGAL	1781	sp|Q7Z6K5|ARPIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5463	22.97	2	1072.5302	1072.5302	M	R	2	11
PSM	VSHSELR	1782	sp|P78330|SERB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=4240	18.829	2	868.44028	868.4403	M	K	2	9
PSM	KLSDGVAVL	1783	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6071	24.254877987733334	2	900.527119	900.528033	A	K	396	405
PSM	KDLYANTVLSGGTTMYPGIAD	1784	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:35	ms_run[1]:scan=8274	31.466367250933335	3	2203.052540	2202.051451	R	R	291	312
PSM	KDLFDPIIED	1785	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8286	31.51505640266667	2	1204.606663	1203.602320	F	R	86	96
PSM	KLFGSKDSDLATQN	1786	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5724	23.521299777066666	2	1522.737073	1522.762737	A	R	308	322
PSM	KIISNASCTTNCLAPLA	1787	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=6488	25.208184080000002	2	1833.899130	1832.912455	L	K	145	162
PSM	PEPAKSAPAP	1788	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=7926	30.2526440848	2	963.5012	963.5020	M	K	2	12
PSM	PEPAKSAPAP	1789	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=3855	17.0949612936	2	963.5012	963.5020	M	K	2	12
PSM	PEPAKSAPAP	1790	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=7710	29.211955386666666	2	963.5012	963.5020	M	K	2	12
PSM	KDENATLDGGDVLFTG	1791	sp|O94760|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7081	26.765438596000003	2	1650.773757	1650.773695	M	R	120	136
PSM	RVTPPPTSPYLNGDSPESANGDMDMENVT	1792	sp|O14936|CSKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	23-UNIMOD:35,25-UNIMOD:35	ms_run[1]:scan=5742	23.5596993184	3	3124.351218	3122.344475	L	R	458	487
PSM	KVPEGPIPPSTP	1793	sp|P16278|BGAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5111	22.043801291733335	2	1217.668633	1217.665589	E	K	359	371
PSM	RVDPSQPIDLTQLVNG	1794	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7635	28.861886731733332	2	1750.925002	1750.921363	G	R	109	125
PSM	KLGGSPTNGNSMAPSSPDSDP	1795	sp|Q8NFP7|NUD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:35	ms_run[1]:scan=4324	19.1918035832	2	2031.872338	2030.885114	L	-	144	165
PSM	KTTTYTQGVPPSQGDLEYQMSTTA	1796	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	20-UNIMOD:35	ms_run[1]:scan=5396	22.826283389866667	3	2619.200061	2619.201028	K	R	57	81
PSM	KEVFPTAALMPGAE	1797	sp|Q08623|HDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:35	ms_run[1]:scan=6533	25.312333416	2	1475.732829	1475.733017	L	K	83	97
PSM	KSSENGALPVVSVV	1798	sp|Q9Y3B2|EXOS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6905	26.27768113013333	2	1385.740077	1384.756195	M	R	43	57
PSM	MKQEGSAR	1799	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=3328	14.637154843466668	2	963.442984	963.444380	-	R	1	9
PSM	KNARGQVGLVP	1800	sp|O43639|NCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5620	23.3027262488	2	1138.645496	1137.661841	C	K	238	249
PSM	KTIALNGVEDV	1801	sp|Q3ZCQ8|TIM50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5982	24.045012749866665	2	1158.612981	1157.629203	L	R	284	295
PSM	KEAPEPGMEVV	1802	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:35	ms_run[1]:scan=4557	20.2048178008	2	1200.568387	1200.569640	S	K	440	451
PSM	KEEMDFPQLM	1803	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=5772	23.6161113904	2	1298.547935	1298.552276	V	K	171	181
PSM	RPAPVAQPPAAAPPSAVGSSAAAP	1804	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5154	22.174494007733333	3	2137.128224	2137.128002	P	R	27	51
PSM	KDLYANNVMSGGTTMYPGIAD	1805	sp|P68133|ACTS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7117	26.8712584928	3	2219.048533	2217.008205	R	R	293	314
PSM	KLVINGNPITIFQE	1806	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7835	29.806890834666667	2	1585.873553	1584.887543	G	R	66	80
PSM	KFNISNGGPAPEAITD	1807	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6064	24.2428635064	2	1630.782180	1629.799851	I	K	130	146
PSM	GGGDLNLK	1808	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4348	19.298	2	772.40792	772.4079	M	K	2	10
PSM	KAAAPGVEDEPLL	1809	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6381	24.931	2	1308.6925	1308.6925	T	R	61	74
PSM	KADGTATAPPP	1810	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3530	15.512	2	1024.5189	1024.5189	Q	R	706	717
PSM	KAPFLGSGGTIAPSSFSS	1811	sp|Q96PY6-5|NEK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6951	26.399	2	1709.8625	1709.8625	V	R	422	440
PSM	KDCVGPEVE	1812	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:4	ms_run[2]:scan=4222	18.743	2	1031.4594	1031.4594	L	K	69	78
PSM	KDDTDDEIA	1813	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3956	17.556	2	1020.4247	1020.4247	K	K	90	99
PSM	KDENATLDGGDVLFTG	1814	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7107	26.84	2	1650.7737	1650.7737	M	R	17	33
PSM	KDENATLDGGDVLFTG	1815	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6989	26.506	2	1650.7737	1650.7737	M	R	17	33
PSM	KDLDVITIPS	1816	sp|O00139-2|KIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6808	26.019	2	1099.6125	1099.6125	M	K	195	205
PSM	KDPEPEDEVPDV	1817	sp|P82675|RT05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5588	23.237	2	1367.6093	1367.6093	R	K	393	405
PSM	KEEPDLDGALLSGPDGD	1818	sp|Q96DT7-4|ZBT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6790	25.978	2	1726.7897	1726.7897	I	R	325	342
PSM	KEITEGDEVEVYS	1819	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5322	22.653	2	1496.6882	1496.6882	N	R	67	80
PSM	KEPFLVPAPPPPL	1820	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7695	29.133	2	1400.8068	1400.8068	E	K	8	21
PSM	KEPLPTLPLG	1821	sp|O43464-4|HTRA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7046	26.664	2	1063.6277	1063.6277	T	R	237	247
PSM	KILLTEPPMNPT	1822	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	9-UNIMOD:35	ms_run[2]:scan=5608	23.278	2	1368.7323	1368.7323	C	K	106	118
PSM	KITLPVDFVTAD	1823	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7684	29.082	2	1317.718	1317.7180	V	K	251	263
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	1824	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=8000	30.498	3	2773.4246	2773.4246	G	K	61	94
PSM	KLLSPVVPQISAPQSN	1825	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6841	26.097	2	1676.9461	1676.9461	N	K	521	537
PSM	KPEYIQMLMPPLIQ	1826	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7246	27.298	3	1731.894	1731.8940	N	K	516	530
PSM	KPGAPPQPAVSA	1827	sp|Q6ZSJ8-2|CA122_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4223	18.749	2	1118.6084	1118.6084	A	R	21	33
PSM	KPLLESGTLGT	1828	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5794	23.659	2	1114.6234	1114.6234	R	K	553	564
PSM	KQLLALDAVDPQGEE	1829	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6651	25.598	2	1624.8308	1624.8308	T	K	404	419
PSM	KSNVSDAVAQST	1830	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3516	15.453	2	1205.5888	1205.5888	L	R	194	206
PSM	KTFAPEEISAMVLT	1831	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:35	ms_run[2]:scan=7102	26.826	2	1551.7854	1551.7854	T	K	138	152
PSM	KTLCGTPNYIAPEVLS	1832	sp|P53350|PLK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:4	ms_run[2]:scan=6806	26.014	2	1761.8971	1761.8971	K	K	209	225
PSM	KTQMDGMSLLPIL	1833	sp|P15586-2|GNS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=7719	29.249	2	1477.752	1477.7520	N	R	368	381
PSM	KTTYDSSLSSYTVPLE	1834	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6960	26.434	2	1789.8622	1789.8622	V	K	267	283
PSM	KVAGMDVELTVEE	1835	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	5-UNIMOD:35	ms_run[2]:scan=5587	23.235	2	1434.6912	1434.6912	K	R	7	20
PSM	KVLTMPETC	1836	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	9-UNIMOD:4	ms_run[2]:scan=5153	22.173	2	1077.5199	1077.5199	L	R	859	868
PSM	KVQTDPPSVPICDLYPNGVFP	1837	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	12-UNIMOD:4	ms_run[2]:scan=7884	30.044	3	2342.1617	2342.1617	P	K	110	131
PSM	KVVYGDTDSVMC	1838	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=4570	20.266	2	1388.5952	1388.5952	A	R	750	762
PSM	RAGLAMPGPPLGPVLGQ	1839	sp|Q9Y3B7-3|RM11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:35	ms_run[2]:scan=7017	26.6	2	1645.8974	1645.8974	V	R	25	42
PSM	RDGETLEELM	1840	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	10-UNIMOD:35	ms_run[2]:scan=5527	23.108	2	1207.5391	1207.5391	L	K	211	221
PSM	RDVGPTPMYPPTYLEPGIG	1841	sp|Q86U70-3|LDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:35	ms_run[2]:scan=7104	26.833	3	2075.0034	2075.0034	D	R	4	23
PSM	REFQASPLLLPVPTQVPQPVG	1842	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7887	30.063	3	2272.258	2272.2580	P	R	181	202
PSM	REPPGGQLLAVPAVSVD	1843	sp|Q86Y37-2|CACL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7191	27.116	2	1703.9206	1703.9206	A	R	50	67
PSM	RPPGLPLPPPPPSSSAVF	1844	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7517	28.333	2	1811.9934	1811.9934	E	R	1433	1451
PSM	KDLFDPIIED	1845	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=8320	31.6342409952	2	1204.607884	1203.602320	F	R	86	96
PSM	KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	1846	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=8596	32.640828145600004	3	3753.631602	3752.640910	A	-	157	196
PSM	RGADTAPTLAPEALPSQGEVE	1847	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=6254	24.646633710933333	3	2110.0502	2108.0382	E	R	1018	1039
PSM	RPGAEGAPLLPPPLPPPSPPGSG	1848	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=7518	28.3370302928	3	2157.156629	2157.158239	E	R	26	49
PSM	KEVGEAICTDPLVS	1849	sp|P51649|SSDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4	ms_run[1]:scan=6165	24.464203851466667	2	1516.743678	1516.744310	A	K	265	279
PSM	KEEIFGPVMQIL	1850	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:35	ms_run[1]:scan=7677	29.0517167712	2	1418.749811	1418.747939	A	K	414	426
PSM	KLIPVPMVGF	1851	sp|Q7Z3B4|NUP54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6917	26.311541267466666	2	1099.629562	1099.646374	E	K	321	331
PSM	KSSENGALPVVSVV	1852	sp|Q9Y3B2|EXOS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6916	26.3088269048	2	1385.740077	1384.756195	M	R	43	57
PSM	KATCIGNNSAAAVSML	1853	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=5805	23.6842692688	2	1623.764411	1622.775627	W	K	160	176
PSM	KDGVGMVEYL	1854	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	6-UNIMOD:35	ms_run[1]:scan=6169	24.46867443893333	2	1125.536420	1125.537612	Q	R	144	154
PSM	KEITALAPSTM	1855	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:35	ms_run[1]:scan=6125	24.3674043016	2	1176.610297	1176.606025	Q	K	317	328
PSM	KDATPQPDILP	1856	sp|Q8NC26|ZN114_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6092	24.298431930666666	2	1195.658862	1193.629203	T	K	54	65
PSM	KAADTIGYPVMI	1857	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:35	ms_run[1]:scan=6862	26.153100733066665	2	1294.641464	1293.663875	L	R	575	587
PSM	KYLIPNATQPES	1858	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5584	23.2294744256	2	1360.686960	1359.703431	D	K	105	117
PSM	KPGGTVESGNGEDLT	1859	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=4356	19.3335651464	2	1461.675252	1459.679067	G	K	492	507
PSM	KLEEANGNTQMVE	1860	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	11-UNIMOD:35	ms_run[1]:scan=4020	17.8491752048	2	1478.656459	1477.671873	A	K	472	485
PSM	KAPEDAGPQPGSYEI	1861	sp|Q9Y5Z4|HEBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5781	23.632815500533333	2	1557.729340	1557.731102	W	R	26	41
PSM	KAMGIMNSFVNDIFE	1862	sp|P33778|H2B1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	3-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7771	29.4945036264	2	1747.779515	1746.795694	S	R	58	73
PSM	KMTNGFSGADLTEICQ	1863	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	15-UNIMOD:4	ms_run[1]:scan=6902	26.27112724266667	2	1771.775130	1770.791671	A	R	677	693
PSM	AHYPTRL	1864	sp|Q13415|ORC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5377	22.78	2	898.4661	898.4661	M	K	2	9
PSM	GLLSDPVR	1865	sp|O43292-2|GPAA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5613	23.287	2	855.48142	855.4814	M	R	2	10
PSM	KAAATPESQEPQA	1866	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3771	16.694	2	1326.6416	1326.6416	G	K	144	157
PSM	KAVETDVMNQETDPLCAEC	1867	sp|Q8IZ73-2|RUSD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=6310	24.762	3	2208.9337	2208.9337	E	R	423	442
PSM	KDDEVQVV	1868	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4604	20.384	2	930.46583	930.4658	R	R	51	59
PSM	KDDEVQVV	1869	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4749	20.915	2	930.46583	930.4658	R	R	51	59
PSM	KDSTLIMQLL	1870	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	7-UNIMOD:35	ms_run[2]:scan=7863	29.944	2	1176.6424	1176.6424	Y	R	214	224
PSM	KDYEEVGVDSVEGEGEEEGEEY	1871	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7996	30.484	3	2475.9925	2475.9925	E	-	314	336
PSM	KEADEEGGENGPADQGFQPQEEEE	1872	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5030	21.811	3	2618.0528	2618.0528	D	R	4988	5012
PSM	KEETQPPVAL	1873	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5385	22.801	2	1110.5921	1110.5921	K	K	92	102
PSM	KEGIPALDNFLD	1874	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7487	28.2	2	1330.6769	1330.6769	L	K	845	857
PSM	KEIFLTVPVGGGESL	1875	sp|Q53HL2|BOREA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7657	28.959	2	1544.845	1544.8450	S	R	225	240
PSM	KEVDGLDVS	1876	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4804	21.107	2	960.47639	960.4764	V	K	531	540
PSM	KEVEPEPTED	1877	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3825	16.943	2	1171.5245	1171.5245	T	K	42	52
PSM	KEVVIVSAT	1878	sp|P24752-2|THIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4825	21.18	2	944.55425	944.5542	L	R	40	49
PSM	KFPGTSSNTNCQNSSGPDADPSSLLQDC	1879	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	11-UNIMOD:4,28-UNIMOD:4	ms_run[2]:scan=6631	25.545	3	2983.256	2983.2560	V	R	681	709
PSM	KFVVDGDTPLIENG	1880	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6761	25.896	2	1502.7617	1502.7617	L	K	281	295
PSM	KGADSELSTVPSVT	1881	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5389	22.811	2	1389.6987	1389.6987	S	K	651	665
PSM	KIPVLVSCEDDLSDD	1882	sp|Q9Y4C2-2|TCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	8-UNIMOD:4	ms_run[2]:scan=6774	25.928	2	1703.7924	1703.7924	P	R	201	216
PSM	KLLDSITVPVA	1883	sp|O00203-3|AP3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7246	27.298	2	1154.6911	1154.6911	A	R	436	447
PSM	KLPTPTSSVPAQ	1884	sp|Q9BTA9-3|WAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4839	21.23	2	1224.6714	1224.6714	S	K	245	257
PSM	KLTDCVVM	1885	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	5-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=4667	20.623	2	980.46709	980.4671	G	R	34	42
PSM	KPEPMEEDLPEN	1886	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	5-UNIMOD:35	ms_run[2]:scan=4423	19.644	2	1442.6235	1442.6235	T	K	186	198
PSM	KPMCVESFSDYPPLG	1887	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=7272	27.394	2	1725.7742	1725.7742	G	R	408	423
PSM	KQMTDVLLTPATDAL	1888	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7523	28.361	2	1615.8491	1615.8491	V	K	105	120
PSM	KTLFVGLPPPAD	1889	sp|O15381-3|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7436	28.022	2	1253.702	1253.7020	D	R	545	557
PSM	KVLLPEYGGT	1890	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5929	23.929	2	1075.5914	1075.5914	D	K	70	80
PSM	KYLIPNATQPES	1891	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5472	22.99	2	1359.7034	1359.7034	D	K	105	117
PSM	MDDKELIEYF	1892	sp|Q14232-2|EI2BA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=7725	29.277	2	1317.5799	1317.5799	-	K	1	11
PSM	MVNVPKT	1893	sp|Q969Q0|RL36L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=4123	18.284	2	803.42112	803.4211	-	R	1	8
PSM	MVVSKMN	1894	sp|Q9NPA8|ENY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=3348	14.72	2	839.38811	839.3881	-	K	1	8
PSM	PPKVTSELL	1895	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6035	24.168	2	982.5699	982.5699	M	R	2	11
PSM	REGGDGEEQDVGDAG	1896	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3728	16.485	2	1489.5917	1489.5917	R	R	291	306
PSM	RLPPNTNDEVDEDPTGN	1897	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4598	20.366	2	1881.8341	1881.8341	V	K	1057	1074
PSM	RPGAEGAPLLPPPLPPPSPPGSG	1898	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7230	27.239	3	2157.1582	2157.1582	E	R	26	49
PSM	TMDKSELVQ	1899	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35	ms_run[2]:scan=4025	17.873	2	1065.5012	1065.5012	M	K	2	11
PSM	PYQYPALTPEQK	1900	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=8145	31.010499904000003	2	1434.7202	1433.7182	M	K	2	14
PSM	KIISNASCTTNCLAPLA	1901	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=6326	24.809115930933334	2	1833.899130	1832.912455	L	K	145	162
PSM	AHRPGPL	1902	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=4540	20.142289113866664	2	788.4277	788.4288	A	K	3	10
PSM	KGPVFAPPYEPLPENV	1903	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7326	27.593805741866667	2	1752.908318	1752.908673	H	K	223	239
PSM	RMNGVMFPGNSPSYTE	1904	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=5750	23.578251299466668	2	1818.752800	1817.771270	N	R	149	165
PSM	KIVSGSPISTPSPSPLP	1905	sp|Q9ULM3|YETS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6465	25.159678293866666	2	1662.921398	1662.919238	C	R	460	477
PSM	PEPTKSAPAP	1906	sp|P58876|H2B1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=3678	16.239854622666666	2	993.5117	993.5126	M	K	2	12
PSM	KEGEEAGPGDPLLEAVP	1907	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=8140	30.994276647733333	2	1707.840550	1706.836296	A	K	352	369
PSM	RDPESETDNDSQEIF	1908	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6080	24.271967504533333	2	1781.723467	1780.738767	Y	K	2485	2500
PSM	VSHSELR	1909	sp|P78330|SERB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=4224	18.754187864000002	2	868.4392	868.4398	M	K	2	9
PSM	RTAVPPGLSSLPLTSVGNTGM	1910	sp|Q6ZTU2|E400N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	21-UNIMOD:35	ms_run[1]:scan=7368	27.748540033866668	3	2070.0790	2070.0774	S	K	313	334
PSM	RVGNGEETPMIGD	1911	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	10-UNIMOD:35	ms_run[1]:scan=4758	20.943956429866667	2	1390.602054	1389.619444	K	K	39	52
PSM	KATCIGNNSAAAVSML	1912	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=5791	23.653044965866666	2	1623.764411	1622.775627	W	K	160	176
PSM	KDSTLIMQLL	1913	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:35	ms_run[1]:scan=7840	29.833665699466668	2	1176.643164	1176.642411	Y	R	214	224
PSM	KEEVEVAQVQVPTPA	1914	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6005	24.103012328	2	1622.851334	1622.851552	E	R	14	29
PSM	KMDATANDVPSPYEV	1915	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6124	24.365781457866667	2	1636.727741	1635.745038	A	R	433	448
PSM	KTIVTDVFQGSM	1916	sp|Q53GS9|SNUT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:35	ms_run[1]:scan=6575	25.418116101333332	2	1341.665820	1340.664603	K	R	342	354
PSM	KPEPPAMPQPVPTA	1917	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:35	ms_run[1]:scan=4795	21.076684741333334	2	1474.747751	1474.749001	G	-	230	244
PSM	KPEDWDEDMDGEWEAPQIANP	1918	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:35	ms_run[1]:scan=7145	26.96824769866667	3	2487.016329	2487.017250	E	R	338	359