MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000422-1 -- main MTD ms_run[1]-location D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F21.maxq.txt MTD ms_run[2]-location D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F21.maxqFin.txt MTD software[1] [MS, MS:1001583, MaxQuant, 1.6.2.10] MTD software[1]-setting Taxon=userFasta.sprot_human_20201019 MTD software[1]-setting enzymes=TrypN MTD software[1]-setting enzymeMode=0 MTD software[1]-setting fixedModifications=Carbamidomethyl (C) MTD software[1]-setting variableModifications=Acetyl (Protein N-term),Oxidation (M) MTD software[1]-setting maxMissedCleavages=1 MTD software[1]-setting lcmsRunType=Standard MTD software[1]-setting firstSearchTol=40 MTD software[1]-setting mainSearchTol=4.5 MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20201019 MTD software[2]-setting CLE=[X]|[RK] MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Acetyl (Protein N-term) MTD software[2]-setting TOL(-)=20 MTD software[2]-setting TOL(+)=20 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=50 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=1 MTD software[3] [MS, MS:1002251, Comet, 2019.01 rev. 5] MTD software[3]-setting Taxon=userFasta.sprot_human_20201019 MTD software[3]-setting search_enzyme_number=11 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Acetyl (Protein N-term),Oxidation (M) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=1 MTD software[3]-setting peptide_mass_tolerance=20 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=1.0005 MTD software[3]-setting fragment_bin_offset=0.4 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:1, Acetyl,] MTD variable_mod[1]-site N-term MTD variable_mod[1]-position Protein N-term MTD variable_mod[2] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[2]-site M MTD variable_mod[2]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P49006|MRP_HUMAN MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 67.0 null 134-UNIMOD:4 0.45 67.0 3 3 3 PRT sp|O75153|CLU_HUMAN Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 61.0 null 0.02 61.0 1 1 1 PRT sp|Q12962|TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 60.0 null 0.12 60.0 1 1 1 PRT sp|Q9UKN8|TF3C4_HUMAN General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 60.0 null 146-UNIMOD:35 0.06 60.0 3 3 3 PRT sp|P67809|YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 59.0 null 218-UNIMOD:35 0.30 59.0 6 4 3 PRT sp|Q7L2E3-2|DHX30_HUMAN Isoform 2 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 57.0 null 55-UNIMOD:35,831-UNIMOD:35 0.04 57.0 5 3 2 PRT sp|Q5T4S7-3|UBR4_HUMAN Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56.0 null 0.02 56.0 4 4 3 PRT sp|P08621-2|RU17_HUMAN Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56.0 null 307-UNIMOD:35 0.11 56.0 4 2 1 PRT sp|P49321-4|NASP_HUMAN Isoform 4 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 54.0 null 629-UNIMOD:35,724-UNIMOD:4,429-UNIMOD:35,190-UNIMOD:4 0.20 54.0 12 9 7 PRT sp|O60784-3|TOM1_HUMAN Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 54.0 null 0.09 54.0 4 2 0 PRT sp|Q86W50|MET16_HUMAN RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 448-UNIMOD:4 0.06 53.0 1 1 1 PRT sp|Q7Z417|NUFP2_HUMAN Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 53.0 null 0.04 53.0 1 1 1 PRT sp|Q16763|UBE2S_HUMAN Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51.0 null 195-UNIMOD:35 0.20 51.0 2 2 2 PRT sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 51.0 null 97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4 0.05 51.0 1 1 1 PRT sp|P16989-2|YBOX3_HUMAN Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.14 50.0 2 2 1 PRT sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 0.19 50.0 15 5 2 PRT sp|Q71U36-2|TBA1A_HUMAN Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.06 50.0 1 1 0 PRT sp|Q02952-3|AKA12_HUMAN Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.03 50.0 3 3 2 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 50.0 null 0.22 50.0 5 3 1 PRT sp|Q9BRJ6|CG050_HUMAN Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 0.20 49.0 3 2 1 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 0.14 49.0 3 3 3 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 49.0 null 561-UNIMOD:35,564-UNIMOD:35,568-UNIMOD:35,572-UNIMOD:35,558-UNIMOD:35,495-UNIMOD:35,506-UNIMOD:35,513-UNIMOD:35,190-UNIMOD:35 0.20 49.0 48 6 1 PRT sp|Q4V328-4|GRAP1_HUMAN Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 0.03 49.0 2 1 0 PRT sp|P14866-2|HNRPL_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 339-UNIMOD:4,327-UNIMOD:35 0.05 49.0 2 1 0 PRT sp|Q92575|UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 144-UNIMOD:4 0.11 49.0 2 2 2 PRT sp|Q5UIP0-2|RIF1_HUMAN Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 2165-UNIMOD:35 0.02 49.0 3 3 3 PRT sp|O43251-6|RFOX2_HUMAN Isoform 6 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 0.05 49.0 1 1 1 PRT sp|Q13409|DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 49.0 null 0.03 49.0 2 1 0 PRT sp|Q9GZT9-2|EGLN1_HUMAN Isoform 2 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.05 48.0 1 1 1 PRT sp|P11413|G6PD_HUMAN Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 294-UNIMOD:4 0.05 48.0 1 1 1 PRT sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.01 48.0 2 2 2 PRT sp|A0A0U1RRL7|MMPOS_HUMAN Protein MMP24OS OS=Homo sapiens OX=9606 GN=MMP24OS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.38 48.0 1 1 1 PRT sp|Q99747|SNAG_HUMAN Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48.0 null 312-UNIMOD:4 0.07 48.0 1 1 1 PRT sp|Q15149-7|PLEC_HUMAN Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 0.01 47.0 4 4 4 PRT sp|Q9BT09|CNPY3_HUMAN Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 0.07 47.0 1 1 1 PRT sp|Q13620-1|CUL4B_HUMAN Isoform 2 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 116-UNIMOD:35 0.03 47.0 1 1 1 PRT sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 527-UNIMOD:35,299-UNIMOD:35,1474-UNIMOD:35,195-UNIMOD:35 0.06 47.0 10 6 3 PRT sp|Q96FW1|OTUB1_HUMAN Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 23-UNIMOD:4,31-UNIMOD:35,204-UNIMOD:4,211-UNIMOD:35,212-UNIMOD:4 0.15 47.0 3 2 1 PRT sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 47.0 null 192-UNIMOD:35,260-UNIMOD:35,272-UNIMOD:35,186-UNIMOD:35,151-UNIMOD:35 0.17 47.0 13 6 2 PRT sp|Q969E4|TCAL3_HUMAN Transcription elongation factor A protein-like 3 OS=Homo sapiens OX=9606 GN=TCEAL3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 0.11 47.0 1 1 1 PRT sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 209-UNIMOD:4,678-UNIMOD:35,691-UNIMOD:4,219-UNIMOD:35 0.12 47.0 9 5 2 PRT sp|P29966|MARCS_HUMAN Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 0.26 46.0 6 5 4 PRT sp|P52272-2|HNRPM_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 287-UNIMOD:35,295-UNIMOD:35,297-UNIMOD:35 0.03 46.0 2 1 0 PRT sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 947-UNIMOD:35 0.04 46.0 6 3 1 PRT sp|Q5T0F9-3|C2D1B_HUMAN Isoform 3 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 25-UNIMOD:35 0.07 46.0 2 2 2 PRT sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 46.0 null 267-UNIMOD:35,155-UNIMOD:35 0.20 46.0 11 7 6 PRT sp|O15550|KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 0.02 46.0 1 1 1 PRT sp|Q9H0B6-2|KLC2_HUMAN Isoform 2 of Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 0.07 46.0 2 2 2 PRT sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 114-UNIMOD:4 0.14 46.0 2 2 2 PRT sp|Q8IZL8|PELP1_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 0.02 46.0 1 1 1 PRT sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 46.0 null 339-UNIMOD:35,342-UNIMOD:35,272-UNIMOD:35,113-UNIMOD:35 0.16 46.0 13 5 2 PRT sp|P78344-2|IF4G2_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 458-UNIMOD:35,247-UNIMOD:35,253-UNIMOD:4,255-UNIMOD:4,258-UNIMOD:35 0.07 46.0 5 4 3 PRT sp|P40222|TXLNA_HUMAN Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 523-UNIMOD:4 0.05 46.0 1 1 1 PRT sp|Q15424-2|SAFB1_HUMAN Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 293-UNIMOD:4,156-UNIMOD:4 0.06 45.0 3 3 3 PRT sp|O95429-2|BAG4_HUMAN Isoform 2 of BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 273-UNIMOD:35 0.08 45.0 2 2 2 PRT sp|O75822-3|EIF3J_HUMAN Isoform 3 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 99-UNIMOD:35 0.10 45.0 2 1 0 PRT sp|O75410-3|TACC1_HUMAN Isoform 3 of Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.04 45.0 1 1 1 PRT sp|P05023-3|AT1A1_HUMAN Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 343-UNIMOD:4,703-UNIMOD:35,642-UNIMOD:35 0.08 45.0 6 5 3 PRT sp|P51858-2|HDGF_HUMAN Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 101-UNIMOD:4 0.09 45.0 1 1 1 PRT sp|Q29RF7|PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.03 45.0 2 2 2 PRT sp|Q9P2E9|RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 660-UNIMOD:35,179-UNIMOD:35 0.02 45.0 2 2 2 PRT sp|O14976-2|GAK_HUMAN Isoform 2 of Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.03 45.0 1 1 1 PRT sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.04 45.0 1 1 1 PRT sp|O14497-2|ARI1A_HUMAN Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.01 44.0 1 1 0 PRT sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 263-UNIMOD:35,266-UNIMOD:4 0.08 44.0 3 2 1 PRT sp|Q86UP2-2|KTN1_HUMAN Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.03 44.0 2 2 2 PRT sp|Q66K74-2|MAP1S_HUMAN Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 727-UNIMOD:35 0.03 44.0 2 2 2 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 165-UNIMOD:35,169-UNIMOD:35,357-UNIMOD:4,94-UNIMOD:35,97-UNIMOD:35 0.18 44.0 23 5 2 PRT sp|Q86WB0-3|NIPA_HUMAN Isoform 3 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.06 44.0 1 1 1 PRT sp|Q14204|DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 2012-UNIMOD:35,2018-UNIMOD:35,505-UNIMOD:35,336-UNIMOD:35,2423-UNIMOD:35,2594-UNIMOD:4,3126-UNIMOD:35,1999-UNIMOD:4,3693-UNIMOD:4 0.04 44.0 16 12 8 PRT sp|Q13618-3|CUL3_HUMAN Isoform 3 of Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.03 44.0 1 1 1 PRT sp|Q9NUA8|ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.02 44.0 1 1 1 PRT sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.04 44.0 4 4 4 PRT sp|Q12873-2|CHD3_HUMAN Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.01 44.0 1 1 1 PRT sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 69-UNIMOD:4 0.04 44.0 1 1 1 PRT sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 111-UNIMOD:35 0.07 44.0 4 3 2 PRT sp|P08195|4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 102-UNIMOD:35,110-UNIMOD:35 0.03 44.0 1 1 1 PRT sp|Q8NE71-2|ABCF1_HUMAN Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.03 44.0 2 1 0 PRT sp|O75691|UTP20_HUMAN Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.01 44.0 1 1 1 PRT sp|P35658-2|NU214_HUMAN Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 1058-UNIMOD:35 0.04 44.0 5 5 5 PRT sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 44.0 null 55-UNIMOD:35,57-UNIMOD:35 0.11 44.0 6 3 2 PRT sp|P39880-4|CUX1_HUMAN Isoform 5 of Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.02 44.0 1 1 1 PRT sp|Q9H000-2|MKRN2_HUMAN Isoform 2 of Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 83-UNIMOD:35,90-UNIMOD:4,99-UNIMOD:35 0.06 44.0 1 1 1 PRT sp|P11216|PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 680-UNIMOD:35 0.03 44.0 1 1 1 PRT sp|O15027-3|SC16A_HUMAN Isoform 3 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 107-UNIMOD:4,765-UNIMOD:35 0.05 44.0 6 6 5 PRT sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 80-UNIMOD:35,247-UNIMOD:4 0.09 44.0 5 4 3 PRT sp|O14519-2|CDKA1_HUMAN Isoform 2 of Cyclin-dependent kinase 2-associated protein 1 OS=Homo sapiens OX=9606 GN=CDK2AP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.31 44.0 1 1 1 PRT sp|O43598|DNPH1_HUMAN 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.11 44.0 2 1 0 PRT sp|Q86T24|KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 44.0 null 0.06 44.0 2 2 2 PRT sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 44.0 null 0.04 44.0 1 1 1 PRT sp|O75367-2|H2AY_HUMAN Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.09 43.0 2 2 2 PRT sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 305-UNIMOD:35,325-UNIMOD:35,190-UNIMOD:35 0.18 43.0 23 5 2 PRT sp|Q6UN15-5|FIP1_HUMAN Isoform 5 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 201-UNIMOD:4,203-UNIMOD:35 0.07 43.0 2 2 2 PRT sp|Q13111|CAF1A_HUMAN Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.02 43.0 1 1 1 PRT sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 83-UNIMOD:35 0.25 43.0 4 4 4 PRT sp|Q5SRE5-2|NU188_HUMAN Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 1041-UNIMOD:4 0.02 43.0 3 2 1 PRT sp|P38117|ETFB_HUMAN Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 66-UNIMOD:4,71-UNIMOD:4 0.16 43.0 3 3 3 PRT sp|O00232-2|PSD12_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.05 43.0 1 1 1 PRT sp|Q9Y6M1-5|IF2B2_HUMAN Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.06 43.0 2 2 2 PRT sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 1204-UNIMOD:4 0.02 43.0 2 2 2 PRT sp|Q8NDI1-3|EHBP1_HUMAN Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.02 43.0 1 1 1 PRT sp|Q9H1K1-2|ISCU_HUMAN Isoform 2 of Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens OX=9606 GN=ISCU null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 44-UNIMOD:4,48-UNIMOD:35 0.13 43.0 1 1 1 PRT sp|Q92734-2|TFG_HUMAN Isoform 2 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 182-UNIMOD:35,367-UNIMOD:35 0.12 43.0 4 2 0 PRT sp|Q9BQG0|MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 10-UNIMOD:35 0.05 43.0 6 4 2 PRT sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 208-UNIMOD:35,291-UNIMOD:35 0.08 43.0 3 3 3 PRT sp|P46100-6|ATRX_HUMAN Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.01 43.0 1 1 1 PRT sp|O15381-3|NVL_HUMAN Isoform 3 of Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.05 43.0 5 2 1 PRT sp|Q2TAL8|QRIC1_HUMAN Glutamine-rich protein 1 OS=Homo sapiens OX=9606 GN=QRICH1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 687-UNIMOD:35 0.02 43.0 2 1 0 PRT sp|P23588-2|IF4B_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.06 43.0 2 2 2 PRT sp|Q9BVL4|SELO_HUMAN Protein adenylyltransferase SelO, mitochondrial OS=Homo sapiens OX=9606 GN=SELENOO PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 43.0 null 0.03 43.0 2 1 0 PRT sp|Q9BTE3-3|MCMBP_HUMAN Isoform 3 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 114-UNIMOD:4,112-UNIMOD:35,405-UNIMOD:35 0.07 43.0 3 2 0 PRT sp|Q12948|FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.04 43.0 1 1 1 PRT sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 43.0 null 241-UNIMOD:4,417-UNIMOD:35 0.13 43.0 4 3 2 PRT sp|P98194-2|AT2C1_HUMAN Isoform 2 of Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 661-UNIMOD:35,669-UNIMOD:4,162-UNIMOD:4 0.04 42.0 2 2 2 PRT sp|Q9H3Q1-2|BORG4_HUMAN Isoform 2 of Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.07 42.0 1 1 1 PRT sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 20-UNIMOD:35,46-UNIMOD:35,48-UNIMOD:35 0.08 42.0 2 2 2 PRT sp|Q92994-9|TF3B_HUMAN Isoform 9 of Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 51-UNIMOD:4 0.04 42.0 1 1 1 PRT sp|Q9ULJ3-2|ZBT21_HUMAN Isoform 2 of Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.02 42.0 1 1 1 PRT sp|Q99459|CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 456-UNIMOD:35 0.06 42.0 4 3 2 PRT sp|Q12888|TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 392-UNIMOD:35 0.03 42.0 4 3 2 PRT sp|Q9H910-2|JUPI2_HUMAN Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.21 42.0 2 2 2 PRT sp|Q13263|TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 42.0 null 579-UNIMOD:35,550-UNIMOD:35,135-UNIMOD:35 0.11 42.0 18 5 2 PRT sp|Q5VSL9-4|STRP1_HUMAN Isoform 4 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.10 42.0 1 1 1 PRT sp|Q8N8S7-3|ENAH_HUMAN Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.04 42.0 1 1 1 PRT sp|Q96DF8|ESS2_HUMAN Splicing factor ESS-2 homolog OS=Homo sapiens OX=9606 GN=ESS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.04 42.0 1 1 1 PRT sp|Q14247-3|SRC8_HUMAN Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 411-UNIMOD:35 0.10 42.0 3 3 3 PRT sp|P84157-2|MXRA7_HUMAN Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.12 42.0 3 1 0 PRT sp|P49593-2|PPM1F_HUMAN Isoform 2 of Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.11 42.0 2 2 2 PRT sp|P18615|NELFE_HUMAN Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.06 42.0 2 1 0 PRT sp|Q9NQX3|GEPH_HUMAN Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 404-UNIMOD:35,409-UNIMOD:35 0.03 42.0 2 1 0 PRT sp|O14562|UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 0.11 42.0 3 1 0 PRT sp|P78345|RPP38_HUMAN Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.07 42.0 1 1 1 PRT sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 585-UNIMOD:35 0.06 42.0 3 2 1 PRT sp|Q96QC0|PP1RA_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.04 42.0 2 2 2 PRT sp|P54098|DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 42.0 null 774-UNIMOD:35,647-UNIMOD:4 0.04 42.0 3 3 3 PRT sp|Q7KZ85|SPT6H_HUMAN Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42.0 null 0.02 42.0 1 1 1 PRT sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 56-UNIMOD:35 0.03 41.0 2 2 2 PRT sp|P09211|GSTP1_HUMAN Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 0.17 41.0 4 2 1 PRT sp|P52594-2|AGFG1_HUMAN Isoform 2 of Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.04 41.0 1 1 1 PRT sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens OX=9606 GN=RTCA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 356-UNIMOD:4,361-UNIMOD:35 0.05 41.0 2 1 0 PRT sp|Q8TCG1-2|CIP2A_HUMAN Isoform 2 of Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 220-UNIMOD:4 0.02 41.0 1 1 1 PRT sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 639-UNIMOD:4,643-UNIMOD:35,645-UNIMOD:35 0.03 41.0 2 2 2 PRT sp|Q9P2J5-2|SYLC_HUMAN Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.02 41.0 1 1 1 PRT sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 753-UNIMOD:4 0.02 41.0 2 2 2 PRT sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.04 41.0 1 1 1 PRT sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 338-UNIMOD:35,339-UNIMOD:35 0.05 41.0 3 3 3 PRT sp|P19623|SPEE_HUMAN Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 274-UNIMOD:35 0.13 41.0 4 2 0 PRT sp|A8CG34|P121C_HUMAN Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.01 41.0 1 1 1 PRT sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 385-UNIMOD:4,393-UNIMOD:35 0.04 41.0 2 2 2 PRT sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 117-UNIMOD:35,692-UNIMOD:35 0.08 41.0 6 4 3 PRT sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 41-UNIMOD:4,449-UNIMOD:35 0.05 41.0 3 3 3 PRT sp|P41214|EIF2D_HUMAN Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.13 41.0 5 4 3 PRT sp|Q9BX40-3|LS14B_HUMAN Isoform 3 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.10 41.0 1 1 1 PRT sp|Q9Y383-3|LC7L2_HUMAN Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.04 41.0 1 1 0 PRT sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 446-UNIMOD:35,447-UNIMOD:4 0.05 41.0 3 2 1 PRT sp|P55786-2|PSA_HUMAN Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.03 41.0 2 2 2 PRT sp|P11586|C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 41.0 null 221-UNIMOD:35 0.10 41.0 9 7 5 PRT sp|O00461|GOLI4_HUMAN Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.04 41.0 1 1 1 PRT sp|P31948-3|STIP1_HUMAN Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 466-UNIMOD:35,475-UNIMOD:35,480-UNIMOD:35,393-UNIMOD:4,396-UNIMOD:4,190-UNIMOD:35,437-UNIMOD:4 0.11 41.0 5 4 3 PRT sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.08 41.0 1 1 1 PRT sp|O15173|PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 180-UNIMOD:35 0.09 41.0 1 1 1 PRT sp|Q6ZRS2-3|SRCAP_HUMAN Isoform 3 of Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.01 41.0 1 1 1 PRT sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 130-UNIMOD:35 0.15 41.0 1 1 1 PRT sp|O95202|LETM1_HUMAN Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 515-UNIMOD:35,552-UNIMOD:4 0.06 41.0 4 3 2 PRT sp|Q9NXH9-2|TRM1_HUMAN Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 610-UNIMOD:4 0.05 41.0 1 1 1 PRT sp|Q96F63|CCD97_HUMAN Coiled-coil domain-containing protein 97 OS=Homo sapiens OX=9606 GN=CCDC97 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.06 41.0 1 1 1 PRT sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 41.0 null 3014-UNIMOD:4,4106-UNIMOD:4,4108-UNIMOD:35 0.01 41.0 3 3 1 PRT sp|O14654|IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 41.0 null 627-UNIMOD:35,703-UNIMOD:35 0.06 41.0 7 4 2 PRT sp|Q9Y2U8|MAN1_HUMAN Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 0.04 40.0 2 2 2 PRT sp|Q96JN0-2|LCOR_HUMAN Isoform 2 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.05 40.0 1 1 1 PRT sp|Q7Z2W4-3|ZCCHV_HUMAN Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 2 2 2 PRT sp|Q8NI60-3|COQ8A_HUMAN Isoform 3 of Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.03 40.0 1 1 1 PRT sp|P35573-2|GDE_HUMAN Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 1397-UNIMOD:35 0.02 40.0 2 2 2 PRT sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 488-UNIMOD:35,279-UNIMOD:35,583-UNIMOD:35 0.17 40.0 9 7 5 PRT sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 40.0 null 93-UNIMOD:4 0.10 40.0 3 3 3 PRT sp|P46736-5|BRCC3_HUMAN Isoform 5 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 35-UNIMOD:35,38-UNIMOD:4 0.07 40.0 1 1 1 PRT sp|Q9P0M6|H2AW_HUMAN Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=MACROH2A2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.06 40.0 1 1 1 PRT sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 573-UNIMOD:35 0.07 40.0 3 3 3 PRT sp|P61916-2|NPC2_HUMAN Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 42-UNIMOD:4,47-UNIMOD:4 0.14 40.0 1 1 1 PRT sp|Q9ULC4-2|MCTS1_HUMAN Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 100-UNIMOD:35,101-UNIMOD:4 0.12 40.0 1 1 1 PRT sp|O75717|WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 364-UNIMOD:35,365-UNIMOD:35,124-UNIMOD:35,1008-UNIMOD:4 0.05 40.0 5 3 2 PRT sp|Q14674-2|ESPL1_HUMAN Isoform 2 of Separin OS=Homo sapiens OX=9606 GN=ESPL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.01 40.0 1 1 1 PRT sp|P30086|PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 133-UNIMOD:4 0.25 40.0 10 3 2 PRT sp|Q6P1N0-2|C2D1A_HUMAN Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 2 2 2 PRT sp|P40855-5|PEX19_HUMAN Isoform 5 of Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 191-UNIMOD:4 0.07 40.0 1 1 1 PRT sp|P00367-2|DHE3_HUMAN Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 1 1 0 PRT sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.01 40.0 1 1 1 PRT sp|Q96T23-3|RSF1_HUMAN Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 398-UNIMOD:4 0.03 40.0 2 2 2 PRT sp|P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.03 40.0 2 1 0 PRT sp|Q99567|NUP88_HUMAN Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 2 2 2 PRT sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 1827-UNIMOD:35 0.02 40.0 6 4 3 PRT sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 0.02 40.0 3 1 0 PRT sp|O75369-5|FLNB_HUMAN Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 450-UNIMOD:4,455-UNIMOD:4,549-UNIMOD:35,491-UNIMOD:35,991-UNIMOD:4,1129-UNIMOD:35 0.04 40.0 7 6 5 PRT sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 1910-UNIMOD:35,318-UNIMOD:35,323-UNIMOD:35,326-UNIMOD:35 0.02 40.0 5 3 2 PRT sp|Q5T8P6-3|RBM26_HUMAN Isoform 3 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.05 40.0 3 3 2 PRT sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 305-UNIMOD:4 0.09 40.0 2 2 2 PRT sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.09 40.0 2 2 2 PRT sp|P21333-2|FLNA_HUMAN Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 1018-UNIMOD:4 0.03 40.0 5 5 5 PRT sp|O75191-2|XYLB_HUMAN Isoform 2 of Xylulose kinase OS=Homo sapiens OX=9606 GN=XYLB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 151-UNIMOD:35 0.04 40.0 1 1 1 PRT sp|O95674|CDS2_HUMAN Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 1 1 1 PRT sp|Q96S44|PRPK_HUMAN EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.09 40.0 1 1 1 PRT sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 70-UNIMOD:35 0.03 40.0 2 1 0 PRT sp|Q13409-6|DC1I2_HUMAN Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 67-UNIMOD:35,80-UNIMOD:35,139-UNIMOD:35 0.09 40.0 3 3 3 PRT sp|Q9Y5S9-2|RBM8A_HUMAN Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.10 40.0 2 1 0 PRT sp|Q9Y312|AAR2_HUMAN Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 111-UNIMOD:35 0.05 40.0 1 1 1 PRT sp|O60826|CCD22_HUMAN Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.04 40.0 1 1 1 PRT sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 40.0 null 119-UNIMOD:4,91-UNIMOD:35 0.11 40.0 6 3 1 PRT sp|Q13428-2|TCOF_HUMAN Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.02 40.0 1 1 1 PRT sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 20-UNIMOD:35 0.09 40.0 2 1 0 PRT sp|Q9NZL4-2|HPBP1_HUMAN Isoform 2 of Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 104-UNIMOD:35,245-UNIMOD:4,254-UNIMOD:35 0.16 40.0 3 2 1 PRT sp|Q9NQR4|NIT2_HUMAN Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 40.0 null 146-UNIMOD:4,44-UNIMOD:4,76-UNIMOD:4 0.19 40.0 3 3 3 PRT sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 40.0 null 369-UNIMOD:4,383-UNIMOD:35,41-UNIMOD:4,693-UNIMOD:4,697-UNIMOD:35 0.06 40.0 7 4 2 PRT sp|P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40.0 null 285-UNIMOD:35,291-UNIMOD:4,294-UNIMOD:4 0.06 40.0 1 1 0 PRT sp|O15534|PER1_HUMAN Period circadian protein homolog 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40.0 null 0.02 40.0 1 1 1 PRT sp|Q12929-2|EPS8_HUMAN Isoform 2 of Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 537-UNIMOD:35 0.03 39.0 1 1 1 PRT sp|Q9NQ29-2|LUC7L_HUMAN Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.05 39.0 1 1 1 PRT sp|Q14789-3|GOGB1_HUMAN Isoform 3 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.01 39.0 3 2 1 PRT sp|Q93074-3|MED12_HUMAN Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 1407-UNIMOD:35,1301-UNIMOD:4 0.02 39.0 2 2 2 PRT sp|P50151|GBG10_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 OS=Homo sapiens OX=9606 GN=GNG10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.24 39.0 1 1 1 PRT sp|Q8WU79-3|SMAP2_HUMAN Isoform 3 of Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.05 39.0 1 1 1 PRT sp|Q16555-2|DPYL2_HUMAN Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.03 39.0 1 1 0 PRT sp|Q9UNH7-2|SNX6_HUMAN Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 231-UNIMOD:4,232-UNIMOD:4 0.06 39.0 1 1 1 PRT sp|O43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.04 39.0 2 2 2 PRT sp|P43246-2|MSH2_HUMAN Isoform 2 of DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 133-UNIMOD:4,144-UNIMOD:35 0.02 39.0 1 1 1 PRT sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.15 39.0 4 3 2 PRT sp|Q53HL2|BOREA_HUMAN Borealin OS=Homo sapiens OX=9606 GN=CDCA8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.06 39.0 1 1 1 PRT sp|Q86Y82|STX12_HUMAN Syntaxin-12 OS=Homo sapiens OX=9606 GN=STX12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.06 39.0 3 1 0 PRT sp|Q92783-2|STAM1_HUMAN Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.05 39.0 1 1 0 PRT sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 132-UNIMOD:35,135-UNIMOD:4,1159-UNIMOD:35,2232-UNIMOD:35,2202-UNIMOD:4,779-UNIMOD:4,785-UNIMOD:35 0.05 39.0 13 8 6 PRT sp|Q8WUM4|PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 40-UNIMOD:4 0.05 39.0 4 3 2 PRT sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 632-UNIMOD:4,646-UNIMOD:35,650-UNIMOD:35,934-UNIMOD:4 0.04 39.0 3 3 3 PRT sp|P60900-2|PSA6_HUMAN Isoform 2 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 59-UNIMOD:4,61-UNIMOD:35,64-UNIMOD:35 0.08 39.0 2 1 0 PRT sp|Q15165-3|PON2_HUMAN Isoform 3 of Serum paraoxonase/arylesterase 2 OS=Homo sapiens OX=9606 GN=PON2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.05 39.0 1 1 1 PRT sp|Q96CS3|FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 29-UNIMOD:35,32-UNIMOD:4 0.04 39.0 1 1 1 PRT sp|P53618|COPB_HUMAN Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 518-UNIMOD:35,137-UNIMOD:35 0.05 39.0 5 3 1 PRT sp|P41252|SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 2 2 2 PRT sp|Q15428|SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.03 39.0 1 1 1 PRT sp|O00567|NOP56_HUMAN Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 496-UNIMOD:35 0.08 39.0 4 3 2 PRT sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.07 39.0 1 1 1 PRT sp|Q92621|NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 1028-UNIMOD:4,1607-UNIMOD:35 0.03 39.0 5 4 3 PRT sp|Q5QJE6|TDIF2_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 39.0 null 0.02 39.0 2 1 0 PRT sp|Q92538-3|GBF1_HUMAN Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 1722-UNIMOD:35,1724-UNIMOD:35,1608-UNIMOD:35 0.02 39.0 3 2 1 PRT sp|Q5JSH3-4|WDR44_HUMAN Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 796-UNIMOD:35,310-UNIMOD:35 0.04 39.0 3 2 1 PRT sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.07 39.0 2 2 2 PRT sp|Q86T82-2|UBP37_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens OX=9606 GN=USP37 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 1 1 1 PRT sp|Q5W0B1|OBI1_HUMAN ORC ubiquitin ligase 1 OS=Homo sapiens OX=9606 GN=OBI1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 1 1 1 PRT sp|Q99963-2|SH3G3_HUMAN Isoform 2 of Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 27-UNIMOD:4,28-UNIMOD:35 0.06 39.0 1 1 1 PRT sp|P04181|OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 150-UNIMOD:4,139-UNIMOD:35 0.10 39.0 4 3 2 PRT sp|P55884|EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.03 39.0 1 1 1 PRT sp|Q8TB37|NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens OX=9606 GN=NUBPL PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.07 39.0 1 1 1 PRT sp|Q9BTC0|DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.01 39.0 1 1 1 PRT sp|Q9NZT2-2|OGFR_HUMAN Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.09 39.0 1 1 1 PRT sp|Q9H840|GEMI7_HUMAN Gem-associated protein 7 OS=Homo sapiens OX=9606 GN=GEMIN7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 44-UNIMOD:4 0.18 39.0 1 1 1 PRT sp|Q8NCN5|PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 1 1 1 PRT sp|Q9NWA0|MED9_HUMAN Mediator of RNA polymerase II transcription subunit 9 OS=Homo sapiens OX=9606 GN=MED9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.13 39.0 1 1 1 PRT sp|P26639|SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 622-UNIMOD:35,630-UNIMOD:4 0.02 39.0 2 1 0 PRT sp|P23193-2|TCEA1_HUMAN Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 270-UNIMOD:4,273-UNIMOD:4 0.07 39.0 1 1 0 PRT sp|Q14980-5|NUMA1_HUMAN Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.04 39.0 2 2 2 PRT sp|P78362|SRPK2_HUMAN SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.03 38.0 2 1 0 PRT sp|P55060-4|XPO2_HUMAN Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 517-UNIMOD:35,797-UNIMOD:4,801-UNIMOD:35,800-UNIMOD:35,296-UNIMOD:35 0.07 38.0 7 5 4 PRT sp|O43156|TTI1_HUMAN TELO2-interacting protein 1 homolog OS=Homo sapiens OX=9606 GN=TTI1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 351-UNIMOD:4 0.02 38.0 1 1 1 PRT sp|Q9Y5Z4|HEBP2_HUMAN Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 0.08 38.0 2 1 0 PRT sp|P62191-2|PRS4_HUMAN Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.06 38.0 1 1 1 PRT sp|Q9HC35-2|EMAL4_HUMAN Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.02 38.0 1 1 1 PRT sp|Q8IZD4-2|DCP1B_HUMAN Isoform 2 of mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 267-UNIMOD:4 0.03 38.0 1 1 1 PRT sp|P52907|CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.06 38.0 1 1 1 PRT sp|Q14781|CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 222-UNIMOD:4,228-UNIMOD:35,238-UNIMOD:35 0.04 38.0 2 1 0 PRT sp|Q04637-6|IF4G1_HUMAN Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 622-UNIMOD:35,623-UNIMOD:4 0.04 38.0 3 3 3 PRT sp|Q86SF2|GALT7_HUMAN N-acetylgalactosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=GALNT7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.02 38.0 1 1 1 PRT sp|P56192|SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 672-UNIMOD:35,333-UNIMOD:4 0.04 38.0 3 2 1 PRT sp|Q92973-3|TNPO1_HUMAN Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 522-UNIMOD:35,524-UNIMOD:35,582-UNIMOD:35,266-UNIMOD:35,114-UNIMOD:4 0.10 38.0 6 5 3 PRT sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 584-UNIMOD:35 0.05 38.0 4 4 4 PRT sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 494-UNIMOD:35 0.05 38.0 12 3 0 PRT sp|P56181-2|NDUV3_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 407-UNIMOD:35 0.08 38.0 3 2 1 PRT sp|O75592-2|MYCB2_HUMAN Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.00 38.0 1 1 1 PRT sp|P00374-2|DYR_HUMAN Isoform 2 of Dihydrofolate reductase OS=Homo sapiens OX=9606 GN=DHFR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.13 38.0 1 1 1 PRT sp|Q8N1F7-2|NUP93_HUMAN Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 299-UNIMOD:4 0.05 38.0 2 2 1 PRT sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.01 38.0 1 1 1 PRT sp|Q7Z309-4|F122B_HUMAN Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 6-UNIMOD:35 0.07 38.0 1 1 1 PRT sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 411-UNIMOD:35,420-UNIMOD:35,328-UNIMOD:4 0.05 38.0 2 2 2 PRT sp|P43686-2|PRS6B_HUMAN Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 132-UNIMOD:35,139-UNIMOD:35 0.04 38.0 1 1 0 PRT sp|P42167-3|LAP2B_HUMAN Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.19 38.0 3 3 3 PRT sp|Q01968-2|OCRL_HUMAN Isoform B of Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 712-UNIMOD:35 0.02 38.0 3 1 0 PRT sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 38.0 null 322-UNIMOD:4,215-UNIMOD:35,191-UNIMOD:35,201-UNIMOD:35,200-UNIMOD:35 0.08 38.0 5 4 3 PRT sp|P20073-2|ANXA7_HUMAN Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 447-UNIMOD:35 0.03 38.0 1 1 1 PRT sp|Q96SZ6-2|CK5P1_HUMAN Isoform 2 of Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Homo sapiens OX=9606 GN=CDK5RAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 450-UNIMOD:35 0.04 38.0 1 1 1 PRT sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 28-UNIMOD:4 0.07 38.0 1 1 1 PRT sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 356-UNIMOD:4,358-UNIMOD:35 0.03 38.0 2 2 2 PRT sp|Q6UB35|C1TM_HUMAN Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.07 38.0 6 5 4 PRT sp|Q4VCS5-2|AMOT_HUMAN Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.03 38.0 2 1 0 PRT sp|Q9Y3B7-3|RM11_HUMAN Isoform 3 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 30-UNIMOD:35 0.10 38.0 2 1 0 PRT sp|P36915-2|GNL1_HUMAN Isoform 2 of Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.06 38.0 1 1 1 PRT sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 246-UNIMOD:35 0.12 38.0 4 3 2 PRT sp|P55735-2|SEC13_HUMAN Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 220-UNIMOD:4 0.08 38.0 1 1 1 PRT sp|Q8TAE6|PP14C_HUMAN Protein phosphatase 1 regulatory subunit 14C OS=Homo sapiens OX=9606 GN=PPP1R14C PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.13 38.0 1 1 1 PRT sp|Q8TEA1|NSUN6_HUMAN tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 OS=Homo sapiens OX=9606 GN=NSUN6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 436-UNIMOD:35 0.04 38.0 1 1 1 PRT sp|P33240-2|CSTF2_HUMAN Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 465-UNIMOD:35,473-UNIMOD:35,140-UNIMOD:35,144-UNIMOD:35 0.07 38.0 6 2 0 PRT sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.04 38.0 4 3 2 PRT sp|Q9NP61-2|ARFG3_HUMAN Isoform 2 of ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.06 38.0 1 1 1 PRT sp|Q15233|NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 227-UNIMOD:35,90-UNIMOD:35 0.08 38.0 3 2 1 PRT sp|Q96PU8-5|QKI_HUMAN Isoform 3 of Protein quaking OS=Homo sapiens OX=9606 GN=QKI null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 244-UNIMOD:35 0.20 38.0 5 4 3 PRT sp|O43491-3|E41L2_HUMAN Isoform 3 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 559-UNIMOD:35,564-UNIMOD:35,232-UNIMOD:4,619-UNIMOD:35,163-UNIMOD:35 0.13 38.0 10 7 4 PRT sp|P14859-4|PO2F1_HUMAN Isoform 4 of POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.03 38.0 1 1 1 PRT sp|O95169-3|NDUB8_HUMAN Isoform 3 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 39-UNIMOD:35 0.13 38.0 1 1 1 PRT sp|Q92552|RT27_HUMAN 28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 1 1 1 PRT sp|P17676-3|CEBPB_HUMAN Isoform 3 of CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 50-UNIMOD:4 0.13 37.0 1 1 1 PRT sp|Q8IYB8|SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.02 37.0 1 1 1 PRT sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.04 37.0 3 2 1 PRT sp|O00178|GTPB1_HUMAN GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 10-UNIMOD:35,18-UNIMOD:35 0.08 37.0 3 3 3 PRT sp|P47755|CAZA2_HUMAN F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 1 1 1 PRT sp|P11387|TOP1_HUMAN DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 504-UNIMOD:4,505-UNIMOD:4 0.04 37.0 2 2 2 PRT sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 153-UNIMOD:35 0.05 37.0 4 4 4 PRT sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 237-UNIMOD:35,240-UNIMOD:35 0.01 37.0 1 1 1 PRT sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.09 37.0 2 2 2 PRT sp|Q6IQ49-3|SDE2_HUMAN Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.04 37.0 1 1 0 PRT sp|Q9NY27-3|PP4R2_HUMAN Isoform 3 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 290-UNIMOD:35 0.12 37.0 2 2 2 PRT sp|Q9H0A0-2|NAT10_HUMAN Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 182-UNIMOD:4,183-UNIMOD:4,820-UNIMOD:35,854-UNIMOD:35,858-UNIMOD:35 0.06 37.0 5 4 3 PRT sp|Q9HAH7|FBRS_HUMAN Probable fibrosin-1 OS=Homo sapiens OX=9606 GN=FBRS PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.04 37.0 1 1 1 PRT sp|P45954|ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 83-UNIMOD:35 0.04 37.0 1 1 1 PRT sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 1037-UNIMOD:35,412-UNIMOD:35,415-UNIMOD:4 0.04 37.0 2 2 2 PRT sp|P82912-2|RT11_HUMAN Isoform 2 of 28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.08 37.0 1 1 1 PRT sp|Q9UI10-3|EI2BD_HUMAN Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 69-UNIMOD:4 0.07 37.0 2 2 2 PRT sp|O75534-2|CSDE1_HUMAN Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 608-UNIMOD:35 0.04 37.0 3 2 0 PRT sp|P52209-2|6PGD_HUMAN Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.04 37.0 1 1 1 PRT sp|O75694-2|NU155_HUMAN Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 253-UNIMOD:35 0.01 37.0 1 1 1 PRT sp|Q9BYD6|RM01_HUMAN 39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 1 1 1 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 837-UNIMOD:35 0.07 37.0 5 4 3 PRT sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 87-UNIMOD:35,137-UNIMOD:35,158-UNIMOD:4 0.15 37.0 5 3 1 PRT sp|Q12797-10|ASPH_HUMAN Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.05 37.0 2 2 1 PRT sp|Q9UHX1-4|PUF60_HUMAN Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 3 2 1 PRT sp|P61011-2|SRP54_HUMAN Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 327-UNIMOD:35,330-UNIMOD:35,333-UNIMOD:35 0.05 37.0 2 1 0 PRT sp|O75955-2|FLOT1_HUMAN Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.05 37.0 1 1 0 PRT sp|Q9UKV3-5|ACINU_HUMAN Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.03 37.0 4 3 2 PRT sp|P41240|CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 405-UNIMOD:35,411-UNIMOD:4 0.04 37.0 1 1 1 PRT sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 172-UNIMOD:35,389-UNIMOD:35,608-UNIMOD:4 0.11 37.0 8 5 3 PRT sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 96-UNIMOD:4,97-UNIMOD:35 0.05 37.0 1 1 1 PRT sp|Q6PJT7-8|ZC3HE_HUMAN Isoform 8 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 228-UNIMOD:4 0.06 37.0 1 1 1 PRT sp|Q6PL24|TMED8_HUMAN Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 110-UNIMOD:35 0.06 37.0 1 1 1 PRT sp|P82933|RT09_HUMAN 28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 267-UNIMOD:35 0.05 37.0 1 1 1 PRT sp|Q96S66-4|CLCC1_HUMAN Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.05 37.0 1 1 1 PRT sp|Q9HAS0|NJMU_HUMAN Protein Njmu-R1 OS=Homo sapiens OX=9606 GN=C17orf75 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 280-UNIMOD:4,288-UNIMOD:4 0.05 37.0 2 1 0 PRT sp|P10586-2|PTPRF_HUMAN Isoform 2 of Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.02 37.0 2 2 1 PRT sp|P11142-2|HSP7C_HUMAN Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 87-UNIMOD:35,122-UNIMOD:35 0.12 37.0 17 4 2 PRT sp|O15031|PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.01 37.0 1 1 1 PRT sp|Q9Y606-2|TRUA_HUMAN Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.04 37.0 1 1 1 PRT sp|Q9NZ63|TLS1_HUMAN Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 71-UNIMOD:35 0.06 37.0 2 1 0 PRT sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.05 37.0 2 2 2 PRT sp|Q8NFG4|FLCN_HUMAN Folliculin OS=Homo sapiens OX=9606 GN=FLCN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.03 37.0 1 1 1 PRT sp|O43172-2|PRP4_HUMAN Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.06 37.0 2 2 2 PRT sp|P04818|TYSY_HUMAN Thymidylate synthase OS=Homo sapiens OX=9606 GN=TYMS PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 149-UNIMOD:35 0.05 37.0 1 1 1 PRT sp|Q8NC60|NOA1_HUMAN Nitric oxide-associated protein 1 OS=Homo sapiens OX=9606 GN=NOA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 68-UNIMOD:35 0.05 37.0 2 2 2 PRT sp|P21281|VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 0.05 37.0 2 1 0 PRT sp|Q96CX2|KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.12 37.0 2 2 2 PRT sp|P18583-2|SON_HUMAN Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 355-UNIMOD:35,266-UNIMOD:35,272-UNIMOD:35 0.03 37.0 4 4 4 PRT sp|Q9BWD3|RTL8A_HUMAN Retrotransposon Gag-like protein 8A OS=Homo sapiens OX=9606 GN=RTL8A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.14 37.0 2 1 0 PRT sp|Q00839-2|HNRPU_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 53-UNIMOD:35,478-UNIMOD:4,482-UNIMOD:35,483-UNIMOD:35 0.07 37.0 9 3 0 PRT sp|Q9Y6H1|CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.17 37.0 2 1 0 PRT sp|Q9NQE9|HINT3_HUMAN Histidine triad nucleotide-binding protein 3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 16-UNIMOD:4,32-UNIMOD:4 0.16 37.0 1 1 1 PRT sp|P61978-3|HNRPK_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.07 37.0 2 2 2 PRT sp|Q96S97|MYADM_HUMAN Myeloid-associated differentiation marker OS=Homo sapiens OX=9606 GN=MYADM PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 24-UNIMOD:35 0.07 37.0 1 1 1 PRT sp|Q9HD15|SRA1_HUMAN Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 37.0 null 75-UNIMOD:35 0.09 37.0 2 1 0 PRT sp|Q5JS54-3|PSMG4_HUMAN Isoform 3 of Proteasome assembly chaperone 4 OS=Homo sapiens OX=9606 GN=PSMG4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.25 37.0 1 1 1 PRT sp|P12277|KCRB_HUMAN Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 37.0 null 207-UNIMOD:35,377-UNIMOD:35,363-UNIMOD:35 0.28 37.0 25 8 5 PRT sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37.0 null 0.00 37.0 1 1 1 PRT sp|Q16891|MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37.0 null 0.03 37.0 1 1 1 PRT sp|Q9NQ92|COPRS_HUMAN Coordinator of PRMT5 and differentiation stimulator OS=Homo sapiens OX=9606 GN=COPRS PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.12 36.0 1 1 1 PRT sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 200-UNIMOD:4 0.02 36.0 1 1 1 PRT sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 232-UNIMOD:4 0.06 36.0 2 2 2 PRT sp|Q86UP3|ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens OX=9606 GN=ZFHX4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 2732-UNIMOD:4 0.01 36.0 2 2 2 PRT sp|Q9Y6R0|NUMBL_HUMAN Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.03 36.0 1 1 1 PRT sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ACBD6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 111-UNIMOD:35,259-UNIMOD:4,267-UNIMOD:4 0.12 36.0 2 2 2 PRT sp|Q96EK5|KBP_HUMAN KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 0.04 36.0 5 2 1 PRT sp|O15357-2|SHIP2_HUMAN Isoform 2 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 47-UNIMOD:35 0.03 36.0 2 2 2 PRT sp|P49815-7|TSC2_HUMAN Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.01 36.0 1 1 1 PRT sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 1 1 1 PRT sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 1018-UNIMOD:35,1023-UNIMOD:4,956-UNIMOD:4,17-UNIMOD:35,24-UNIMOD:35,29-UNIMOD:4,1045-UNIMOD:4,1050-UNIMOD:35,1606-UNIMOD:35,2442-UNIMOD:4 0.05 36.0 13 8 5 PRT sp|P48634-2|PRC2A_HUMAN Isoform 2 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 1355-UNIMOD:35 0.03 36.0 4 4 4 PRT sp|Q9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens OX=9606 GN=EXOG PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.05 36.0 1 1 1 PRT sp|P28331-3|NDUS1_HUMAN Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 616-UNIMOD:4 0.03 36.0 1 1 1 PRT sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 0.11 36.0 3 2 1 PRT sp|Q96AT9-5|RPE_HUMAN Isoform 5 of Ribulose-phosphate 3-epimerase OS=Homo sapiens OX=9606 GN=RPE null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 118-UNIMOD:4,125-UNIMOD:35,133-UNIMOD:35 0.11 36.0 1 1 1 PRT sp|Q9NV96-2|CC50A_HUMAN Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 17-UNIMOD:4 0.05 36.0 1 1 1 PRT sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.06 36.0 1 1 1 PRT sp|Q96A26|F162A_HUMAN Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 91-UNIMOD:35 0.12 36.0 2 1 0 PRT sp|O00330-2|ODPX_HUMAN Isoform 2 of Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 91-UNIMOD:4 0.07 36.0 1 1 1 PRT sp|P30050|RL12_HUMAN 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 141-UNIMOD:4 0.10 36.0 1 1 1 PRT sp|P13489|RINI_HUMAN Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.07 36.0 2 2 2 PRT sp|Q9UQ35-2|SRRM2_HUMAN Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 1263-UNIMOD:35,1239-UNIMOD:35 0.02 36.0 3 2 1 PRT sp|Q92990-2|GLMN_HUMAN Isoform 2 of Glomulin OS=Homo sapiens OX=9606 GN=GLMN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 168-UNIMOD:35,174-UNIMOD:4,176-UNIMOD:4,177-UNIMOD:4 0.04 36.0 1 1 1 PRT sp|Q9NPI6-2|DCP1A_HUMAN Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 204-UNIMOD:35 0.03 36.0 1 1 1 PRT sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.04 36.0 4 1 0 PRT sp|Q9H1Y0-2|ATG5_HUMAN Isoform Short of Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 145-UNIMOD:4 0.08 36.0 1 1 1 PRT sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.20 36.0 2 2 2 PRT sp|O14787-2|TNPO2_HUMAN Isoform 2 of Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 1 1 1 PRT sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 222-UNIMOD:4 0.11 36.0 3 3 3 PRT sp|P25705-2|ATPA_HUMAN Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 55-UNIMOD:35 0.13 36.0 4 4 4 PRT sp|Q86SX6|GLRX5_HUMAN Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 67-UNIMOD:4 0.13 36.0 3 1 0 PRT sp|Q99536-3|VAT1_HUMAN Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 193-UNIMOD:35 0.11 36.0 3 2 1 PRT sp|P14618-2|KPYM_HUMAN Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.08 36.0 8 3 1 PRT sp|Q9H6T3-3|RPAP3_HUMAN Isoform 3 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.07 36.0 2 2 2 PRT sp|Q92616|GCN1_HUMAN eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.03 36.0 5 5 5 PRT sp|Q96SB4-4|SRPK1_HUMAN Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 327-UNIMOD:35 0.03 36.0 1 1 1 PRT sp|Q96KG9-5|SCYL1_HUMAN Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.06 36.0 2 2 1 PRT sp|P42858|HD_HUMAN Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 1873-UNIMOD:35 0.01 36.0 1 1 1 PRT sp|Q15417-3|CNN3_HUMAN Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 201-UNIMOD:35 0.07 36.0 1 1 1 PRT sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 10-UNIMOD:35 0.02 36.0 3 2 1 PRT sp|P23381-2|SYWC_HUMAN Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 309-UNIMOD:35 0.04 36.0 1 1 0 PRT sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 196-UNIMOD:35,198-UNIMOD:35 0.05 36.0 3 2 1 PRT sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 381-UNIMOD:35 0.04 36.0 1 1 1 PRT sp|Q86XL3-2|ANKL2_HUMAN Isoform 2 of Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.03 36.0 2 1 0 PRT sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 4 2 1 PRT sp|Q96FV9-2|THOC1_HUMAN Isoform 2 of THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.05 36.0 1 1 1 PRT sp|Q9HB71-3|CYBP_HUMAN Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 149-UNIMOD:35 0.19 36.0 2 2 1 PRT sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 314-UNIMOD:4,315-UNIMOD:35 0.08 36.0 4 2 1 PRT sp|Q9P2D1-2|CHD7_HUMAN Isoform 2 of Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 570-UNIMOD:35 0.03 36.0 2 2 2 PRT sp|Q9NZN5-2|ARHGC_HUMAN Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.01 36.0 2 1 0 PRT sp|Q6ZSZ5-2|ARHGI_HUMAN Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 1 1 1 PRT sp|Q9HB09-3|B2L12_HUMAN Isoform 3 of Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.05 36.0 1 1 1 PRT sp|Q8NC51-4|PAIRB_HUMAN Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 11-UNIMOD:4 0.15 36.0 10 4 3 PRT sp|Q9BSD7|NTPCR_HUMAN Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.08 36.0 1 1 1 PRT sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 3 3 3 PRT sp|O95486|SC24A_HUMAN Protein transport protein Sec24A OS=Homo sapiens OX=9606 GN=SEC24A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 1 1 1 PRT sp|Q05682-5|CALD1_HUMAN Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 1-UNIMOD:1,1-UNIMOD:35 0.06 36.0 2 2 2 PRT sp|Q3SY69|AL1L2_HUMAN Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH1L2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 472-UNIMOD:4,831-UNIMOD:35 0.03 36.0 3 2 1 PRT sp|P11177-2|ODPB_HUMAN Isoform 2 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 115-UNIMOD:35,245-UNIMOD:4,250-UNIMOD:35 0.09 36.0 2 2 2 PRT sp|Q15059-2|BRD3_HUMAN Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 140-UNIMOD:35 0.03 36.0 1 1 1 PRT sp|P00558-2|PGK1_HUMAN Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 223-UNIMOD:35,71-UNIMOD:4 0.14 36.0 5 4 3 PRT sp|P51610-2|HCFC1_HUMAN Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 434-UNIMOD:35,532-UNIMOD:35 0.03 36.0 6 4 2 PRT sp|Q9Y2D5|AKAP2_HUMAN A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.02 36.0 1 1 1 PRT sp|Q6PJ69|TRI65_HUMAN Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 0.03 36.0 2 1 0 PRT sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 1143-UNIMOD:35 0.03 36.0 6 4 2 PRT sp|Q86UE4|LYRIC_HUMAN Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.06 36.0 2 2 2 PRT sp|Q04206-2|TF65_HUMAN Isoform 2 of Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 271-UNIMOD:35 0.03 36.0 1 1 1 PRT sp|Q9C0C2|TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 20-UNIMOD:35 0.02 36.0 2 2 2 PRT sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 93-UNIMOD:4 0.05 36.0 1 1 1 PRT sp|P09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 890-UNIMOD:35 0.05 36.0 4 4 4 PRT sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 36.0 null 387-UNIMOD:35,394-UNIMOD:35,544-UNIMOD:35 0.03 36.0 6 4 3 PRT sp|Q96F44-3|TRI11_HUMAN Isoform 3 of E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 451-UNIMOD:35,454-UNIMOD:4 0.04 36.0 2 1 0 PRT sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 852-UNIMOD:35 0.06 36.0 3 3 3 PRT sp|Q14202-2|ZMYM3_HUMAN Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.01 36.0 1 1 1 PRT sp|Q7Z6Z7-2|HUWE1_HUMAN Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 2383-UNIMOD:35,643-UNIMOD:35,19-UNIMOD:4 0.02 36.0 6 5 4 PRT sp|Q8WXF1|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 492-UNIMOD:35 0.05 36.0 2 1 0 PRT sp|P51116|FXR2_HUMAN Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 560-UNIMOD:35,571-UNIMOD:35 0.06 36.0 2 2 2 PRT sp|Q96RK0|CIC_HUMAN Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 0.01 36.0 1 1 1 PRT sp|Q5T4S7|UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 0.00 36.0 1 1 0 PRT sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 431-UNIMOD:35 0.08 36.0 2 2 2 PRT sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 78-UNIMOD:4,83-UNIMOD:35,131-UNIMOD:35 0.14 36.0 2 2 1 PRT sp|P45984|MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 249-UNIMOD:35 0.04 36.0 1 1 0 PRT sp|P00747|PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 423-UNIMOD:35,426-UNIMOD:4 0.02 36.0 1 1 1 PRT sp|Q12846|STX4_HUMAN Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 79-UNIMOD:35 0.06 36.0 2 1 0 PRT sp|Q8NHW5|RLA0L_HUMAN 60S acidic ribosomal protein P0-like OS=Homo sapiens OX=9606 GN=RPLP0P6 PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36.0 null 119-UNIMOD:4 0.07 36.0 1 1 1 PRT sp|P18206-2|VINC_HUMAN Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 898-UNIMOD:35,899-UNIMOD:35,900-UNIMOD:35,94-UNIMOD:35,741-UNIMOD:35,748-UNIMOD:35,797-UNIMOD:35,799-UNIMOD:35,209-UNIMOD:35 0.12 35.0 12 8 6 PRT sp|O60832|DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 95-UNIMOD:4,191-UNIMOD:35 0.22 35.0 3 3 3 PRT sp|Q9UJZ1-2|STML2_HUMAN Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.10 35.0 2 2 2 PRT sp|Q9HAV4|XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 20-UNIMOD:35,21-UNIMOD:35,1131-UNIMOD:4 0.02 35.0 4 2 1 PRT sp|Q9NPF5|DMAP1_HUMAN DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.03 35.0 1 1 1 PRT sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|Q96Q15-4|SMG1_HUMAN Isoform 4 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.01 35.0 1 1 1 PRT sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 0.01 35.0 2 1 0 PRT sp|Q9Y5A9|YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 182-UNIMOD:35,189-UNIMOD:35 0.06 35.0 2 2 2 PRT sp|P78312-4|F193A_HUMAN Isoform 4 of Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 1077-UNIMOD:35 0.01 35.0 1 1 1 PRT sp|Q13561|DCTN2_HUMAN Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 378-UNIMOD:35 0.04 35.0 2 1 0 PRT sp|O75909-1|CCNK_HUMAN Isoform 3 of Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 1 1 0 PRT sp|Q6IN85-5|P4R3A_HUMAN Isoform 5 of Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.06 35.0 2 2 2 PRT sp|Q9UGU0-2|TCF20_HUMAN Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.01 35.0 1 1 1 PRT sp|P55265-5|DSRAD_HUMAN Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 586-UNIMOD:35 0.04 35.0 2 2 2 PRT sp|Q86VP6-2|CAND1_HUMAN Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 1059-UNIMOD:35 0.05 35.0 4 4 4 PRT sp|Q9UMX0-4|UBQL1_HUMAN Isoform 4 of Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.09 35.0 1 1 1 PRT sp|Q13439-3|GOGA4_HUMAN Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 2 2 2 PRT sp|O00410-2|IPO5_HUMAN Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 567-UNIMOD:35,571-UNIMOD:35 0.02 35.0 1 1 1 PRT sp|O43795-2|MYO1B_HUMAN Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 310-UNIMOD:4 0.01 35.0 1 1 1 PRT sp|Q06210-2|GFPT1_HUMAN Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 340-UNIMOD:35 0.02 35.0 2 1 0 PRT sp|Q96B01-3|R51A1_HUMAN Isoform 3 of RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 1 1 1 PRT sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 222-UNIMOD:35 0.04 35.0 4 3 2 PRT sp|Q9UJK0|TSR3_HUMAN 18S rRNA aminocarboxypropyltransferase OS=Homo sapiens OX=9606 GN=TSR3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.06 35.0 1 1 1 PRT sp|Q9UPN3-4|MACF1_HUMAN Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 2290-UNIMOD:35 0.00 35.0 1 1 1 PRT sp|P80303-2|NUCB2_HUMAN Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.07 35.0 2 2 2 PRT sp|Q9UI09|NDUAC_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.12 35.0 1 1 1 PRT sp|O43399-2|TPD54_HUMAN Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 22-UNIMOD:35 0.11 35.0 1 1 1 PRT sp|O75390|CISY_HUMAN Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|P78417-2|GSTO1_HUMAN Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.14 35.0 2 2 2 PRT sp|Q14103-4|HNRPD_HUMAN Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 4 1 0 PRT sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 2 2 2 PRT sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 37-UNIMOD:35 0.06 35.0 2 1 0 PRT sp|Q7Z4V5-2|HDGR2_HUMAN Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 1 1 1 PRT sp|Q15366-7|PCBP2_HUMAN Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 87-UNIMOD:35 0.09 35.0 3 2 1 PRT sp|P41440|S19A1_HUMAN Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 580-UNIMOD:4 0.05 35.0 2 2 2 PRT sp|P38432|COIL_HUMAN Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.03 35.0 1 1 1 PRT sp|Q13564-3|ULA1_HUMAN Isoform 3 of NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|Q92598-2|HS105_HUMAN Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 277-UNIMOD:35,290-UNIMOD:4,292-UNIMOD:35 0.05 35.0 3 2 1 PRT sp|A6NDU8|CE051_HUMAN UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 0.05 35.0 4 1 0 PRT sp|Q6P9B6|MEAK7_HUMAN MTOR-associated protein MEAK7 OS=Homo sapiens OX=9606 GN=MEAK7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 406-UNIMOD:35 0.04 35.0 1 1 1 PRT sp|O14980|XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.03 35.0 2 2 2 PRT sp|Q8WWM7-6|ATX2L_HUMAN Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 5 3 2 PRT sp|Q9Y2X9-2|ZN281_HUMAN Isoform 2 of Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 1 1 1 PRT sp|Q6P587|FAHD1_HUMAN Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 61-UNIMOD:35 0.09 35.0 1 1 1 PRT sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 104-UNIMOD:4,107-UNIMOD:35,109-UNIMOD:35,110-UNIMOD:35 0.02 35.0 1 1 1 PRT sp|P28289-2|TMOD1_HUMAN Isoform 2 of Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.08 35.0 1 1 0 PRT sp|P54105|ICLN_HUMAN Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 0.06 35.0 4 1 0 PRT sp|Q53ET0|CRTC2_HUMAN CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 515-UNIMOD:4 0.04 35.0 1 1 1 PRT sp|Q96T58|MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.01 35.0 2 2 2 PRT sp|Q53GS7-2|GLE1_HUMAN Isoform 2 of Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.03 35.0 1 1 1 PRT sp|Q9BY44-3|EIF2A_HUMAN Isoform 3 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.12 35.0 4 4 4 PRT sp|Q5T6F2|UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.01 35.0 2 1 0 PRT sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 1594-UNIMOD:4 0.02 35.0 2 2 2 PRT sp|Q9H2U2|IPYR2_HUMAN Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 161-UNIMOD:4,171-UNIMOD:4 0.06 35.0 1 1 1 PRT sp|Q9Y678|COPG1_HUMAN Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 586-UNIMOD:35 0.02 35.0 2 1 0 PRT sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.07 35.0 2 2 2 PRT sp|Q9UKX7-2|NUP50_HUMAN Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.09 35.0 2 2 2 PRT sp|P48147|PPCE_HUMAN Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 1 1 1 PRT sp|P42694-2|HELZ_HUMAN Isoform 2 of Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.01 35.0 1 1 1 PRT sp|Q9Y5X3|SNX5_HUMAN Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|O95551|TYDP2_HUMAN Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 1 1 1 PRT sp|P50502|F10A1_HUMAN Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 220-UNIMOD:35 0.08 35.0 3 2 1 PRT sp|Q86UK7-4|ZN598_HUMAN Isoform 4 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.06 35.0 1 1 1 PRT sp|P40925|MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 137-UNIMOD:4,90-UNIMOD:35 0.13 35.0 5 3 1 PRT sp|Q99717|SMAD5_HUMAN Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 35.0 null 454-UNIMOD:35,110-UNIMOD:4 0.10 35.0 3 3 3 PRT sp|Q12830-4|BPTF_HUMAN Isoform 4 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 2076-UNIMOD:35,445-UNIMOD:4,20-UNIMOD:4 0.02 35.0 4 4 4 PRT sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|Q6NUQ4-2|TM214_HUMAN Isoform 2 of Transmembrane protein 214 OS=Homo sapiens OX=9606 GN=TMEM214 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.03 35.0 1 1 1 PRT sp|O60231|DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.02 35.0 1 1 1 PRT sp|Q96D46|NMD3_HUMAN 60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 35.0 null 410-UNIMOD:35 0.03 35.0 5 3 2 PRT sp|Q9Y4J8-6|DTNA_HUMAN Isoform 6 of Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 342-UNIMOD:35 0.07 35.0 1 1 1 PRT sp|Q6P2Q9|PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 25-UNIMOD:35 0.02 35.0 2 2 2 PRT sp|Q9BVT8|TMUB1_HUMAN Transmembrane and ubiquitin-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMUB1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.12 35.0 1 1 1 PRT sp|Q00796-2|DHSO_HUMAN Isoform 2 of Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.18 35.0 1 1 1 PRT sp|Q96KQ7-2|EHMT2_HUMAN Isoform 2 of Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 154-UNIMOD:35 0.05 35.0 2 2 2 PRT sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 1 1 1 PRT sp|Q15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.12 35.0 2 2 2 PRT sp|Q8NFH5-2|NUP35_HUMAN Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.11 35.0 2 2 2 PRT sp|O95168-2|NDUB4_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 OS=Homo sapiens OX=9606 GN=NDUFB4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.16 35.0 1 1 1 PRT sp|Q9NQS7-2|INCE_HUMAN Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 2 2 2 PRT sp|P35658|NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35.0 null 0.01 35.0 1 1 1 PRT sp|P13010|XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 35.0 null 296-UNIMOD:4 0.06 35.0 3 3 3 PRT sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35.0 null 246-UNIMOD:35 0.09 35.0 3 1 0 PRT sp|Q12788|TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 35.0 null 0.04 35.0 2 2 2 PRT sp|Q9H3P7|GCP60_HUMAN Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 35.0 null 331-UNIMOD:35,332-UNIMOD:35 0.06 35.0 3 2 1 PRT sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35.0 null 548-UNIMOD:35 0.02 35.0 1 1 1 PRT sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 917-UNIMOD:4,296-UNIMOD:35 0.04 34.0 6 3 1 PRT sp|Q8N5F7|NKAP_HUMAN NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.04 34.0 1 1 1 PRT sp|Q8WWK9-6|CKAP2_HUMAN Isoform 4 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 449-UNIMOD:35 0.02 34.0 1 1 1 PRT sp|Q13330-2|MTA1_HUMAN Isoform Short of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 281-UNIMOD:4 0.04 34.0 1 1 0 PRT sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 451-UNIMOD:35,407-UNIMOD:35 0.05 34.0 10 3 0 PRT sp|Q15906|VPS72_HUMAN Vacuolar protein sorting-associated protein 72 homolog OS=Homo sapiens OX=9606 GN=VPS72 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.04 34.0 1 1 1 PRT sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 347-UNIMOD:35,355-UNIMOD:35,359-UNIMOD:35 0.05 34.0 2 1 0 PRT sp|Q9NZZ3-2|CHMP5_HUMAN Isoform 2 of Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 20-UNIMOD:4 0.10 34.0 1 1 1 PRT sp|Q8WWY3-2|PRP31_HUMAN Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 81-UNIMOD:35 0.04 34.0 2 1 0 PRT sp|Q6MZP7-3|LIN54_HUMAN Isoform 3 of Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=LIN54 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.03 34.0 1 1 1 PRT sp|O94760-2|DDAH1_HUMAN Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.09 34.0 1 1 1 PRT sp|Q15024|EXOS7_HUMAN Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 189-UNIMOD:4 0.05 34.0 1 1 1 PRT sp|Q96KR1|ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 1002-UNIMOD:35,1032-UNIMOD:35,1038-UNIMOD:35 0.04 34.0 10 3 0 PRT sp|Q9Y2J2-3|E41L3_HUMAN Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 461-UNIMOD:35,594-UNIMOD:35 0.08 34.0 3 3 3 PRT sp|P62820-2|RAB1A_HUMAN Isoform 2 of Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.12 34.0 1 1 1 PRT sp|P07942|LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 455-UNIMOD:4 0.01 34.0 1 1 1 PRT sp|O94966-4|UBP19_HUMAN Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 1029-UNIMOD:4 0.01 34.0 1 1 1 PRT sp|Q8TBC4-2|UBA3_HUMAN Isoform 2 of NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 350-UNIMOD:4,353-UNIMOD:4 0.05 34.0 1 1 1 PRT sp|P49756-4|RBM25_HUMAN Isoform 4 of RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 83-UNIMOD:4 0.13 34.0 1 1 1 PRT sp|Q9UKK9|NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.07 34.0 1 1 1 PRT sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens OX=9606 GN=PPM1E PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.02 34.0 1 1 1 PRT sp|Q13011|ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.05 34.0 1 1 1 PRT sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 106-UNIMOD:4,187-UNIMOD:4 0.07 34.0 3 2 1 PRT sp|E9PAV3|NACAM_HUMAN Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 2048-UNIMOD:35 0.02 34.0 3 3 3 PRT sp|Q99729-3|ROAA_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.05 34.0 1 1 1 PRT sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 0.42 34.0 3 2 1 PRT sp|Q96ST2-2|IWS1_HUMAN Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.03 34.0 1 1 0 PRT sp|Q9Y4C2-2|TCAF1_HUMAN Isoform 2 of TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 208-UNIMOD:4 0.02 34.0 1 1 1 PRT sp|P41091|IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 434-UNIMOD:4 0.03 34.0 1 1 1 PRT sp|Q12955-6|ANK3_HUMAN Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 170-UNIMOD:35 0.03 34.0 2 2 2 PRT sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.03 34.0 2 2 2 PRT sp|Q96RT1-7|ERBIN_HUMAN Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 364-UNIMOD:35,367-UNIMOD:35,781-UNIMOD:35 0.02 34.0 2 2 1 PRT sp|O75165|DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.01 34.0 1 1 1 PRT sp|Q9UN37|VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 403-UNIMOD:4,404-UNIMOD:35,407-UNIMOD:35 0.03 34.0 2 1 0 PRT sp|Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 902-UNIMOD:4 0.01 34.0 1 1 1 PRT sp|Q14558-2|KPRA_HUMAN Isoform 2 of Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.04 34.0 1 1 1 PRT sp|Q9UG63|ABCF2_HUMAN ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 453-UNIMOD:35,65-UNIMOD:35 0.04 34.0 3 2 1 PRT sp|Q9Y520-3|PRC2C_HUMAN Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.02 34.0 5 4 3 PRT sp|P56962|STX17_HUMAN Syntaxin-17 OS=Homo sapiens OX=9606 GN=STX17 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 290-UNIMOD:4 0.05 34.0 1 1 1 PRT sp|Q9BU02|THTPA_HUMAN Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.07 34.0 1 1 1 PRT sp|O95861-3|BPNT1_HUMAN Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 151-UNIMOD:4,155-UNIMOD:35 0.07 34.0 2 1 0 PRT sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 511-UNIMOD:35,517-UNIMOD:4 0.02 34.0 2 1 0 PRT sp|P78527-2|PRKDC_HUMAN Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 879-UNIMOD:35,880-UNIMOD:35,3014-UNIMOD:4,948-UNIMOD:35,958-UNIMOD:35 0.02 34.0 5 4 1 PRT sp|P56181|NDUV3_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.15 34.0 1 1 1 PRT sp|O95793-2|STAU1_HUMAN Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.05 34.0 2 2 2 PRT sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 134-UNIMOD:35,139-UNIMOD:35 0.09 34.0 2 1 0 PRT sp|Q9BUJ2-3|HNRL1_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.02 34.0 1 1 1 PRT sp|Q3KQU3-2|MA7D1_HUMAN Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.02 34.0 1 1 1 PRT sp|Q5JTH9-2|RRP12_HUMAN Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 79-UNIMOD:35 0.03 34.0 2 2 2 PRT sp|O75190-4|DNJB6_HUMAN Isoform D of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.06 34.0 1 1 1 PRT sp|P50552|VASP_HUMAN Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 334-UNIMOD:4 0.07 34.0 1 1 1 PRT sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.01 34.0 1 1 1 PRT sp|Q12860-2|CNTN1_HUMAN Isoform 2 of Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 652-UNIMOD:35 0.01 34.0 1 1 0 PRT sp|P05114|HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 0.25 34.0 2 2 2 PRT sp|Q7L8L6|FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 655-UNIMOD:35,670-UNIMOD:4 0.04 34.0 2 2 2 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 293-UNIMOD:35 0.07 34.0 8 4 2 PRT sp|Q9NX70|MED29_HUMAN Mediator of RNA polymerase II transcription subunit 29 OS=Homo sapiens OX=9606 GN=MED29 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 0.07 34.0 2 1 0 PRT sp|Q13405|RM49_HUMAN 39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.09 34.0 1 1 1 PRT sp|Q6P1Q9-2|MET2B_HUMAN Isoform 2 of tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.04 34.0 1 1 1 PRT sp|O60934|NBN_HUMAN Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 595-UNIMOD:35 0.07 34.0 4 3 2 PRT sp|Q9H4L5-8|OSBL3_HUMAN Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 478-UNIMOD:35 0.03 34.0 1 1 1 PRT sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 0.04 34.0 2 1 0 PRT sp|Q6P3W7|SCYL2_HUMAN SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 24-UNIMOD:35 0.02 34.0 1 1 1 PRT sp|P47756-2|CAPZB_HUMAN Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 88-UNIMOD:35 0.06 34.0 2 1 0 PRT sp|P08865|RSSA_HUMAN 40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.11 34.0 2 2 2 PRT sp|O15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.07 34.0 1 1 1 PRT sp|O43716|GATC_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial OS=Homo sapiens OX=9606 GN=GATC PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 78-UNIMOD:35 0.13 34.0 1 1 1 PRT sp|P78347-5|GTF2I_HUMAN Isoform 5 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.11 34.0 2 2 2 PRT sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.03 34.0 2 2 2 PRT sp|Q6SPF0|SAMD1_HUMAN Atherin OS=Homo sapiens OX=9606 GN=SAMD1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 0.06 34.0 2 1 0 PRT sp|P55209-2|NP1L1_HUMAN Isoform 2 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.08 34.0 2 2 2 PRT sp|P29401|TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.03 34.0 3 1 0 PRT sp|Q14126|DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 1069-UNIMOD:35,928-UNIMOD:35 0.06 34.0 6 4 3 PRT sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34.0 null 0.02 34.0 2 2 2 PRT sp|O75534|CSDE1_HUMAN Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 34.0 null 639-UNIMOD:35 0.04 34.0 2 2 0 PRT sp|P13804|ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34.0 null 261-UNIMOD:35 0.06 34.0 2 1 0 PRT sp|O75909|CCNK_HUMAN Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34.0 null 0.03 34.0 1 1 0 PRT sp|Q07020|RL18_HUMAN 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34.0 null 0.07 34.0 1 1 0 PRT sp|Q9Y2L1-2|RRP44_HUMAN Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 164-UNIMOD:4 0.03 33.0 2 2 2 PRT sp|Q4G0J3|LARP7_HUMAN La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 2 2 2 PRT sp|P23526|SAHH_HUMAN Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 29-UNIMOD:35,33-UNIMOD:35 0.06 33.0 4 2 0 PRT sp|Q32MZ4-3|LRRF1_HUMAN Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|Q14671-4|PUM1_HUMAN Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 894-UNIMOD:35 0.01 33.0 1 1 1 PRT sp|Q9UNS2-2|CSN3_HUMAN Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 373-UNIMOD:35 0.04 33.0 2 1 0 PRT sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|P46013-2|KI67_HUMAN Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 7 6 5 PRT sp|Q96SN8-4|CK5P2_HUMAN Isoform 4 of CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|Q92667-2|AKAP1_HUMAN Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 147-UNIMOD:4 0.07 33.0 4 3 2 PRT sp|P12814-2|ACTN1_HUMAN Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|O76021-2|RL1D1_HUMAN Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.12 33.0 3 2 1 PRT sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 1 PRT sp|O75147-2|OBSL1_HUMAN Isoform 2 of Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|Q9H6Z4-3|RANB3_HUMAN Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.06 33.0 2 2 2 PRT sp|P62258-2|1433E_HUMAN Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 11-UNIMOD:35,199-UNIMOD:35 0.16 33.0 4 3 2 PRT sp|Q9NUM4|T106B_HUMAN Transmembrane protein 106B OS=Homo sapiens OX=9606 GN=TMEM106B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 26-UNIMOD:35 0.05 33.0 1 1 1 PRT sp|Q5BKZ1-3|ZN326_HUMAN Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 2 1 0 PRT sp|O15164-2|TIF1A_HUMAN Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.06 33.0 3 3 3 PRT sp|O43615|TIM44_HUMAN Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|Q1ZZU3|SWI5_HUMAN DNA repair protein SWI5 homolog OS=Homo sapiens OX=9606 GN=SWI5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 233-UNIMOD:35 0.06 33.0 1 1 1 PRT sp|Q8WY36-2|BBX_HUMAN Isoform 2 of HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 899-UNIMOD:35,908-UNIMOD:4 0.02 33.0 2 1 0 PRT sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 544-UNIMOD:35 0.02 33.0 1 1 1 PRT sp|Q969M7-5|UBE2F_HUMAN Isoform 5 of NEDD8-conjugating enzyme UBE2F OS=Homo sapiens OX=9606 GN=UBE2F null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 50-UNIMOD:4,52-UNIMOD:4 0.15 33.0 1 1 1 PRT sp|Q9UN86-2|G3BP2_HUMAN Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 109-UNIMOD:35 0.04 33.0 2 1 0 PRT sp|P52888-2|THOP1_HUMAN Isoform 2 of Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 251-UNIMOD:4,258-UNIMOD:4 0.06 33.0 1 1 1 PRT sp|Q3YEC7|RABL6_HUMAN Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 491-UNIMOD:4 0.02 33.0 1 1 1 PRT sp|Q2TAK8-2|PWP3A_HUMAN Isoform 2 of PWWP domain-containing DNA repair factor 3A OS=Homo sapiens OX=9606 GN=PWWP3A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 480-UNIMOD:4 0.02 33.0 1 1 1 PRT sp|P40926-2|MDHM_HUMAN Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 89-UNIMOD:4,170-UNIMOD:4,93-UNIMOD:4,273-UNIMOD:35 0.22 33.0 8 5 2 PRT sp|Q96B26|EXOS8_HUMAN Exosome complex component RRP43 OS=Homo sapiens OX=9606 GN=EXOSC8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 89-UNIMOD:4 0.06 33.0 2 1 0 PRT sp|Q9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 1 PRT sp|P30040|ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 221-UNIMOD:35 0.06 33.0 5 1 0 PRT sp|P78371-2|TCPB_HUMAN Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 197-UNIMOD:35,15-UNIMOD:35,306-UNIMOD:35 0.08 33.0 5 3 0 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 0.05 33.0 3 1 0 PRT sp|Q96JM3|CHAP1_HUMAN Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 800-UNIMOD:35 0.02 33.0 1 1 1 PRT sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 1824-UNIMOD:35,1908-UNIMOD:4 0.02 33.0 3 3 3 PRT sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 0.08 33.0 2 1 0 PRT sp|O94905|ERLN2_HUMAN Erlin-2 OS=Homo sapiens OX=9606 GN=ERLIN2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 1 PRT sp|Q5JRX3-3|PREP_HUMAN Isoform 3 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 2 2 2 PRT sp|Q9NYL2-2|M3K20_HUMAN Isoform 2 of Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 1 1 1 PRT sp|Q4VC44-2|FWCH1_HUMAN Isoform 2 of FLYWCH-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=FLYWCH1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|Q86TB9-4|PATL1_HUMAN Isoform 4 of Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 93-UNIMOD:35,105-UNIMOD:35 0.02 33.0 1 1 1 PRT sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 1-UNIMOD:35 0.10 33.0 2 2 2 PRT sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 276-UNIMOD:35,410-UNIMOD:35,411-UNIMOD:4,155-UNIMOD:35,404-UNIMOD:35 0.15 33.0 11 5 3 PRT sp|Q2M2I8-2|AAK1_HUMAN Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|Q96GG9|DCNL1_HUMAN DCN1-like protein 1 OS=Homo sapiens OX=9606 GN=DCUN1D1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 123-UNIMOD:35,126-UNIMOD:35,131-UNIMOD:4 0.07 33.0 1 1 1 PRT sp|O43264-2|ZW10_HUMAN Isoform 2 of Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 1 1 1 PRT sp|O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 0.04 33.0 3 2 1 PRT sp|P17096|HMGA1_HUMAN High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.23 33.0 3 2 1 PRT sp|Q96N67-7|DOCK7_HUMAN Isoform 7 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 1 1 1 PRT sp|P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 196-UNIMOD:35,148-UNIMOD:35 0.09 33.0 5 4 3 PRT sp|Q9H4A5-2|GLP3L_HUMAN Isoform 2 of Golgi phosphoprotein 3-like OS=Homo sapiens OX=9606 GN=GOLPH3L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.07 33.0 1 1 1 PRT sp|Q9H2V7-5|SPNS1_HUMAN Isoform 5 of Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.07 33.0 1 1 1 PRT sp|P23142-2|FBLN1_HUMAN Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|P49750-3|YLPM1_HUMAN Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.02 33.0 3 2 1 PRT sp|Q14320|FA50A_HUMAN Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 73-UNIMOD:35 0.04 33.0 1 1 1 PRT sp|A1X283|SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 33.0 null 664-UNIMOD:4 0.03 33.0 3 2 1 PRT sp|Q14318|FKBP8_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 211-UNIMOD:35 0.04 33.0 3 1 0 PRT sp|Q07020-2|RL18_HUMAN Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.09 33.0 1 1 0 PRT sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|Q9BRT9|SLD5_HUMAN DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.07 33.0 1 1 1 PRT sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 1 1 1 PRT sp|Q8IXQ5-5|KLHL7_HUMAN Isoform 5 of Kelch-like protein 7 OS=Homo sapiens OX=9606 GN=KLHL7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 211-UNIMOD:4 0.03 33.0 1 1 1 PRT sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 158-UNIMOD:35 0.03 33.0 3 1 0 PRT sp|P45984-3|MK09_HUMAN Isoform Beta-1 of Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 249-UNIMOD:35 0.04 33.0 1 1 0 PRT sp|Q8TD30-2|ALAT2_HUMAN Isoform 2 of Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 165-UNIMOD:4 0.04 33.0 1 1 1 PRT sp|P62913-2|RL11_HUMAN Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.08 33.0 1 1 0 PRT sp|Q9BY77-2|PDIP3_HUMAN Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 0 PRT sp|Q06124-3|PTN11_HUMAN Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 104-UNIMOD:4 0.03 33.0 1 1 1 PRT sp|Q9Y6M7-5|S4A7_HUMAN Isoform 5 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 750-UNIMOD:35 0.02 33.0 1 1 1 PRT sp|Q01130-2|SRSF2_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 72-UNIMOD:35,75-UNIMOD:35 0.09 33.0 6 1 0 PRT sp|P49406|RM19_HUMAN 39S ribosomal protein L19, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL19 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 204-UNIMOD:35 0.05 33.0 1 1 1 PRT sp|P05026-2|AT1B1_HUMAN Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 121-UNIMOD:35,126-UNIMOD:4 0.06 33.0 1 1 1 PRT sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.05 33.0 1 1 1 PRT sp|P07737|PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 86-UNIMOD:35 0.20 33.0 2 2 2 PRT sp|P62280|RS11_HUMAN 40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 131-UNIMOD:4 0.16 33.0 2 2 2 PRT sp|Q9Y3D8-2|KAD6_HUMAN Isoform 2 of Adenylate kinase isoenzyme 6 OS=Homo sapiens OX=9606 GN=AK6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 50-UNIMOD:4 0.13 33.0 1 1 1 PRT sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|P16383-2|GCFC2_HUMAN Isoform 2 of GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.04 33.0 2 2 2 PRT sp|Q9NXF1-2|TEX10_HUMAN Isoform 2 of Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 2 2 2 PRT sp|P04792|HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.19 33.0 3 2 1 PRT sp|Q04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.11 33.0 1 1 1 PRT sp|P53396-2|ACLY_HUMAN Isoform 2 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 947-UNIMOD:35,229-UNIMOD:4 0.04 33.0 3 3 3 PRT sp|Q03252|LMNB2_HUMAN Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 574-UNIMOD:35 0.02 33.0 1 1 1 PRT sp|O95831-6|AIFM1_HUMAN Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 84-UNIMOD:35 0.13 33.0 2 2 2 PRT sp|P42126-2|ECI1_HUMAN Isoform 2 of Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens OX=9606 GN=ECI1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 60-UNIMOD:35 0.06 33.0 2 1 0 PRT sp|Q71U36|TBA1A_HUMAN Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 0.14 33.0 7 3 0 PRT sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 53-UNIMOD:35,497-UNIMOD:4,501-UNIMOD:35,502-UNIMOD:35 0.04 33.0 4 2 0 PRT sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 33.0 null 894-UNIMOD:35,898-UNIMOD:4 0.06 33.0 5 4 3 PRT sp|P16989|YBOX3_HUMAN Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 0.06 33.0 1 1 0 PRT sp|Q14674|ESPL1_HUMAN Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|O43432|IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 1411-UNIMOD:4 0.01 33.0 1 1 1 PRT sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|O94776|MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 261-UNIMOD:4,249-UNIMOD:35 0.02 33.0 2 1 0 PRT sp|O75955|FLOT1_HUMAN Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 0.04 33.0 1 1 0 PRT sp|P46020|KPB1_HUMAN Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33.0 null 1185-UNIMOD:4 0.02 33.0 1 1 0 PRT sp|Q16181-2|SEPT7_HUMAN Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 203-UNIMOD:4,352-UNIMOD:35,354-UNIMOD:35,356-UNIMOD:35,362-UNIMOD:35 0.06 32.0 2 2 2 PRT sp|Q9H9B1-4|EHMT1_HUMAN Isoform 4 of Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|P49589-2|SYCC_HUMAN Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 227-UNIMOD:35 0.06 32.0 3 3 1 PRT sp|Q8WX92|NELFB_HUMAN Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|P47914|RL29_HUMAN 60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 0.10 32.0 2 1 0 PRT sp|P36776-3|LONM_HUMAN Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 614-UNIMOD:35 0.02 32.0 1 1 1 PRT sp|Q49A26-4|GLYR1_HUMAN Isoform 4 of Putative oxidoreductase GLYR1 OS=Homo sapiens OX=9606 GN=GLYR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.06 32.0 2 2 2 PRT sp|O95243-3|MBD4_HUMAN Isoform 3 of Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 190-UNIMOD:35 0.03 32.0 1 1 1 PRT sp|Q99598|TSNAX_HUMAN Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 36-UNIMOD:35,282-UNIMOD:35 0.09 32.0 4 2 1 PRT sp|Q9NQ66-2|PLCB1_HUMAN Isoform B of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.01 32.0 1 1 1 PRT sp|O75477|ERLN1_HUMAN Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.04 32.0 1 1 1 PRT sp|Q15056-2|IF4H_HUMAN Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.06 32.0 2 1 0 PRT sp|P82932|RT06_HUMAN 28S ribosomal protein S6, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 105-UNIMOD:4 0.11 32.0 1 1 1 PRT sp|O15067|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 447-UNIMOD:35 0.04 32.0 5 4 3 PRT sp|P46778|RL21_HUMAN 60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 159-UNIMOD:35 0.10 32.0 1 1 1 PRT sp|Q02880-2|TOP2B_HUMAN Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 959-UNIMOD:35 0.01 32.0 1 1 0 PRT sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 943-UNIMOD:35,880-UNIMOD:35,888-UNIMOD:35,1207-UNIMOD:35 0.04 32.0 10 5 2 PRT sp|P31150|GDIA_HUMAN Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 168-UNIMOD:35,202-UNIMOD:4 0.10 32.0 3 3 3 PRT sp|Q99497|PARK7_HUMAN Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 17-UNIMOD:35,26-UNIMOD:35 0.08 32.0 5 1 0 PRT sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 438-UNIMOD:35,293-UNIMOD:35,671-UNIMOD:4 0.04 32.0 7 3 1 PRT sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.15 32.0 1 1 1 PRT sp|Q9H582-2|ZN644_HUMAN Isoform 2 of Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 152-UNIMOD:4 0.02 32.0 2 1 0 PRT sp|O43175|SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 18-UNIMOD:4,19-UNIMOD:4 0.08 32.0 3 3 3 PRT sp|Q13404-8|UB2V1_HUMAN Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 43-UNIMOD:35,102-UNIMOD:4 0.34 32.0 2 2 2 PRT sp|P30044-2|PRDX5_HUMAN Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 48-UNIMOD:4 0.10 32.0 2 1 0 PRT sp|P21399|ACOC_HUMAN Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|P04406-2|G3P_HUMAN Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 110-UNIMOD:4,114-UNIMOD:4,205-UNIMOD:4 0.16 32.0 4 3 2 PRT sp|Q15723-4|ELF2_HUMAN Isoform 4 of ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 381-UNIMOD:4 0.04 32.0 1 1 1 PRT sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.08 32.0 1 1 1 PRT sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 208-UNIMOD:35,410-UNIMOD:35 0.08 32.0 4 3 2 PRT sp|Q9Y2W2|WBP11_HUMAN WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 63-UNIMOD:35 0.03 32.0 2 1 0 PRT sp|Q9UJC3-2|HOOK1_HUMAN Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.05 32.0 2 2 2 PRT sp|P05091-2|ALDH2_HUMAN Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 161-UNIMOD:35,375-UNIMOD:35 0.12 32.0 4 4 4 PRT sp|Q9UNZ2-6|NSF1C_HUMAN Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.09 32.0 1 1 1 PRT sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 411-UNIMOD:35,414-UNIMOD:35 0.03 32.0 2 1 0 PRT sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|P56537-2|IF6_HUMAN Isoform 2 of Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 217-UNIMOD:35 0.07 32.0 1 1 1 PRT sp|Q9H3U1-2|UN45A_HUMAN Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 708-UNIMOD:35 0.04 32.0 2 2 2 PRT sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 579-UNIMOD:35,609-UNIMOD:35 0.03 32.0 3 2 1 PRT sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens OX=9606 GN=SGTB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.06 32.0 1 1 1 PRT sp|P46777|RL5_HUMAN 60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 235-UNIMOD:35,236-UNIMOD:35,239-UNIMOD:35 0.05 32.0 2 1 0 PRT sp|Q92900-2|RENT1_HUMAN Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 3 2 1 PRT sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.04 32.0 1 1 1 PRT sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 32.0 null 803-UNIMOD:35,3-UNIMOD:1 0.05 32.0 3 3 3 PRT sp|Q9BVJ6-2|UT14A_HUMAN Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.05 32.0 2 2 2 PRT sp|P53992-2|SC24C_HUMAN Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.09 32.0 2 2 2 PRT sp|Q8ND24-2|RN214_HUMAN Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|P10599-2|THIO_HUMAN Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.16 32.0 1 1 1 PRT sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 0.21 32.0 7 2 1 PRT sp|P06400|RB_HUMAN Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|Q13576-3|IQGA2_HUMAN Isoform 3 of Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 2 2 2 PRT sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.01 32.0 1 1 1 PRT sp|Q16850-2|CP51A_HUMAN Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 246-UNIMOD:4 0.08 32.0 2 2 2 PRT sp|Q9Y2X3|NOP58_HUMAN Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 439-UNIMOD:4,205-UNIMOD:4 0.05 32.0 2 2 2 PRT sp|Q00341-2|VIGLN_HUMAN Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 3 2 1 PRT sp|Q8N806|UBR7_HUMAN Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens OX=9606 GN=UBR7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 260-UNIMOD:4 0.05 32.0 2 1 0 PRT sp|Q9H9B4|SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 0.04 32.0 2 1 0 PRT sp|P61960|UFM1_HUMAN Ubiquitin-fold modifier 1 OS=Homo sapiens OX=9606 GN=UFM1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.19 32.0 1 1 1 PRT sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens OX=9606 GN=PIK3C3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 260-UNIMOD:35,262-UNIMOD:35 0.02 32.0 1 1 1 PRT sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.01 32.0 2 1 0 PRT sp|Q99735-2|MGST2_HUMAN Isoform 2 of Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.19 32.0 1 1 1 PRT sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 335-UNIMOD:4 0.04 32.0 2 2 2 PRT sp|P49821-2|NDUV1_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 116-UNIMOD:4 0.04 32.0 1 1 1 PRT sp|Q8WZA9|IRGQ_HUMAN Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.06 32.0 3 2 1 PRT sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|Q969T4|UB2E3_HUMAN Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens OX=9606 GN=UBE2E3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.07 32.0 1 1 1 PRT sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 32.0 null 874-UNIMOD:4,881-UNIMOD:35,136-UNIMOD:4 0.01 32.0 3 2 1 PRT sp|Q96RG2-4|PASK_HUMAN Isoform 3 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|Q8IY26|PLPP6_HUMAN Phospholipid phosphatase 6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.08 32.0 1 1 1 PRT sp|Q9Y237|PIN4_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 90-UNIMOD:35,106-UNIMOD:35 0.17 32.0 1 1 1 PRT sp|Q15293|RCN1_HUMAN Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.08 32.0 2 2 2 PRT sp|Q15102|PA1B3_HUMAN Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.08 32.0 1 1 1 PRT sp|Q15811-13|ITSN1_HUMAN Isoform 13 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|P11310|ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 149-UNIMOD:35,155-UNIMOD:35,156-UNIMOD:4,159-UNIMOD:4 0.12 32.0 4 3 2 PRT sp|Q9Y639-1|NPTN_HUMAN Isoform 1 of Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 263-UNIMOD:35 0.06 32.0 1 1 1 PRT sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.03 32.0 1 1 1 PRT sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.13 32.0 1 1 1 PRT sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.01 32.0 1 1 1 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 122-UNIMOD:35 0.05 32.0 5 2 0 PRT sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 305-UNIMOD:35 0.06 32.0 4 1 0 PRT sp|O43264|ZW10_HUMAN Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 0.02 32.0 2 1 0 PRT sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 230-UNIMOD:35 0.02 32.0 1 1 0 PRT sp|Q96CW1|AP2M1_HUMAN AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 337-UNIMOD:4,338-UNIMOD:35 0.04 32.0 1 1 1 PRT sp|Q9Y383|LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 0.04 32.0 1 1 0 PRT sp|P35453|HXD13_HUMAN Homeobox protein Hox-D13 OS=Homo sapiens OX=9606 GN=HOXD13 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 168-UNIMOD:35 0.06 32.0 1 1 1 PRT sp|Q96TA1|NIBA2_HUMAN Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 372-UNIMOD:35 0.02 32.0 1 1 1 PRT sp|Q92925|SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 0.04 32.0 1 1 1 PRT sp|Q9BW91|NUDT9_HUMAN ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32.0 null 0.04 32.0 1 1 0 PRT sp|P31350|RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 0.03 31.0 2 1 0 PRT sp|P09417-2|DHPR_HUMAN Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 116-UNIMOD:35,121-UNIMOD:35 0.08 31.0 3 1 0 PRT sp|Q12816-2|TROP_HUMAN Isoform 2 of Trophinin OS=Homo sapiens OX=9606 GN=TRO null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.03 31.0 1 1 1 PRT sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 453-UNIMOD:35,455-UNIMOD:4,464-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|Q14160-2|SCRIB_HUMAN Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 1 1 1 PRT sp|Q16778|H2B2E_HUMAN Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 60-UNIMOD:35,63-UNIMOD:35 0.29 31.0 6 3 1 PRT sp|Q6P996-4|PDXD1_HUMAN Isoform 4 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 385-UNIMOD:35,16-UNIMOD:35 0.06 31.0 3 3 3 PRT sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.08 31.0 2 2 2 PRT sp|Q4AC94|C2CD3_HUMAN C2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=C2CD3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 1 1 1 PRT sp|Q9UI14|PRAF1_HUMAN Prenylated Rab acceptor protein 1 OS=Homo sapiens OX=9606 GN=RABAC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.09 31.0 1 1 1 PRT sp|P63208-2|SKP1_HUMAN Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.08 31.0 1 1 1 PRT sp|P57772-2|SELB_HUMAN Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.03 31.0 1 1 1 PRT sp|Q9NQT5|EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 178-UNIMOD:35,180-UNIMOD:4,184-UNIMOD:4,174-UNIMOD:35 0.05 31.0 4 1 0 PRT sp|Q92576-2|PHF3_HUMAN Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 1223-UNIMOD:35 0.01 31.0 2 1 0 PRT sp|Q8N488|RYBP_HUMAN RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.08 31.0 1 1 1 PRT sp|Q9UL42|PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 328-UNIMOD:35 0.04 31.0 1 1 1 PRT sp|Q9UBT2-2|SAE2_HUMAN Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 256-UNIMOD:35 0.08 31.0 4 3 2 PRT sp|Q15084-3|PDIA6_HUMAN Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.07 31.0 3 2 1 PRT sp|Q9BW27-2|NUP85_HUMAN Isoform 2 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 62-UNIMOD:4 0.03 31.0 1 1 1 PRT sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 630-UNIMOD:35 0.09 31.0 11 5 3 PRT sp|Q9NTX5-5|ECHD1_HUMAN Isoform 5 of Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.11 31.0 2 1 0 PRT sp|P33527-8|MRP1_HUMAN Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 2 1 0 PRT sp|Q9Y4A5-2|TRRAP_HUMAN Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 658-UNIMOD:35 0.00 31.0 1 1 1 PRT sp|Q96G28|CFA36_HUMAN Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 83-UNIMOD:4 0.06 31.0 1 1 1 PRT sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 427-UNIMOD:35,438-UNIMOD:4 0.05 31.0 4 2 1 PRT sp|P50897-2|PPT1_HUMAN Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.08 31.0 1 1 1 PRT sp|Q9BQA1-2|MEP50_HUMAN Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.05 31.0 2 1 0 PRT sp|Q13573|SNW1_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 125-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|Q9NXA8-4|SIR5_HUMAN Isoform 4 of NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.08 31.0 1 1 1 PRT sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.10 31.0 1 1 1 PRT sp|Q96EN8|MOCOS_HUMAN Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 655-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|Q9ULA0-2|DNPEP_HUMAN Isoform 2 of Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.03 31.0 1 1 1 PRT sp|P50990-3|TCPQ_HUMAN Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 171-UNIMOD:4 0.09 31.0 3 3 3 PRT sp|Q9UMZ2-6|SYNRG_HUMAN Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 233-UNIMOD:35 0.03 31.0 2 2 2 PRT sp|Q8IWI9|MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 2 2 2 PRT sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens OX=9606 GN=RAC3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 145-UNIMOD:35 0.08 31.0 3 1 0 PRT sp|Q9UBB4-2|ATX10_HUMAN Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q9Y613|FHOD1_HUMAN FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.02 31.0 2 2 2 PRT sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 145-UNIMOD:35 0.08 31.0 2 1 0 PRT sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.02 31.0 2 2 2 PRT sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 434-UNIMOD:35 0.06 31.0 4 2 1 PRT sp|Q9H3P2|NELFA_HUMAN Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.03 31.0 1 1 1 PRT sp|Q8N4Q1|MIA40_HUMAN Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 0.25 31.0 3 2 1 PRT sp|Q86VM9|ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 0.01 31.0 2 1 0 PRT sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 0.01 31.0 2 2 2 PRT sp|P35998-2|PRS7_HUMAN Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 43-UNIMOD:4 0.04 31.0 2 1 0 PRT sp|O43432-4|IF4G3_HUMAN Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 1 1 1 PRT sp|Q9ULF5-2|S39AA_HUMAN Isoform 2 of Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q5JSZ5-5|PRC2B_HUMAN Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 708-UNIMOD:35,709-UNIMOD:35,719-UNIMOD:4 0.01 31.0 1 1 1 PRT sp|Q16891-3|MIC60_HUMAN Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 649-UNIMOD:4 0.02 31.0 1 1 1 PRT sp|P25440-4|BRD2_HUMAN Isoform 4 of Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 45-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|P61204-2|ARF3_HUMAN Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 97-UNIMOD:35 0.11 31.0 2 1 0 PRT sp|Q9Y6N7-6|ROBO1_HUMAN Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 1 1 1 PRT sp|Q99575|POP1_HUMAN Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 358-UNIMOD:4 0.02 31.0 1 1 1 PRT sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 589-UNIMOD:4 0.03 31.0 2 2 2 PRT sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 0.03 31.0 2 1 0 PRT sp|O60664-4|PLIN3_HUMAN Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 165-UNIMOD:35 0.07 31.0 3 2 1 PRT sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.01 31.0 1 1 1 PRT sp|O75616|ERAL1_HUMAN GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|P41250|GARS_HUMAN Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 292-UNIMOD:35,616-UNIMOD:4,628-UNIMOD:35 0.04 31.0 2 2 2 PRT sp|O60828-5|PQBP1_HUMAN Isoform 5 of Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.10 31.0 1 1 1 PRT sp|Q93009-3|UBP7_HUMAN Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 228-UNIMOD:35,229-UNIMOD:35 0.04 31.0 4 3 2 PRT sp|Q96D71-2|REPS1_HUMAN Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.02 31.0 1 1 1 PRT sp|Q8N0X4-2|CLYBL_HUMAN Isoform 2 of Citramalyl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=CLYBL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|P27816-6|MAP4_HUMAN Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 478-UNIMOD:35,292-UNIMOD:35,300-UNIMOD:35,741-UNIMOD:35,514-UNIMOD:35,450-UNIMOD:35,506-UNIMOD:35,296-UNIMOD:35,306-UNIMOD:35 0.13 31.0 13 10 5 PRT sp|P20020-5|AT2B1_HUMAN Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 640-UNIMOD:35 0.01 31.0 1 1 1 PRT sp|Q8N3R9-2|MPP5_HUMAN Isoform 2 of MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 198-UNIMOD:35 0.02 31.0 1 1 1 PRT sp|O14929-2|HAT1_HUMAN Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 16-UNIMOD:4 0.09 31.0 2 2 2 PRT sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.02 31.0 1 1 1 PRT sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|P62195-2|PRS8_HUMAN Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 142-UNIMOD:35,104-UNIMOD:4 0.10 31.0 5 3 1 PRT sp|Q9H1E3|NUCKS_HUMAN Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.14 31.0 2 2 2 PRT sp|Q6GMV3|PTRD1_HUMAN Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.09 31.0 1 1 1 PRT sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 760-UNIMOD:35,761-UNIMOD:4 0.03 31.0 2 2 2 PRT sp|P62753|RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 1-UNIMOD:35,12-UNIMOD:4 0.11 31.0 6 2 0 PRT sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 10-UNIMOD:4,13-UNIMOD:4 0.07 31.0 1 1 1 PRT sp|Q13509|TBB3_HUMAN Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 330-UNIMOD:35 0.06 31.0 2 2 2 PRT sp|Q15181|IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 270-UNIMOD:4,274-UNIMOD:4 0.08 31.0 1 1 1 PRT sp|Q05519-2|SRS11_HUMAN Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.07 31.0 3 2 1 PRT sp|Q16630-3|CPSF6_HUMAN Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 53-UNIMOD:35 0.04 31.0 3 1 0 PRT sp|Q96G46-2|DUS3L_HUMAN Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|P55210-4|CASP7_HUMAN Isoform 4 of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.09 31.0 1 1 1 PRT sp|O95219|SNX4_HUMAN Sorting nexin-4 OS=Homo sapiens OX=9606 GN=SNX4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.05 31.0 1 1 1 PRT sp|Q5SW79-2|CE170_HUMAN Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 790-UNIMOD:35 0.01 31.0 1 1 1 PRT sp|P50395-2|GDIB_HUMAN Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 157-UNIMOD:4,66-UNIMOD:35 0.07 31.0 3 2 1 PRT sp|Q9BU61-2|NDUF3_HUMAN Isoform b of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Homo sapiens OX=9606 GN=NDUFAF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.20 31.0 1 1 1 PRT sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 38-UNIMOD:35 0.03 31.0 5 1 0 PRT sp|P14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 260-UNIMOD:4,261-UNIMOD:4,460-UNIMOD:35,472-UNIMOD:4 0.11 31.0 3 3 2 PRT sp|P49589|SYCC_HUMAN Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 227-UNIMOD:35 0.04 31.0 2 2 0 PRT sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 31.0 null 33-UNIMOD:4 0.10 31.0 3 2 1 PRT sp|Q02880|TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 964-UNIMOD:35 0.01 31.0 2 1 0 PRT sp|Q9UNF1|MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 0.04 31.0 1 1 1 PRT sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 281-UNIMOD:4 0.05 31.0 2 2 1 PRT sp|Q9BY77|PDIP3_HUMAN Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 31.0 null 0.04 31.0 2 1 0 PRT sp|Q15398|DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 281-UNIMOD:35 0.03 31.0 1 1 1 PRT sp|P36871|PGM1_HUMAN Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.06 30.0 2 2 2 PRT sp|P30419-2|NMT1_HUMAN Isoform Short of Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|Q5VT25-3|MRCKA_HUMAN Isoform 3 of Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 968-UNIMOD:4 0.01 30.0 1 1 1 PRT sp|Q9H8Y5|ANKZ1_HUMAN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKZF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 610-UNIMOD:35 0.02 30.0 1 1 1 PRT sp|Q9NQX7-2|ITM2C_HUMAN Isoform 2 of Integral membrane protein 2C OS=Homo sapiens OX=9606 GN=ITM2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.10 30.0 1 1 1 PRT sp|Q9UIF9-2|BAZ2A_HUMAN Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 0 PRT sp|Q14118|DAG1_HUMAN Dystroglycan OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 713-UNIMOD:4 0.02 30.0 1 1 1 PRT sp|Q9UGM6|SYWM_HUMAN Tryptophan--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=WARS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.05 30.0 1 1 1 PRT sp|Q9UNW1-4|MINP1_HUMAN Isoform 4 of Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 268-UNIMOD:4,274-UNIMOD:4 0.06 30.0 1 1 1 PRT sp|O43852-10|CALU_HUMAN Isoform 10 of Calumenin OS=Homo sapiens OX=9606 GN=CALU null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 197-UNIMOD:35 0.12 30.0 3 2 1 PRT sp|Q9H8M5-3|CNNM2_HUMAN Isoform 3 of Metal transporter CNNM2 OS=Homo sapiens OX=9606 GN=CNNM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 508-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|Q99661-2|KIF2C_HUMAN Isoform 2 of Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|O43663|PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q5T3J3|LRIF1_HUMAN Ligand-dependent nuclear receptor-interacting factor 1 OS=Homo sapiens OX=9606 GN=LRIF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.00 30.0 1 1 1 PRT sp|Q6PCB5-2|RSBNL_HUMAN Isoform 2 of Lysine-specific demethylase RSBN1L OS=Homo sapiens OX=9606 GN=RSBN1L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 548-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|Q96GA3|LTV1_HUMAN Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.05 30.0 2 2 2 PRT sp|Q16543|CDC37_HUMAN Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 316-UNIMOD:35 0.08 30.0 3 2 1 PRT sp|Q8NB90-3|AFG2H_HUMAN Isoform 3 of ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|P00533-4|EGFR_HUMAN Isoform 4 of Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|O43237-2|DC1L2_HUMAN Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 287-UNIMOD:35 0.08 30.0 2 2 2 PRT sp|Q9GZR7-2|DDX24_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|P15336-3|ATF2_HUMAN Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.08 30.0 1 1 1 PRT sp|Q96KN1|LRAT2_HUMAN Protein LRATD2 OS=Homo sapiens OX=9606 GN=LRATD2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|Q9H6R4-2|NOL6_HUMAN Isoform 2 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 815-UNIMOD:35 0.01 30.0 2 1 0 PRT sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 87-UNIMOD:35 0.06 30.0 4 3 0 PRT sp|Q03001-8|DYST_HUMAN Isoform 2 of Dystonin OS=Homo sapiens OX=9606 GN=DST null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 1813-UNIMOD:35 0.01 30.0 2 2 2 PRT sp|P15121|ALDR_HUMAN Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.09 30.0 2 2 2 PRT sp|Q86YP4-2|P66A_HUMAN Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 244-UNIMOD:35 0.08 30.0 3 2 1 PRT sp|Q6IE81-3|JADE1_HUMAN Isoform 3 of Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|Q8N556|AFAP1_HUMAN Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q9UBC2-3|EP15R_HUMAN Isoform 3 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|Q16204|CCDC6_HUMAN Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 2 1 0 PRT sp|Q12906-5|ILF3_HUMAN Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 407-UNIMOD:35,465-UNIMOD:35,403-UNIMOD:35 0.09 30.0 6 4 2 PRT sp|Q13099-3|IFT88_HUMAN Isoform 3 of Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|P15880|RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 215-UNIMOD:35,216-UNIMOD:35,222-UNIMOD:4 0.05 30.0 2 1 0 PRT sp|O75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 0.05 30.0 2 1 0 PRT sp|P51572|BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 241-UNIMOD:35 0.05 30.0 4 2 1 PRT sp|Q02241-3|KIF23_HUMAN Isoform 3 of Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|P05165-3|PCCA_HUMAN Isoform 3 of Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 105-UNIMOD:35,111-UNIMOD:4 0.02 30.0 1 1 0 PRT sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 183-UNIMOD:35,192-UNIMOD:35 0.03 30.0 2 1 0 PRT sp|Q9Y2R5|RT17_HUMAN 28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 100-UNIMOD:4 0.17 30.0 1 1 1 PRT sp|P48556|PSMD8_HUMAN 26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 0.04 30.0 2 1 0 PRT sp|P35613-3|BASI_HUMAN Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.10 30.0 1 1 1 PRT sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 236-UNIMOD:35 0.06 30.0 4 1 0 PRT sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 149-UNIMOD:35 0.02 30.0 2 2 2 PRT sp|P49790-2|NU153_HUMAN Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 467-UNIMOD:35,686-UNIMOD:4,689-UNIMOD:4 0.02 30.0 3 2 1 PRT sp|P00918|CAH2_HUMAN Carbonic anhydrase 2 OS=Homo sapiens OX=9606 GN=CA2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.10 30.0 2 2 2 PRT sp|Q9NVM9-2|INT13_HUMAN Isoform 2 of Integrator complex subunit 13 OS=Homo sapiens OX=9606 GN=INTS13 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 537-UNIMOD:35 0.04 30.0 2 2 2 PRT sp|O60488-2|ACSL4_HUMAN Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 330-UNIMOD:35,337-UNIMOD:35 0.02 30.0 3 1 0 PRT sp|Q15813|TBCE_HUMAN Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 120-UNIMOD:35 0.02 30.0 2 1 0 PRT sp|P12532|KCRU_HUMAN Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 240-UNIMOD:35 0.03 30.0 1 1 1 PRT sp|Q8WXH0|SYNE2_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 6054-UNIMOD:4 0.01 30.0 3 3 3 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 30.0 null 0.05 30.0 5 4 3 PRT sp|Q12846-2|STX4_HUMAN Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.06 30.0 1 1 0 PRT sp|P52564-2|MP2K6_HUMAN Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.05 30.0 1 1 1 PRT sp|Q9H4A6|GOLP3_HUMAN Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.05 30.0 1 1 1 PRT sp|Q9Y6B7|AP4B1_HUMAN AP-4 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP4B1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|P67775-2|PP2AA_HUMAN Isoform 2 of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 83-UNIMOD:35 0.06 30.0 1 1 1 PRT sp|Q8TC76|F110B_HUMAN Protein FAM110B OS=Homo sapiens OX=9606 GN=FAM110B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 248-UNIMOD:4 0.04 30.0 1 1 1 PRT sp|Q14966-5|ZN638_HUMAN Isoform 5 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|Q7LGA3-3|HS2ST_HUMAN Isoform 3 of Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 201-UNIMOD:4,209-UNIMOD:4 0.08 30.0 1 1 1 PRT sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q8TAQ2-2|SMRC2_HUMAN Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 318-UNIMOD:4 0.04 30.0 2 1 0 PRT sp|P07954-2|FUMH_HUMAN Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|Q13185|CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.08 30.0 1 1 1 PRT sp|Q15032-2|R3HD1_HUMAN Isoform 2 of R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|Q7KZI7-10|MARK2_HUMAN Isoform 10 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|P49189-2|AL9A1_HUMAN Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 168-UNIMOD:35 0.03 30.0 1 1 1 PRT sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 199-UNIMOD:35 0.02 30.0 1 1 1 PRT sp|Q9NYB0|TE2IP_HUMAN Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|P62249|RS16_HUMAN 40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.10 30.0 3 1 0 PRT sp|Q8NC44|RETR2_HUMAN Reticulophagy regulator 2 OS=Homo sapiens OX=9606 GN=RETREG2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|Q9Y285-2|SYFA_HUMAN Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 259-UNIMOD:35 0.03 30.0 2 1 0 PRT sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 1110-UNIMOD:35 0.03 30.0 4 3 2 PRT sp|Q13347|EIF3I_HUMAN Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 140-UNIMOD:35 0.04 30.0 1 1 1 PRT sp|Q9BY89|K1671_HUMAN Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.01 30.0 1 1 1 PRT sp|Q14676-3|MDC1_HUMAN Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 1037-UNIMOD:4,59-UNIMOD:35,62-UNIMOD:4 0.02 30.0 3 2 1 PRT sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.09 30.0 1 1 1 PRT sp|P36578|RL4_HUMAN 60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.04 30.0 1 1 1 PRT sp|Q07812-5|BAX_HUMAN Isoform Epsilon of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 38-UNIMOD:35 0.13 30.0 1 1 1 PRT sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 187-UNIMOD:35,208-UNIMOD:35,210-UNIMOD:35 0.03 30.0 3 2 1 PRT sp|Q8WXI9|P66B_HUMAN Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 292-UNIMOD:35,308-UNIMOD:4 0.04 30.0 1 1 1 PRT sp|P24928-2|RPB1_HUMAN Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 1 1 1 PRT sp|P22314-2|UBA1_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.03 30.0 2 2 2 PRT sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 1886-UNIMOD:4,1895-UNIMOD:4 0.01 30.0 1 1 1 PRT sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 0.09 30.0 7 3 1 PRT sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 0.02 30.0 1 1 0 PRT sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 140-UNIMOD:35 0.03 30.0 1 1 0 PRT sp|Q15819|UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 88-UNIMOD:35,97-UNIMOD:35 0.21 30.0 2 2 2 PRT sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 353-UNIMOD:35 0.02 30.0 1 1 1 PRT sp|P35659|DEK_HUMAN Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 343-UNIMOD:35 0.04 30.0 1 1 1 PRT sp|P00367|DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 0.03 30.0 1 1 0 PRT sp|Q9NTI5|PDS5B_HUMAN Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 571-UNIMOD:4,573-UNIMOD:4 0.01 30.0 1 1 1 PRT sp|Q6IQ49|SDE2_HUMAN Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 0.03 30.0 1 1 0 PRT sp|P30520|PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 58-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|P43686|PRS6B_HUMAN 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 163-UNIMOD:35,170-UNIMOD:35 0.04 30.0 1 1 0 PRT sp|Q9H2J7|S6A15_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 0.02 30.0 1 1 1 PRT sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 95-UNIMOD:35 0.03 30.0 1 1 1 PRT sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30.0 null 0.04 30.0 1 1 0 PRT sp|P20810-4|ICAL_HUMAN Isoform 4 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 367-UNIMOD:4,287-UNIMOD:4 0.08 29.0 4 4 4 PRT sp|P19404|NDUV2_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 110-UNIMOD:35 0.10 29.0 7 2 1 PRT sp|O43524-2|FOXO3_HUMAN Isoform 2 of Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.04 29.0 1 1 1 PRT sp|O75152|ZC11A_HUMAN Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 5 4 3 PRT sp|P16615-5|AT2A2_HUMAN Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 719-UNIMOD:35,361-UNIMOD:35,364-UNIMOD:4,447-UNIMOD:4 0.05 29.0 3 3 3 PRT sp|Q13554-7|KCC2B_HUMAN Isoform 7 of Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.04 29.0 1 1 1 PRT sp|Q86UV5-4|UBP48_HUMAN Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|Q15020-4|SART3_HUMAN Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 861-UNIMOD:35 0.05 29.0 2 2 2 PRT sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.08 29.0 1 1 1 PRT sp|Q9BQ52-3|RNZ2_HUMAN Isoform 3 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 237-UNIMOD:4 0.04 29.0 1 1 1 PRT sp|P13591-6|NCAM1_HUMAN Isoform 6 of Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 96-UNIMOD:4 0.05 29.0 1 1 1 PRT sp|P46199|IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|Q96MW1|CCD43_HUMAN Coiled-coil domain-containing protein 43 OS=Homo sapiens OX=9606 GN=CCDC43 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 156-UNIMOD:35 0.07 29.0 1 1 1 PRT sp|Q14CX7-2|NAA25_HUMAN Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 381-UNIMOD:4 0.03 29.0 2 2 2 PRT sp|P46020-3|KPB1_HUMAN Isoform 3 of Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 1113-UNIMOD:4 0.02 29.0 1 1 0 PRT sp|Q7RTP6-2|MICA3_HUMAN Isoform 2 of [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 1212-UNIMOD:35 0.01 29.0 2 1 0 PRT sp|P23378|GCSP_HUMAN Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|Q9BV44|THUM3_HUMAN THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 208-UNIMOD:4 0.03 29.0 1 1 1 PRT sp|Q9NR30-2|DDX21_HUMAN Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.04 29.0 1 1 1 PRT sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 377-UNIMOD:35,368-UNIMOD:35 0.03 29.0 2 1 0 PRT sp|Q9NX55|HYPK_HUMAN Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 64-UNIMOD:35 0.14 29.0 1 1 1 PRT sp|P20674|COX5A_HUMAN Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 82-UNIMOD:35 0.19 29.0 2 2 2 PRT sp|O75436-2|VP26A_HUMAN Isoform 2 of Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 0 PRT sp|Q9UHB7-2|AFF4_HUMAN Isoform 2 of AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 2 1 0 PRT sp|Q5H9R7-3|PP6R3_HUMAN Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 37-UNIMOD:4,756-UNIMOD:4,28-UNIMOD:35 0.03 29.0 3 2 1 PRT sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|Q6FI81-3|CPIN1_HUMAN Isoform 3 of Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.04 29.0 1 1 0 PRT sp|Q14746-2|COG2_HUMAN Isoform 2 of Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.03 29.0 2 1 0 PRT sp|Q8N183|NDUF2_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.10 29.0 1 1 1 PRT sp|Q9UNF1-2|MAGD2_HUMAN Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|P62304|RUXE_HUMAN Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.15 29.0 1 1 1 PRT sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 0.04 29.0 2 1 0 PRT sp|P62910|RL32_HUMAN 60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.11 29.0 1 1 1 PRT sp|P48637-2|GSHB_HUMAN Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 298-UNIMOD:4 0.04 29.0 1 1 1 PRT sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PIK3R4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 862-UNIMOD:35,871-UNIMOD:35 0.02 29.0 2 2 2 PRT sp|Q92890-3|UFD1_HUMAN Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 48-UNIMOD:35 0.05 29.0 2 1 0 PRT sp|P42696-2|RBM34_HUMAN Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 196-UNIMOD:4 0.12 29.0 2 2 2 PRT sp|Q9H6U6-6|BCAS3_HUMAN Isoform 6 of Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 402-UNIMOD:35,403-UNIMOD:35 0.02 29.0 1 1 1 PRT sp|Q9NWU5|RM22_HUMAN 39S ribosomal protein L22, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL22 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 29.0 null 0.06 29.0 4 1 0 PRT sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 2 2 2 PRT sp|O95218-2|ZRAB2_HUMAN Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|Q6PI78|TMM65_HUMAN Transmembrane protein 65 OS=Homo sapiens OX=9606 GN=TMEM65 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 219-UNIMOD:35 0.07 29.0 1 1 1 PRT sp|Q96EA4-2|SPDLY_HUMAN Isoform 2 of Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|O15047|SET1A_HUMAN Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|O14561|ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 139-UNIMOD:35,140-UNIMOD:4 0.10 29.0 1 1 1 PRT sp|P21796|VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|Q5VV42-2|CDKAL_HUMAN Isoform 2 of Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 217-UNIMOD:35,68-UNIMOD:4 0.06 29.0 2 2 1 PRT sp|Q01469|FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 120-UNIMOD:4,122-UNIMOD:35,127-UNIMOD:4 0.11 29.0 1 1 1 PRT sp|Q99816|TS101_HUMAN Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 305-UNIMOD:35 0.06 29.0 1 1 1 PRT sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 518-UNIMOD:35 0.03 29.0 1 1 1 PRT sp|P13797-3|PLST_HUMAN Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 124-UNIMOD:35,98-UNIMOD:4,220-UNIMOD:35,122-UNIMOD:4 0.08 29.0 6 4 3 PRT sp|Q13416|ORC2_HUMAN Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|P17301|ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|Q12872|SFSWA_HUMAN Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 1 1 1 PRT sp|P53597|SUCA_HUMAN Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|Q9H223|EHD4_HUMAN EH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=EHD4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|Q86SZ2-2|TPC6B_HUMAN Isoform 2 of Trafficking protein particle complex subunit 6B OS=Homo sapiens OX=9606 GN=TRAPPC6B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 118-UNIMOD:35,121-UNIMOD:4 0.12 29.0 1 1 0 PRT sp|Q14C86-3|GAPD1_HUMAN Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 457-UNIMOD:35 0.02 29.0 1 1 1 PRT sp|O60763|USO1_HUMAN General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|Q9UM54-6|MYO6_HUMAN Isoform 6 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|Q9Y3D3|RT16_HUMAN 28S ribosomal protein S16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS16 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.11 29.0 1 1 1 PRT sp|O95347-2|SMC2_HUMAN Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|Q9UHY1|NRBP_HUMAN Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 29.0 null 0.02 29.0 2 1 0 PRT sp|Q15054-3|DPOD3_HUMAN Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 292-UNIMOD:4 0.04 29.0 2 1 0 PRT sp|Q9BUR5-2|MIC26_HUMAN Isoform 2 of MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.09 29.0 1 1 1 PRT sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 2 2 2 PRT sp|Q9BRP8-2|PYM1_HUMAN Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.09 29.0 1 1 1 PRT sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.02 29.0 1 1 1 PRT sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 2 2 2 PRT sp|P31946-2|1433B_HUMAN Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.05 29.0 1 1 1 PRT sp|Q00403|TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 32-UNIMOD:35,34-UNIMOD:4,37-UNIMOD:4 0.05 29.0 1 1 1 PRT sp|P04350|TBB4A_HUMAN Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 73-UNIMOD:35,330-UNIMOD:35,257-UNIMOD:35 0.09 29.0 7 3 1 PRT sp|Q96SI9-2|STRBP_HUMAN Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 284-UNIMOD:35,314-UNIMOD:35 0.05 29.0 5 3 1 PRT sp|P31939-2|PUR9_HUMAN Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 59-UNIMOD:35 0.07 29.0 3 3 3 PRT sp|P14868-2|SYDC_HUMAN Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 262-UNIMOD:35 0.05 29.0 1 1 1 PRT sp|Q6P4F2|FDX2_HUMAN Ferredoxin-2, mitochondrial OS=Homo sapiens OX=9606 GN=FDX2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 139-UNIMOD:35,142-UNIMOD:35 0.09 29.0 1 1 1 PRT sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.03 29.0 1 1 1 PRT sp|Q9H330-4|TM245_HUMAN Isoform 4 of Transmembrane protein 245 OS=Homo sapiens OX=9606 GN=TMEM245 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 1 1 1 PRT sp|O95139|NDUB6_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 120-UNIMOD:35 0.15 29.0 1 1 1 PRT sp|A1L0T0|HACL2_HUMAN 2-hydroxyacyl-CoA lyase 2 OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 288-UNIMOD:35 0.03 29.0 1 1 1 PRT sp|Q9C0D3|ZY11B_HUMAN Protein zyg-11 homolog B OS=Homo sapiens OX=9606 GN=ZYG11B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 43-UNIMOD:4 0.03 29.0 1 1 1 PRT sp|Q96TA2-3|YMEL1_HUMAN Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 243-UNIMOD:35 0.04 29.0 2 2 2 PRT sp|Q9P015|RM15_HUMAN 39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 0.06 29.0 1 1 1 PRT sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 160-UNIMOD:35 0.02 29.0 1 1 1 PRT sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 0.03 29.0 1 1 0 PRT sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 20-UNIMOD:4,27-UNIMOD:4 0.01 29.0 1 1 1 PRT sp|P61923|COPZ1_HUMAN Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 0.07 29.0 2 1 0 PRT sp|Q9UNS2|CSN3_HUMAN COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 393-UNIMOD:35 0.04 29.0 1 1 0 PRT sp|P57740|NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 29.0 null 0.01 29.0 1 1 1 PRT sp|O00273-2|DFFA_HUMAN Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.06 28.0 1 1 1 PRT sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 2 1 0 PRT sp|P56945-4|BCAR1_HUMAN Isoform 4 of Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9Y5V3|MAGD1_HUMAN Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.10 28.0 1 1 1 PRT sp|Q14766-3|LTBP1_HUMAN Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 1049-UNIMOD:4,1057-UNIMOD:4 0.01 28.0 1 1 1 PRT sp|P0DP25|CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.15 28.0 2 2 2 PRT sp|Q96PV7-2|F193B_HUMAN Isoform 2 of Protein FAM193B OS=Homo sapiens OX=9606 GN=FAM193B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 400-UNIMOD:35,405-UNIMOD:35 0.03 28.0 1 1 1 PRT sp|Q5ST30|SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 408-UNIMOD:4 0.03 28.0 1 1 1 PRT sp|Q96L91-4|EP400_HUMAN Isoform 4 of E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 951-UNIMOD:35 0.00 28.0 1 1 0 PRT sp|Q8IZH2-2|XRN1_HUMAN Isoform 2 of 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 229-UNIMOD:4 0.12 28.0 5 3 2 PRT sp|P12956-2|XRCC6_HUMAN Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 412-UNIMOD:35 0.04 28.0 7 2 1 PRT sp|O75400-2|PR40A_HUMAN Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q96ME7-2|ZN512_HUMAN Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.05 28.0 2 2 1 PRT sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.07 28.0 1 1 1 PRT sp|P28370-2|SMCA1_HUMAN Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9HCE1-2|MOV10_HUMAN Isoform 2 of Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 0 PRT sp|Q08623-3|HDHD1_HUMAN Isoform 3 of Pseudouridine-5'-phosphatase OS=Homo sapiens OX=9606 GN=PUDP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 92-UNIMOD:35 0.07 28.0 2 1 0 PRT sp|P22234|PUR6_HUMAN Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 244-UNIMOD:35 0.03 28.0 2 1 0 PRT sp|P62750|RL23A_HUMAN 60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 87-UNIMOD:35 0.07 28.0 2 1 0 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 1 1 1 PRT sp|P43250-3|GRK6_HUMAN Isoform GRK6C of G protein-coupled receptor kinase 6 OS=Homo sapiens OX=9606 GN=GRK6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|Q8WX93-7|PALLD_HUMAN Isoform 7 of Palladin OS=Homo sapiens OX=9606 GN=PALLD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 18-UNIMOD:35,24-UNIMOD:4 0.03 28.0 1 1 1 PRT sp|Q7Z3J3|RGPD4_HUMAN RanBP2-like and GRIP domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RGPD4 PE=2 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|P26373-2|RL13_HUMAN Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 108-UNIMOD:35,8-UNIMOD:35 0.20 28.0 4 3 2 PRT sp|Q15003-2|CND2_HUMAN Isoform 2 of Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9H7B4-3|SMYD3_HUMAN Isoform 3 of Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 54-UNIMOD:35 0.03 28.0 1 1 1 PRT sp|Q96IZ5-2|RBM41_HUMAN Isoform 2 of RNA-binding protein 41 OS=Homo sapiens OX=9606 GN=RBM41 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 1 1 1 PRT sp|P54819-4|KAD2_HUMAN Isoform 4 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 30-UNIMOD:35,44-UNIMOD:4 0.17 28.0 2 2 2 PRT sp|P60842-2|IF4A1_HUMAN Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 178-UNIMOD:35,187-UNIMOD:35,216-UNIMOD:35 0.17 28.0 8 4 3 PRT sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens OX=9606 GN=HSD17B11 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.06 28.0 1 1 1 PRT sp|Q06787-11|FMR1_HUMAN Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 333-UNIMOD:35 0.04 28.0 1 1 1 PRT sp|P54886-2|P5CS_HUMAN Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 367-UNIMOD:35,151-UNIMOD:35 0.03 28.0 3 2 1 PRT sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|O75319-2|DUS11_HUMAN Isoform 2 of RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.05 28.0 1 1 1 PRT sp|Q9P2B4|CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 2 2 2 PRT sp|Q8IY22|CMIP_HUMAN C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 0.02 28.0 2 1 0 PRT sp|Q9UN36-4|NDRG2_HUMAN Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 1 1 1 PRT sp|P01023|A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|Q9NUJ3|T11L1_HUMAN T-complex protein 11-like protein 1 OS=Homo sapiens OX=9606 GN=TCP11L1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|Q9Y4U1|MMAC_HUMAN Cyanocobalamin reductase / alkylcobalamin dealkylase OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.06 28.0 1 1 1 PRT sp|Q9BW91-2|NUDT9_HUMAN Isoform 2 of ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.05 28.0 1 1 0 PRT sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 21-UNIMOD:35,100-UNIMOD:35 0.15 28.0 3 2 1 PRT sp|P35221|CTNA1_HUMAN Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q96JC1-2|VPS39_HUMAN Isoform 2 of Vam6/Vps39-like protein OS=Homo sapiens OX=9606 GN=VPS39 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|P18754|RCC1_HUMAN Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 163-UNIMOD:35,93-UNIMOD:4 0.08 28.0 2 2 2 PRT sp|O00499-9|BIN1_HUMAN Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 1 1 1 PRT sp|P48047|ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 185-UNIMOD:35 0.06 28.0 2 1 0 PRT sp|Q8NFC6|BD1L1_HUMAN Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 2 2 2 PRT sp|Q8IY81|SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 583-UNIMOD:35 0.02 28.0 3 1 0 PRT sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.00 28.0 1 1 1 PRT sp|Q9UKZ1|CNO11_HUMAN CCR4-NOT transcription complex subunit 11 OS=Homo sapiens OX=9606 GN=CNOT11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|Q13596|SNX1_HUMAN Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 353-UNIMOD:35 0.06 28.0 2 2 2 PRT sp|Q9Y5V0|ZN706_HUMAN Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 41-UNIMOD:4,44-UNIMOD:4 0.34 28.0 4 2 1 PRT sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 466-UNIMOD:35 0.04 28.0 2 2 2 PRT sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 6-UNIMOD:35 0.06 28.0 2 2 2 PRT sp|Q14686|NCOA6_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|Q14684-2|RRP1B_HUMAN Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 2 2 2 PRT sp|Q6VMQ6-2|MCAF1_HUMAN Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q7Z2T5|TRM1L_HUMAN TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 85-UNIMOD:35 0.13 28.0 1 1 1 PRT sp|Q96C57|CSTOS_HUMAN Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 215-UNIMOD:35 0.08 28.0 1 1 1 PRT sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 0.02 28.0 3 2 1 PRT sp|P00492|HPRT_HUMAN Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.12 28.0 2 2 2 PRT sp|Q9UHD8-3|SEPT9_HUMAN Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 422-UNIMOD:35 0.09 28.0 3 3 2 PRT sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 0.09 28.0 2 2 2 PRT sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 115-UNIMOD:35 0.07 28.0 1 1 1 PRT sp|O60306|AQR_HUMAN RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 244-UNIMOD:35 0.02 28.0 2 2 2 PRT sp|O00217|NDUS8_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 28.0 null 41-UNIMOD:35,46-UNIMOD:35,48-UNIMOD:35,117-UNIMOD:4,121-UNIMOD:4 0.15 28.0 2 2 2 PRT sp|P30085-2|KCY_HUMAN Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 1-UNIMOD:35 0.11 28.0 1 1 1 PRT sp|O15371-2|EIF3D_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 131-UNIMOD:35 0.08 28.0 2 2 1 PRT sp|P35250-2|RFC2_HUMAN Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.06 28.0 1 1 1 PRT sp|Q5JTZ9|SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q8NCF5|NF2IP_HUMAN NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.04 28.0 1 1 1 PRT sp|Q8N6R0-1|EFNMT_HUMAN Isoform 4 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.03 28.0 1 1 1 PRT sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 2 2 2 PRT sp|Q9UPN7|PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.02 28.0 1 1 1 PRT sp|Q9UHR6|ZNHI2_HUMAN Zinc finger HIT domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZNHIT2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 28.0 null 188-UNIMOD:4 0.11 28.0 2 2 2 PRT sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 327-UNIMOD:35 0.03 28.0 14 1 0 PRT sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|P23921|RIR1_HUMAN Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 662-UNIMOD:4 0.06 28.0 3 3 3 PRT sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 0.04 28.0 1 1 0 PRT sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 0.02 28.0 2 2 1 PRT sp|P42695|CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|O60271|JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 0.01 28.0 1 1 1 PRT sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28.0 null 549-UNIMOD:35,918-UNIMOD:35 0.01 28.0 2 2 1 PRT sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 2 1 0 PRT sp|Q9H8Y8-2|GORS2_HUMAN Isoform 2 of Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.05 27.0 1 1 1 PRT sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=HEATR6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|P30049|ATPD_HUMAN ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.09 27.0 1 1 1 PRT sp|Q9BQC3-3|DPH2_HUMAN Isoform 3 of 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|Q9BT78-2|CSN4_HUMAN Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|Q15006|EMC2_HUMAN ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 288-UNIMOD:35 0.05 27.0 1 1 1 PRT sp|Q7Z7C8|TAF8_HUMAN Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|O95433-2|AHSA1_HUMAN Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 136-UNIMOD:35 0.09 27.0 4 2 1 PRT sp|P11717|MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 3 3 3 PRT sp|P07355|ANXA2_HUMAN Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|Q5FBB7-5|SGO1_HUMAN Isoform 5 of Shugoshin 1 OS=Homo sapiens OX=9606 GN=SGO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.05 27.0 1 1 1 PRT sp|Q96PC5-6|MIA2_HUMAN Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P31483-3|TIA1_HUMAN Isoform 3 of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.06 27.0 1 1 1 PRT sp|P06280|AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q92665|RT31_HUMAN 28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.05 27.0 1 1 1 PRT sp|O94788-4|AL1A2_HUMAN Isoform 4 of Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q9P0U3-2|SENP1_HUMAN Isoform 2 of Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P16219|ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|O95817|BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P54198-2|HIRA_HUMAN Isoform Short of Protein HIRA OS=Homo sapiens OX=9606 GN=HIRA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|O75420|GGYF1_HUMAN GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|P42684-4|ABL2_HUMAN Isoform 4 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P55011-3|S12A2_HUMAN Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 2 2 2 PRT sp|Q6Y7W6-4|GGYF2_HUMAN Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 317-UNIMOD:35 0.01 27.0 1 1 1 PRT sp|P30622-2|CLIP1_HUMAN Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 4 2 1 PRT sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.06 27.0 1 1 1 PRT sp|O94832|MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|P35637-2|FUS_HUMAN Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 320-UNIMOD:35 0.05 27.0 2 2 0 PRT sp|P48382-2|RFX5_HUMAN Isoform 2 of DNA-binding protein RFX5 OS=Homo sapiens OX=9606 GN=RFX5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 148-UNIMOD:35 0.03 27.0 1 1 1 PRT sp|P15927|RFA2_HUMAN Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 97-UNIMOD:35,102-UNIMOD:35 0.05 27.0 5 1 0 PRT sp|P24666-3|PPAC_HUMAN Isoform 3 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.10 27.0 1 1 1 PRT sp|P46109|CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|Q12905|ILF2_HUMAN Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.07 27.0 3 2 1 PRT sp|P30414|NKTR_HUMAN NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|Q5VW32-2|BROX_HUMAN Isoform 2 of BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q7Z5G4-3|GOGA7_HUMAN Isoform 2 of Golgin subfamily A member 7 OS=Homo sapiens OX=9606 GN=GOLGA7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.12 27.0 1 1 1 PRT sp|Q13435|SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 0.03 27.0 4 2 1 PRT sp|Q9Y2T4-3|2ABG_HUMAN Isoform 3 of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q99714-2|HCD2_HUMAN Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 58-UNIMOD:4,178-UNIMOD:35 0.12 27.0 2 2 2 PRT sp|P61421|VA0D1_HUMAN V-type proton ATPase subunit d 1 OS=Homo sapiens OX=9606 GN=ATP6V0D1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 354-UNIMOD:35 0.04 27.0 2 2 2 PRT sp|Q14669-4|TRIPC_HUMAN Isoform 4 of E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 1704-UNIMOD:35 0.01 27.0 1 1 1 PRT sp|Q5VWN6-2|TASO2_HUMAN Isoform 2 of Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 1 PRT sp|Q9Y224|RTRAF_HUMAN RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 0.11 27.0 3 2 1 PRT sp|P0DPI2|GAL3A_HUMAN Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 176-UNIMOD:4,177-UNIMOD:4 0.06 27.0 1 1 1 PRT sp|Q969U7-2|PSMG2_HUMAN Isoform 2 of Proteasome assembly chaperone 2 OS=Homo sapiens OX=9606 GN=PSMG2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.06 27.0 1 1 1 PRT sp|Q9Y2I7-2|FYV1_HUMAN Isoform 2 of 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 0 PRT sp|P09936|UCHL1_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 6-UNIMOD:35,12-UNIMOD:35 0.10 27.0 3 2 1 PRT sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 230-UNIMOD:35 0.05 27.0 1 1 1 PRT sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens OX=9606 GN=ARL8B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.08 27.0 1 1 1 PRT sp|Q9H074|PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 125-UNIMOD:35 0.05 27.0 4 2 1 PRT sp|Q8TEM1-2|PO210_HUMAN Isoform 2 of Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.04 27.0 2 2 2 PRT sp|P50748|KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 2198-UNIMOD:4 0.01 27.0 2 1 0 PRT sp|P82664|RT10_HUMAN 28S ribosomal protein S10, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.07 27.0 1 1 1 PRT sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens OX=9606 GN=ARF5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 134-UNIMOD:35,130-UNIMOD:35 0.09 27.0 2 1 0 PRT sp|Q7Z6E9-4|RBBP6_HUMAN Isoform 4 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.01 27.0 1 1 0 PRT sp|P0DPB6|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 29-UNIMOD:35 0.11 27.0 1 1 1 PRT sp|Q99873-2|ANM1_HUMAN Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 313-UNIMOD:35 0.07 27.0 2 2 2 PRT sp|P04844-2|RPN2_HUMAN Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q01813-2|PFKAP_HUMAN Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 403-UNIMOD:4,417-UNIMOD:35 0.03 27.0 1 1 1 PRT sp|Q7Z6J8|UBE3D_HUMAN E3 ubiquitin-protein ligase E3D OS=Homo sapiens OX=9606 GN=UBE3D PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 52-UNIMOD:4 0.04 27.0 1 1 1 PRT sp|Q9UHP3|UBP25_HUMAN Ubiquitin carboxyl-terminal hydrolase 25 OS=Homo sapiens OX=9606 GN=USP25 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.09 27.0 2 2 2 PRT sp|P60520|GBRL2_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Homo sapiens OX=9606 GN=GABARAPL2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 91-UNIMOD:35 0.14 27.0 1 1 1 PRT sp|P61956-2|SUMO2_HUMAN Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.18 27.0 2 1 0 PRT sp|Q16881-7|TRXR1_HUMAN Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|O75964|ATP5L_HUMAN ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 0.14 27.0 2 1 0 PRT sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.13 27.0 2 2 2 PRT sp|Q9UBH6-2|XPR1_HUMAN Isoform 2 of Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens OX=9606 GN=XPR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P61604|CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 0.25 27.0 2 2 2 PRT sp|P33121-2|ACSL1_HUMAN Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q9NZ09-2|UBAP1_HUMAN Isoform 2 of Ubiquitin-associated protein 1 OS=Homo sapiens OX=9606 GN=UBAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|P58876|H2B1D_HUMAN Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.09 27.0 1 1 1 PRT sp|Q86Y56-2|DAAF5_HUMAN Isoform 2 of Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q8IY67-3|RAVR1_HUMAN Isoform 3 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.21 27.0 1 1 0 PRT sp|O95721|SNP29_HUMAN Synaptosomal-associated protein 29 OS=Homo sapiens OX=9606 GN=SNAP29 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.05 27.0 1 1 1 PRT sp|O95336|6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.07 27.0 1 1 1 PRT sp|Q53GG5-2|PDLI3_HUMAN Isoform 2 of PDZ and LIM domain protein 3 OS=Homo sapiens OX=9606 GN=PDLIM3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.08 27.0 1 1 1 PRT sp|Q9ULV3-5|CIZ1_HUMAN Isoform 5 of Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 122-UNIMOD:35,133-UNIMOD:4 0.02 27.0 1 1 1 PRT sp|Q96JP5-2|ZFP91_HUMAN Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q96B54|ZN428_HUMAN Zinc finger protein 428 OS=Homo sapiens OX=9606 GN=ZNF428 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 111-UNIMOD:4 0.08 27.0 1 1 1 PRT sp|Q7Z2K8|GRIN1_HUMAN G protein-regulated inducer of neurite outgrowth 1 OS=Homo sapiens OX=9606 GN=GPRIN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 876-UNIMOD:35 0.02 27.0 1 1 1 PRT sp|Q96PU8|QKI_HUMAN Protein quaking OS=Homo sapiens OX=9606 GN=QKI PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 56-UNIMOD:35 0.04 27.0 1 1 1 PRT sp|Q12906|ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 403-UNIMOD:35,407-UNIMOD:35 0.01 27.0 1 1 0 PRT sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 122-UNIMOD:35 0.06 27.0 6 3 1 PRT sp|Q9HB71|CYBP_HUMAN Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.07 27.0 1 1 0 PRT sp|Q32MZ4|LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.03 27.0 2 2 2 PRT sp|Q9HC35|EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q5JRA6|TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 697-UNIMOD:35 0.01 27.0 1 1 1 PRT sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens OX=9606 GN=EEF1A2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 276-UNIMOD:35 0.04 27.0 1 1 1 PRT sp|P48735|IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 53-UNIMOD:35,58-UNIMOD:35 0.03 27.0 2 1 0 PRT sp|Q9NPA3|M1IP1_HUMAN Mid1-interacting protein 1 OS=Homo sapiens OX=9606 GN=MID1IP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.11 27.0 1 1 1 PRT sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 987-UNIMOD:35 0.00 27.0 1 1 0 PRT sp|P47897|SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|Q9BY67|CADM1_HUMAN Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27.0 null 0.03 27.0 1 1 0 PRT sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P63092-3|GNAS2_HUMAN Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 3-UNIMOD:4 0.03 26.0 1 1 1 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 7 5 3 PRT sp|P17482|HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 1 1 1 PRT sp|Q7Z460-2|CLAP1_HUMAN Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1223-UNIMOD:35 0.03 26.0 3 3 2 PRT sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 292-UNIMOD:4 0.04 26.0 2 2 2 PRT sp|P40937-2|RFC5_HUMAN Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 192-UNIMOD:35,181-UNIMOD:35 0.07 26.0 2 2 2 PRT sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.07 26.0 4 3 2 PRT sp|Q9UPT5-4|EXOC7_HUMAN Isoform 4 of Exocyst complex component 7 OS=Homo sapiens OX=9606 GN=EXOC7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 1 1 1 PRT sp|O14730-2|RIOK3_HUMAN Isoform 2 of Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.03 26.0 1 1 0 PRT sp|Q9NTK5-3|OLA1_HUMAN Isoform 3 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 159-UNIMOD:35 0.09 26.0 3 2 1 PRT sp|Q96P16-3|RPR1A_HUMAN Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.07 26.0 2 2 2 PRT sp|Q9NWH9|SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q92797-2|SYMPK_HUMAN Isoform 2 of Symplekin OS=Homo sapiens OX=9606 GN=SYMPK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q9HAV7|GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.11 26.0 2 2 2 PRT sp|Q9UHB9-3|SRP68_HUMAN Isoform 3 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.05 26.0 1 1 1 PRT sp|Q9Y287-2|ITM2B_HUMAN Isoform 2 of Integral membrane protein 2B OS=Homo sapiens OX=9606 GN=ITM2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.08 26.0 1 1 1 PRT sp|O60287|NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P55084-2|ECHB_HUMAN Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|Q14232-2|EI2BA_HUMAN Isoform 2 of Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 20-UNIMOD:35 0.06 26.0 2 1 0 PRT sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens OX=9606 GN=NEDD8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.15 26.0 1 1 1 PRT sp|Q08J23|NSUN2_HUMAN RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 183-UNIMOD:35,184-UNIMOD:4 0.03 26.0 2 2 2 PRT sp|Q8WWI1-3|LMO7_HUMAN Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1171-UNIMOD:35 0.01 26.0 1 1 1 PRT sp|O43670-2|ZN207_HUMAN Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 2 2 2 PRT sp|P68371|TBB4B_HUMAN Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 330-UNIMOD:35 0.03 26.0 1 1 0 PRT sp|P33981-2|TTK_HUMAN Isoform 2 of Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1369-UNIMOD:35 0.01 26.0 1 1 1 PRT sp|Q14008-2|CKAP5_HUMAN Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 2 2 2 PRT sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 114-UNIMOD:35 0.03 26.0 2 1 0 PRT sp|Q9HC38-2|GLOD4_HUMAN Isoform 2 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 279-UNIMOD:35 0.08 26.0 2 2 2 PRT sp|P53582|MAP11_HUMAN Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 139-UNIMOD:35 0.03 26.0 1 1 1 PRT sp|O43242-2|PSMD3_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|Q9Y277|VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.05 26.0 1 1 1 PRT sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 1 1 1 PRT sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 793-UNIMOD:4 0.02 26.0 3 2 1 PRT sp|P11940-2|PABP1_HUMAN Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 3 2 1 PRT sp|P22087|FBRL_HUMAN rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.08 26.0 2 2 2 PRT sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|O43314-2|VIP2_HUMAN Isoform 2 of Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q01581|HMCS1_HUMAN Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 209-UNIMOD:35 0.03 26.0 1 1 1 PRT sp|P61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 13-UNIMOD:4 0.03 26.0 1 1 1 PRT sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1026-UNIMOD:4 0.01 26.0 1 1 1 PRT sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 206-UNIMOD:35 0.07 26.0 1 1 1 PRT sp|Q70E73|RAPH1_HUMAN Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q15370|ELOB_HUMAN Elongin-B OS=Homo sapiens OX=9606 GN=ELOB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.14 26.0 1 1 1 PRT sp|O75531|BAF_HUMAN Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.17 26.0 1 1 1 PRT sp|Q16637-4|SMN_HUMAN Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 200-UNIMOD:35 0.08 26.0 1 1 1 PRT sp|Q9BY67-2|CADM1_HUMAN Isoform 2 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 1 1 0 PRT sp|O75582-2|KS6A5_HUMAN Isoform 2 of Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 282-UNIMOD:35 0.03 26.0 1 1 1 PRT sp|Q9P289-2|STK26_HUMAN Isoform 2 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 315-UNIMOD:4 0.05 26.0 1 1 1 PRT sp|Q8WVM8-2|SCFD1_HUMAN Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 270-UNIMOD:35,282-UNIMOD:35 0.04 26.0 1 1 1 PRT sp|Q9ULW0|TPX2_HUMAN Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q5JPE7-3|NOMO2_HUMAN Isoform 3 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q69YQ0-2|CYTSA_HUMAN Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 79-UNIMOD:4,91-UNIMOD:35 0.02 26.0 1 1 1 PRT sp|P35611-2|ADDA_HUMAN Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 525-UNIMOD:4,529-UNIMOD:35 0.03 26.0 1 1 1 PRT sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 26.0 null 50-UNIMOD:35 0.12 26.0 4 3 2 PRT sp|Q96EV2|RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P31153|METK2_HUMAN S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 64-UNIMOD:35 0.04 26.0 1 1 1 PRT sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 80-UNIMOD:4,85-UNIMOD:4 0.01 26.0 1 1 1 PRT sp|P19174|PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 228-UNIMOD:35 0.02 26.0 2 2 2 PRT sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 796-UNIMOD:35 0.01 26.0 2 1 0 PRT sp|Q8NG68|TTL_HUMAN Tubulin--tyrosine ligase OS=Homo sapiens OX=9606 GN=TTL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.05 26.0 1 1 1 PRT sp|P55196-1|AFAD_HUMAN Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q6GYQ0-4|RGPA1_HUMAN Isoform 4 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P46779-4|RL28_HUMAN Isoform 4 of 60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.17 26.0 1 1 1 PRT sp|Q9NUL7|DDX28_HUMAN Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens OX=9606 GN=DDX28 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|Q07866-8|KLC1_HUMAN Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.02 26.0 1 1 1 PRT sp|Q92979|NEP1_HUMAN Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 1 1 1 PRT sp|Q5TH69|BIG3_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P55010|IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 39-UNIMOD:35 0.05 26.0 2 2 2 PRT sp|P62491-2|RB11A_HUMAN Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.08 26.0 1 1 1 PRT sp|P49916-4|DNLI3_HUMAN Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 47-UNIMOD:35 0.02 26.0 1 1 1 PRT sp|Q16643|DREB_HUMAN Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 26.0 null 401-UNIMOD:35 0.06 26.0 3 2 1 PRT sp|P51570|GALK1_HUMAN Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|Q96GX2|A7L3B_HUMAN Ataxin-7-like protein 3B OS=Homo sapiens OX=9606 GN=ATXN7L3B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 75-UNIMOD:4 0.22 26.0 1 1 1 PRT sp|Q9UIG0-2|BAZ1B_HUMAN Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 1224-UNIMOD:4,1227-UNIMOD:4 0.02 26.0 1 1 1 PRT sp|Q8NCW5-2|NNRE_HUMAN Isoform 2 of NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 12-UNIMOD:4,24-UNIMOD:4 0.13 26.0 1 1 1 PRT sp|Q92785|REQU_HUMAN Zinc finger protein ubi-d4 OS=Homo sapiens OX=9606 GN=DPF2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.07 26.0 2 2 2 PRT sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens OX=9606 GN=IMP3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.09 26.0 1 1 1 PRT sp|P46087-2|NOP2_HUMAN Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 459-UNIMOD:4 0.02 26.0 1 1 1 PRT sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q13404|UB2V1_HUMAN Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 90-UNIMOD:35 0.12 26.0 1 1 1 PRT sp|P33778|H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 60-UNIMOD:35,63-UNIMOD:35 0.13 26.0 1 1 0 PRT sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 1 1 0 PRT sp|P39687|AN32A_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 26.0 null 123-UNIMOD:4 0.16 26.0 3 3 3 PRT sp|Q16630|CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.04 26.0 1 1 0 PRT sp|P35637|FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 321-UNIMOD:35 0.05 26.0 2 2 0 PRT sp|Q7Z6E9|RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.01 26.0 2 1 0 PRT sp|Q9Y230|RUVB2_HUMAN RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 168-UNIMOD:35 0.03 26.0 1 1 1 PRT sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 191-UNIMOD:35 0.02 26.0 1 1 1 PRT sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 1321-UNIMOD:35 0.01 26.0 1 1 1 PRT sp|Q99933|BAG1_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 200-UNIMOD:35,213-UNIMOD:4 0.05 26.0 1 1 1 PRT sp|P51114|FXR1_HUMAN Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.03 26.0 1 1 1 PRT sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.13 25.0 2 2 2 PRT sp|Q96G03-2|PGM2_HUMAN Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.09 25.0 2 2 2 PRT sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 250-UNIMOD:4 0.04 25.0 1 1 1 PRT sp|Q7Z4Q2-3|HEAT3_HUMAN Isoform 3 of HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 38-UNIMOD:35 0.04 25.0 1 1 1 PRT sp|O60645|EXOC3_HUMAN Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P54687-2|BCAT1_HUMAN Isoform 2 of Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|Q53EL6-2|PDCD4_HUMAN Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q13813-3|SPTN1_HUMAN Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.00 25.0 1 1 1 PRT sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.00 25.0 1 1 1 PRT sp|O94808|GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 341-UNIMOD:35 0.02 25.0 1 1 1 PRT sp|P51114-2|FXR1_HUMAN Isoform 2 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q9BWD1|THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|P59998|ARPC4_HUMAN Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens OX=9606 GN=ARPC4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.07 25.0 1 1 1 PRT sp|Q9BZZ5-1|API5_HUMAN Isoform 1 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.05 25.0 2 2 2 PRT sp|Q9H4I2|ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q6QNY1|BL1S2_HUMAN Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 41-UNIMOD:4 0.09 25.0 1 1 1 PRT sp|P49643|PRI2_HUMAN DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|P46939-3|UTRO_HUMAN Isoform Up71 of Utrophin OS=Homo sapiens OX=9606 GN=UTRN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 176-UNIMOD:35,177-UNIMOD:4 0.02 25.0 1 1 1 PRT sp|P18124|RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|P20618|PSB1_HUMAN Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|P04179-3|SODM_HUMAN Isoform 3 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.09 25.0 1 1 1 PRT sp|P51991-2|ROA3_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 136-UNIMOD:35 0.03 25.0 2 1 0 PRT sp|P62495-2|ERF1_HUMAN Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q15029-2|U5S1_HUMAN Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 652-UNIMOD:35,937-UNIMOD:35 0.05 25.0 5 4 2 PRT sp|Q9H9Y6-3|RPA2_HUMAN Isoform 3 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|P50851-2|LRBA_HUMAN Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 2 2 2 PRT sp|P40123-3|CAP2_HUMAN Isoform 3 of Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 216-UNIMOD:35 0.06 25.0 1 1 1 PRT sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|Q5TBB1-2|RNH2B_HUMAN Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|Q9BWU0|NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 611-UNIMOD:35 0.01 25.0 1 1 1 PRT sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|Q6P0N0|M18BP_HUMAN Mis18-binding protein 1 OS=Homo sapiens OX=9606 GN=MIS18BP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|Q86U38-2|NOP9_HUMAN Isoform 2 of Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q6P1L5|F117B_HUMAN Protein FAM117B OS=Homo sapiens OX=9606 GN=FAM117B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 2 2 2 PRT sp|Q14166|TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 572-UNIMOD:4 0.02 25.0 1 1 1 PRT sp|P13073|COX41_HUMAN Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 39-UNIMOD:35 0.08 25.0 1 1 1 PRT sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|Q9UBF2-2|COPG2_HUMAN Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 583-UNIMOD:35 0.02 25.0 1 1 1 PRT sp|P00387-2|NB5R3_HUMAN Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 154-UNIMOD:35,164-UNIMOD:35 0.07 25.0 1 1 1 PRT sp|P39656-3|OST48_HUMAN Isoform 3 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|P48163-2|MAOX_HUMAN Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q7LBC6-3|KDM3B_HUMAN Isoform 3 of Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q9UQR0|SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 121-UNIMOD:4 0.07 25.0 3 3 3 PRT sp|Q9UJX4-2|APC5_HUMAN Isoform 2 of Anaphase-promoting complex subunit 5 OS=Homo sapiens OX=9606 GN=ANAPC5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 54-UNIMOD:35 0.06 25.0 1 1 1 PRT sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens OX=9606 GN=AASS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 880-UNIMOD:35 0.01 25.0 2 1 0 PRT sp|Q8IZ21-3|PHAR4_HUMAN Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q14919|NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.06 25.0 1 1 1 PRT sp|Q14254|FLOT2_HUMAN Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 357-UNIMOD:35 0.07 25.0 2 2 2 PRT sp|O96019|ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 43-UNIMOD:35 0.03 25.0 1 1 1 PRT sp|Q96RE7|NACC1_HUMAN Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q6NVV1|R13P3_HUMAN Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens OX=9606 GN=RPL13AP3 PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.12 25.0 2 1 0 PRT sp|P27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q9Y3A6-2|TMED5_HUMAN Isoform 2 of Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 151-UNIMOD:35 0.06 25.0 1 1 1 PRT sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 25.0 null 9-UNIMOD:35 0.07 25.0 2 1 0 PRT sp|Q93079|H2B1H_HUMAN Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.09 25.0 1 1 1 PRT sp|Q9Y5A7-2|NUB1_HUMAN Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 209-UNIMOD:35 0.04 25.0 1 1 1 PRT sp|Q16512-3|PKN1_HUMAN Isoform 3 of Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|O14745|NHRF1_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 25.0 null 0.12 25.0 3 2 1 PRT sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens OX=9606 GN=CETN2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.08 25.0 1 1 1 PRT sp|Q8WU90|ZC3HF_HUMAN Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|P49368-2|TCPG_HUMAN Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.07 25.0 3 3 3 PRT sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.04 25.0 2 2 2 PRT sp|Q15642-5|CIP4_HUMAN Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 291-UNIMOD:35 0.05 25.0 1 1 1 PRT sp|Q969S9-5|RRF2M_HUMAN Isoform 5 of Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=GFM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 113-UNIMOD:35 0.04 25.0 1 1 1 PRT sp|P45974-2|UBP5_HUMAN Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 487-UNIMOD:35,493-UNIMOD:35 0.05 25.0 2 2 2 PRT sp|Q96RY5|CRML_HUMAN Protein cramped-like OS=Homo sapiens OX=9606 GN=CRAMP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|O60502-3|OGA_HUMAN Isoform 3 of Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|Q8NC51|PAIRB_HUMAN Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25.0 null 11-UNIMOD:4 0.07 25.0 3 2 1 PRT sp|Q02952|AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 2 2 1 PRT sp|Q5T8P6|RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 1 1 0 PRT sp|Q3KQU3|MA7D1_HUMAN MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 1 1 1 PRT sp|P06454|PTMA_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.13 25.0 2 1 0 PRT sp|P84157|MXRA7_HUMAN Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.10 25.0 1 1 0 PRT sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25.0 null 0.09 25.0 1 1 1 PRT sp|Q86SZ2|TPC6B_HUMAN Trafficking protein particle complex subunit 6B OS=Homo sapiens OX=9606 GN=TRAPPC6B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 149-UNIMOD:4 0.09 25.0 2 1 0 PRT sp|Q9HCE1|MOV10_HUMAN Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 1 1 0 PRT sp|O60499|STX10_HUMAN Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.07 25.0 1 1 1 PRT sp|O75436|VP26A_HUMAN Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.04 25.0 1 1 0 PRT sp|Q6W2J9|BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 1436-UNIMOD:4 0.02 25.0 1 1 1 PRT sp|O15400|STX7_HUMAN Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|Q8N9V3|WSDU1_HUMAN WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDSUB1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|Q7L576|CYFP1_HUMAN Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.01 25.0 1 1 1 PRT sp|Q92841-1|DDX17_HUMAN Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 1-UNIMOD:1,1-UNIMOD:35 0.02 25.0 1 1 1 PRT sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 330-UNIMOD:35 0.03 25.0 3 1 0 PRT sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 1065-UNIMOD:35 0.02 25.0 1 1 1 PRT sp|Q9H8M7|MINY3_HUMAN Ubiquitin carboxyl-terminal hydrolase MINDY-3 OS=Homo sapiens OX=9606 GN=MINDY3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.04 25.0 1 1 1 PRT sp|Q92520|FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 147-UNIMOD:35 0.09 24.0 1 1 1 PRT sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 104-UNIMOD:35 0.02 24.0 1 1 1 PRT sp|Q8IXW5-2|RPAP2_HUMAN Isoform 2 of Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 OS=Homo sapiens OX=9606 GN=RPAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 288-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|Q9ULK4-6|MED23_HUMAN Isoform 6 of Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens OX=9606 GN=MED23 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q9BRK5-4|CAB45_HUMAN Isoform 4 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|Q9Y4F1|FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q6PCE3|PGM2L_HUMAN Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q9H3K2|GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 71-UNIMOD:35 0.03 24.0 1 1 1 PRT sp|Q9UBB6-2|NCDN_HUMAN Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 258-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|P61326|MGN_HUMAN Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.08 24.0 3 1 0 PRT sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q9NZQ3-3|SPN90_HUMAN Isoform 3 of NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q9H4A3-4|WNK1_HUMAN Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q13438-4|OS9_HUMAN Isoform 4 of Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 2 1 0 PRT sp|P26368-2|U2AF2_HUMAN Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q14847-3|LASP1_HUMAN Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|O43464-4|HTRA2_HUMAN Isoform 4 of Serine protease HTRA2, mitochondrial OS=Homo sapiens OX=9606 GN=HTRA2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 0 PRT sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.04 24.0 2 2 2 PRT sp|Q13217|DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 454-UNIMOD:35 0.02 24.0 1 1 1 PRT sp|P15374|UCHL3_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 129-UNIMOD:35 0.06 24.0 1 1 1 PRT sp|Q53H12|AGK_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.06 24.0 2 2 2 PRT sp|P40227-2|TCPZ_HUMAN Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 2 1 0 PRT sp|P09960-3|LKHA4_HUMAN Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 63-UNIMOD:35 0.03 24.0 1 1 1 PRT sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|P49959-2|MRE11_HUMAN Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q7Z2Z1-2|TICRR_HUMAN Isoform 2 of Treslin OS=Homo sapiens OX=9606 GN=TICRR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|P09651-3|ROA1_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 137-UNIMOD:35 0.04 24.0 1 1 1 PRT sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|P35268|RL22_HUMAN 60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.09 24.0 1 1 1 PRT sp|Q9Y6K0|CEPT1_HUMAN Choline/ethanolaminephosphotransferase 1 OS=Homo sapiens OX=9606 GN=CEPT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q96JM7-2|LMBL3_HUMAN Isoform 2 of Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 47-UNIMOD:4 0.16 24.0 3 3 3 PRT sp|P35241-4|RADI_HUMAN Isoform 4 of Radixin OS=Homo sapiens OX=9606 GN=RDX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 169-UNIMOD:35 0.02 24.0 1 1 1 PRT sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|Q8TED0-3|UTP15_HUMAN Isoform 3 of U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q6P3X3|TTC27_HUMAN Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 814-UNIMOD:35 0.02 24.0 1 1 1 PRT sp|O43353-2|RIPK2_HUMAN Isoform 2 of Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 378-UNIMOD:35 0.04 24.0 1 1 1 PRT sp|Q9UBW7-2|ZMYM2_HUMAN Isoform 2 of Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q92597-3|NDRG1_HUMAN Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 56-UNIMOD:35 0.05 24.0 1 1 1 PRT sp|O75489-2|NDUS3_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.11 24.0 1 1 1 PRT sp|Q9NT62-2|ATG3_HUMAN Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q9H2G2-2|SLK_HUMAN Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.01 24.0 1 1 1 PRT sp|P28838-2|AMPL_HUMAN Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 212-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|P31040-3|SDHA_HUMAN Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 509-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|Q14137|BOP1_HUMAN Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 108-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|P05556-2|ITB1_HUMAN Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 193-UNIMOD:35 0.02 24.0 2 1 0 PRT sp|Q5VT66-3|MARC1_HUMAN Isoform 3 of Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q9NXL9-3|MCM9_HUMAN Isoform S of DNA helicase MCM9 OS=Homo sapiens OX=9606 GN=MCM9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 232-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 76-UNIMOD:4 0.04 24.0 2 2 2 PRT sp|Q96GD4-3|AURKB_HUMAN Isoform 3 of Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 58-UNIMOD:35 0.11 24.0 1 1 1 PRT sp|Q6P158-3|DHX57_HUMAN Isoform 3 of Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q14694|UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|Q8N257|H2B3B_HUMAN Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.09 24.0 1 1 1 PRT sp|P06454-2|PTMA_HUMAN Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.23 24.0 2 2 1 PRT sp|P53602|MVD1_HUMAN Diphosphomevalonate decarboxylase OS=Homo sapiens OX=9606 GN=MVD PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 108-UNIMOD:4 0.03 24.0 1 1 1 PRT sp|Q9BXP5-5|SRRT_HUMAN Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|P54709-2|AT1B3_HUMAN Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 68-UNIMOD:35 0.07 24.0 1 1 1 PRT sp|O60216|RAD21_HUMAN Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 24.0 null 0.06 24.0 2 2 2 PRT sp|Q86XZ4|SPAS2_HUMAN Spermatogenesis-associated serine-rich protein 2 OS=Homo sapiens OX=9606 GN=SPATS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 168-UNIMOD:35 0.03 24.0 1 1 1 PRT sp|Q9H0W5|CCDC8_HUMAN Coiled-coil domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CCDC8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|Q9NPF4|OSGEP_HUMAN Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q7Z6K5|ARPIN_HUMAN Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 2-UNIMOD:1 0.04 24.0 1 1 1 PRT sp|O43237|DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 364-UNIMOD:35 0.04 24.0 1 1 1 PRT sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 1468-UNIMOD:35 0.02 24.0 3 3 3 PRT sp|O15371|EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 174-UNIMOD:35,180-UNIMOD:35 0.02 24.0 1 1 0 PRT sp|Q96ME7|ZN512_HUMAN Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.02 24.0 1 1 0 PRT sp|P28289|TMOD1_HUMAN Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.05 24.0 1 1 0 PRT sp|Q9NZJ4|SACS_HUMAN Sacsin OS=Homo sapiens OX=9606 GN=SACS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.00 24.0 1 1 1 PRT sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 1527-UNIMOD:35 0.00 24.0 1 1 1 PRT sp|Q5JTJ3|COA6_HUMAN Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 68-UNIMOD:4,79-UNIMOD:4 0.11 24.0 1 1 0 PRT sp|Q8N6M3|FITM2_HUMAN Fat storage-inducing transmembrane protein 2 OS=Homo sapiens OX=9606 GN=FITM2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|O43488|ARK72_HUMAN Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.06 24.0 1 1 1 PRT sp|O14657|TOR1B_HUMAN Torsin-1B OS=Homo sapiens OX=9606 GN=TOR1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 2 1 0 PRT sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens OX=9606 GN=PLPP3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.04 24.0 1 1 1 PRT sp|Q9P0U4|CXXC1_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 375-UNIMOD:4,380-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|P45973|CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 133-UNIMOD:4,137-UNIMOD:35,140-UNIMOD:35 0.09 24.0 1 1 1 PRT sp|Q9Y3C0|WASC3_HUMAN WASH complex subunit 3 OS=Homo sapiens OX=9606 GN=WASHC3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 156-UNIMOD:35 0.07 24.0 1 1 1 PRT sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.04 24.0 3 1 0 PRT sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|O95789|ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 672-UNIMOD:35 0.01 24.0 1 1 1 PRT sp|Q9BUH6|PAXX_HUMAN Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 0.08 24.0 1 1 1 PRT sp|Q14934|NFAC4_HUMAN Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24.0 null 577-UNIMOD:4 0.02 24.0 1 1 1 PRT sp|Q9Y3U8|RL36_HUMAN 60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 7-UNIMOD:35 0.11 23.0 1 1 1 PRT sp|P55039|DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q8WUH1|CHUR_HUMAN Protein Churchill OS=Homo sapiens OX=9606 GN=CHURC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.10 23.0 1 1 1 PRT sp|P08243-3|ASNS_HUMAN Isoform 3 of Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 66-UNIMOD:35,75-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|P52758|RIDA_HUMAN 2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 0.12 23.0 3 1 0 PRT sp|Q6P4R8-3|NFRKB_HUMAN Isoform 3 of Nuclear factor related to kappa-B-binding protein OS=Homo sapiens OX=9606 GN=NFRKB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=GFUS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|Q9BYT8|NEUL_HUMAN Neurolysin, mitochondrial OS=Homo sapiens OX=9606 GN=NLN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q96BJ3-3|AIDA_HUMAN Isoform 3 of Axin interactor, dorsalization-associated protein OS=Homo sapiens OX=9606 GN=AIDA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.06 23.0 1 1 0 PRT sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q9UMX5|NENF_HUMAN Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.07 23.0 1 1 1 PRT sp|Q9NTJ3-2|SMC4_HUMAN Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 2 2 2 PRT sp|Q5H9F3-2|BCORL_HUMAN Isoform 2 of BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|O75970-5|MPDZ_HUMAN Isoform 4 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 628-UNIMOD:35,630-UNIMOD:4,631-UNIMOD:4 0.01 23.0 1 1 1 PRT sp|Q9NPI1|BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 499-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|Q92878-3|RAD50_HUMAN Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 906-UNIMOD:35,909-UNIMOD:35,914-UNIMOD:35 0.01 23.0 2 1 0 PRT sp|Q86VI4-2|LAP4B_HUMAN Isoform 2 of Lysosomal-associated transmembrane protein 4B OS=Homo sapiens OX=9606 GN=LAPTM4B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|P51649|SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 272-UNIMOD:4 0.03 23.0 2 1 0 PRT sp|P32969|RL9_HUMAN 60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 23.0 null 277-UNIMOD:4 0.02 23.0 3 1 0 PRT sp|O95229-2|ZWINT_HUMAN Isoform 2 of ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|Q8WUM0|NU133_HUMAN Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|A0AVT1-2|UBA6_HUMAN Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 18-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|O60506-5|HNRPQ_HUMAN Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q9UL46|PSME2_HUMAN Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|O43676|NDUB3_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Homo sapiens OX=9606 GN=NDUFB3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.12 23.0 1 1 1 PRT sp|Q9Y5L4|TIM13_HUMAN Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 23-UNIMOD:35 0.13 23.0 1 1 1 PRT sp|P39748|FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q7Z2Z2-2|EFL1_HUMAN Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q9BTA9-3|WAC_HUMAN Isoform 3 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|P23458|JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|O75928-3|PIAS2_HUMAN Isoform 3 of E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.04 23.0 2 1 0 PRT sp|Q9Y3I0|RTCB_HUMAN RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 468-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|O00154-2|BACH_HUMAN Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 37-UNIMOD:35 0.10 23.0 2 2 2 PRT sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 514-UNIMOD:35 0.03 23.0 1 1 1 PRT sp|O95628-5|CNOT4_HUMAN Isoform 5 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.04 23.0 1 1 1 PRT sp|Q9ULU4-2|PKCB1_HUMAN Isoform 2 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 490-UNIMOD:4 0.04 23.0 1 1 1 PRT sp|P08240-2|SRPRA_HUMAN Isoform 2 of Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 2 1 0 PRT sp|P14314-2|GLU2B_HUMAN Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 175-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|Q6WCQ1-3|MPRIP_HUMAN Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 951-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 144-UNIMOD:4 0.04 23.0 1 1 1 PRT sp|Q92793-2|CBP_HUMAN Isoform 2 of CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|P46776|RL27A_HUMAN 60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.08 23.0 1 1 1 PRT sp|Q9UNN5-2|FAF1_HUMAN Isoform Short of FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q96KP4-2|CNDP2_HUMAN Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q7L5D6-2|GET4_HUMAN Isoform 2 of Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 62-UNIMOD:35 0.05 23.0 1 1 1 PRT sp|Q8IUH4-2|ZDH13_HUMAN Isoform 2 of Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|P45880-2|VDAC2_HUMAN Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|O94973-3|AP2A2_HUMAN Isoform 3 of AP-2 complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=AP2A2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 10-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|P61247|RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.05 23.0 1 1 1 PRT sp|Q9UJU6-5|DBNL_HUMAN Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 24-UNIMOD:4,26-UNIMOD:35 0.04 23.0 1 1 1 PRT sp|P31942-4|HNRH3_HUMAN Isoform 4 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 159-UNIMOD:35 0.07 23.0 1 1 1 PRT sp|Q9UBF8-3|PI4KB_HUMAN Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|Q9Y2B0|CNPY2_HUMAN Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.09 23.0 1 1 1 PRT sp|Q8WXG6-6|MADD_HUMAN Isoform 6 of MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 1106-UNIMOD:35 0.01 23.0 1 1 1 PRT sp|O15027|SC16A_HUMAN Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.01 23.0 1 1 0 PRT sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 23.0 null 0.04 23.0 2 1 0 PRT sp|P62195|PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 112-UNIMOD:4 0.03 23.0 1 1 0 PRT sp|Q7Z460|CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 1290-UNIMOD:35 0.01 23.0 1 1 0 PRT sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 970-UNIMOD:35 0.02 23.0 1 1 1 PRT sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.00 23.0 1 1 1 PRT sp|P12956|XRCC6_HUMAN X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 4 1 0 PRT sp|O43852|CALU_HUMAN Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.04 23.0 1 1 0 PRT sp|Q7Z4Q2|HEAT3_HUMAN HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q3ZCQ8|TIM50_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 2 1 0 PRT sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 387-UNIMOD:35 0.02 23.0 2 1 0 PRT sp|P53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23.0 null 0.09 23.0 1 1 1 PRT sp|Q9NZJ6|COQ3_HUMAN Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 155-UNIMOD:4 0.05 23.0 1 1 1 PRT sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 284-UNIMOD:35 0.03 23.0 1 1 1 PRT sp|P43487|RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.07 23.0 1 1 1 PRT sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 207-UNIMOD:35 0.05 23.0 1 1 1 PRT sp|Q16555|DPYL2_HUMAN Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 1 1 0 PRT sp|Q96KG9|SCYL1_HUMAN N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 0.02 23.0 1 1 0 PRT sp|Q8WYP5|ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23.0 null 1724-UNIMOD:35,1726-UNIMOD:35 0.01 23.0 1 1 1 PRT sp|Q04917|1433F_HUMAN 14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.06 22.0 1 1 1 PRT sp|Q9UJX3-2|APC7_HUMAN Isoform 2 of Anaphase-promoting complex subunit 7 OS=Homo sapiens OX=9606 GN=ANAPC7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q96J01-2|THOC3_HUMAN Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9H501|ESF1_HUMAN ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 300-UNIMOD:35 0.03 22.0 2 1 0 PRT sp|Q6NUQ1|RINT1_HUMAN RAD50-interacting protein 1 OS=Homo sapiens OX=9606 GN=RINT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 473-UNIMOD:35 0.01 22.0 1 1 1 PRT sp|Q9NYL9|TMOD3_HUMAN Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q99623-2|PHB2_HUMAN Isoform 2 of Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 101-UNIMOD:35 0.04 22.0 1 1 1 PRT sp|Q96AG4|LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q96EP5-2|DAZP1_HUMAN Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 63-UNIMOD:4 0.03 22.0 1 1 1 PRT sp|P48643-2|TCPE_HUMAN Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q99856|ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 2 1 0 PRT sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens OX=9606 GN=RNF10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 483-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|Q13042-4|CDC16_HUMAN Isoform 4 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 2 1 0 PRT sp|Q9HAW4-3|CLSPN_HUMAN Isoform 3 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 397-UNIMOD:4 0.01 22.0 1 1 1 PRT sp|P53794|SC5A3_HUMAN Sodium/myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC5A3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 609-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 3 1 0 PRT sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 50-UNIMOD:4,53-UNIMOD:35 0.08 22.0 5 3 1 PRT sp|O43447-2|PPIH_HUMAN Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 108-UNIMOD:35 0.07 22.0 1 1 1 PRT sp|Q9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 295-UNIMOD:35 0.03 22.0 1 1 1 PRT sp|Q9Y6R4-2|M3K4_HUMAN Isoform 2 of Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P52735-3|VAV2_HUMAN Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 328-UNIMOD:35 0.01 22.0 1 1 1 PRT sp|Q9H1I8-3|ASCC2_HUMAN Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q96CB8|INT12_HUMAN Integrator complex subunit 12 OS=Homo sapiens OX=9606 GN=INTS12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9NZ52-3|GGA3_HUMAN Isoform 3 of ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.07 22.0 2 2 2 PRT sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q8NFZ3-2|NLGNY_HUMAN Isoform 2 of Neuroligin-4, Y-linked OS=Homo sapiens OX=9606 GN=NLGN4Y null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P53367-3|ARFP1_HUMAN Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 75-UNIMOD:35 0.06 22.0 1 1 1 PRT sp|Q9NVI1-2|FANCI_HUMAN Isoform 2 of Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q6P161|RM54_HUMAN 39S ribosomal protein L54, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL54 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|O43390-3|HNRPR_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q9UJY5-4|GGA1_HUMAN Isoform 4 of ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q16222-2|UAP1_HUMAN Isoform AGX1 of UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 293-UNIMOD:4 0.03 22.0 1 1 1 PRT sp|Q9NY61|AATF_HUMAN Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 487-UNIMOD:35 0.03 22.0 1 1 1 PRT sp|Q92485-2|ASM3B_HUMAN Isoform 2 of Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens OX=9606 GN=SMPDL3B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.05 22.0 1 1 0 PRT sp|P28715|ERCC5_HUMAN DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|O15084-2|ANR28_HUMAN Isoform 2 of Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 864-UNIMOD:35 0.01 22.0 1 1 1 PRT sp|Q8NBJ5|GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 191-UNIMOD:35 0.02 22.0 1 1 1 PRT sp|Q9BVC3|DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo sapiens OX=9606 GN=DSCC1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|A5YKK6-2|CNOT1_HUMAN Isoform 2 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 2149-UNIMOD:35 0.01 22.0 1 1 1 PRT sp|Q12893|TM115_HUMAN Transmembrane protein 115 OS=Homo sapiens OX=9606 GN=TMEM115 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|O75874|IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q9BRA2|TXD17_HUMAN Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|O95405-2|ZFYV9_HUMAN Isoform 2 of Zinc finger FYVE domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZFYVE9 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P08559-3|ODPA_HUMAN Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q99618|CDCA3_HUMAN Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.09 22.0 1 1 1 PRT sp|O96000-2|NDUBA_HUMAN Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 OS=Homo sapiens OX=9606 GN=NDUFB10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 27-UNIMOD:35,28-UNIMOD:35,100-UNIMOD:35 0.16 22.0 2 2 2 PRT sp|P84022-3|SMAD3_HUMAN Isoform 3 of Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|P62308|RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 2-UNIMOD:1 0.12 22.0 2 1 0 PRT sp|P27816|MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 506-UNIMOD:35,514-UNIMOD:35,450-UNIMOD:35 0.06 22.0 4 4 0 PRT sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 2 2 0 PRT sp|P53992|SC24C_HUMAN Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 0 PRT sp|Q5VV42|CDKAL_HUMAN Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 138-UNIMOD:4 0.02 22.0 1 1 0 PRT sp|P49848|TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.04 22.0 4 1 0 PRT sp|Q8IY67|RAVR1_HUMAN Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 0 PRT sp|O14730|RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 0 PRT sp|P02768|ALBU_HUMAN Albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|Q9H6S0|YTDC2_HUMAN 3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 2 1 0 PRT sp|Q99996|AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.00 22.0 1 1 1 PRT sp|Q9C0F0|ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22.0 null 1152-UNIMOD:35,1165-UNIMOD:4 0.01 22.0 1 1 1 PRT sp|O60502|OGA_HUMAN Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q7Z3U7|MON2_HUMAN Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 0 PRT sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 72-UNIMOD:35,75-UNIMOD:35 0.08 22.0 1 1 0 PRT sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 609-UNIMOD:35,613-UNIMOD:35 0.02 21.0 3 2 1 PRT sp|P09622-2|DLDH_HUMAN Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q13098-5|CSN1_HUMAN Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9H0W9-4|CK054_HUMAN Isoform 4 of Ester hydrolase C11orf54 OS=Homo sapiens OX=9606 GN=C11orf54 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 138-UNIMOD:4 0.06 21.0 1 1 1 PRT sp|Q96KB5|TOPK_HUMAN Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|O43913-2|ORC5_HUMAN Isoform 2 of Origin recognition complex subunit 5 OS=Homo sapiens OX=9606 GN=ORC5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q92614-3|MY18A_HUMAN Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9Y2W1|TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q92830-2|KAT2A_HUMAN Isoform 2 of Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q9BZE1|RM37_HUMAN 39S ribosomal protein L37, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL37 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 625-UNIMOD:35,628-UNIMOD:35 0.03 21.0 2 2 2 PRT sp|Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 21.0 null 0.07 21.0 2 1 0 PRT sp|P08133-2|ANXA6_HUMAN Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P47813|IF1AX_HUMAN Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|O94830-2|DDHD2_HUMAN Isoform 2 of Phospholipase DDHD2 OS=Homo sapiens OX=9606 GN=DDHD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 271-UNIMOD:35 0.05 21.0 1 1 1 PRT sp|P13995-2|MTDC_HUMAN Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.05 21.0 1 1 1 PRT sp|Q3LXA3-2|TKFC_HUMAN Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P29218|IMPA1_HUMAN Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q8N5N7-2|RM50_HUMAN Isoform 2 of 39S ribosomal protein L50, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL50 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 52-UNIMOD:4 0.08 21.0 1 1 1 PRT sp|Q14571|ITPR2_HUMAN Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9H825-2|METL8_HUMAN Isoform 2 of mRNA N(3)-methylcytidine methyltransferase METTL8 OS=Homo sapiens OX=9606 GN=METTL8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 136-UNIMOD:35 0.07 21.0 1 1 1 PRT sp|Q9UPN9-2|TRI33_HUMAN Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 845-UNIMOD:35,849-UNIMOD:4 0.01 21.0 1 1 1 PRT sp|P30154-5|2AAB_HUMAN Isoform 5 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q969R2-6|OSBP2_HUMAN Isoform 6 of Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 61-UNIMOD:4 0.02 21.0 1 1 1 PRT sp|Q96EK7-2|F120B_HUMAN Isoform 2 of Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 511-UNIMOD:4 0.03 21.0 2 2 2 PRT sp|Q9Y2Z0-2|SGT1_HUMAN Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q05048|CSTF1_HUMAN Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 58-UNIMOD:35 0.04 21.0 1 1 1 PRT sp|P62851|RS25_HUMAN 40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.09 21.0 1 1 1 PRT sp|Q13200-2|PSMD2_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q01518-2|CAP1_HUMAN Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P06744|G6PI_HUMAN Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 65-UNIMOD:35,119-UNIMOD:35 0.03 21.0 2 2 2 PRT sp|Q6ZSJ8-2|CA122_HUMAN Isoform 2 of Uncharacterized protein C1orf122 OS=Homo sapiens OX=9606 GN=C1orf122 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.28 21.0 1 1 1 PRT sp|O60907-2|TBL1X_HUMAN Isoform 2 of F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 161-UNIMOD:35 0.03 21.0 1 1 1 PRT sp|Q4KMG0-2|CDON_HUMAN Isoform 2 of Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q9UM00-1|TMCO1_HUMAN Isoform 3 of Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|P10244-2|MYBB_HUMAN Isoform 2 of Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 455-UNIMOD:4 0.03 21.0 1 1 1 PRT sp|O95785-4|WIZ_HUMAN Isoform 4 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q9UQB8-3|BAIP2_HUMAN Isoform 3 of Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.05 21.0 2 2 2 PRT sp|Q2KHR3-2|QSER1_HUMAN Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q01804-5|OTUD4_HUMAN Isoform 2 of OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P46937-5|YAP1_HUMAN Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 86-UNIMOD:35 0.03 21.0 1 1 0 PRT sp|Q8WVY7|UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|Q16822|PCKGM_HUMAN Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|O75683|SURF6_HUMAN Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P16083|NQO2_HUMAN Ribosyldihydronicotinamide dehydrogenase [quinone] OS=Homo sapiens OX=9606 GN=NQO2 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|Q7Z333-3|SETX_HUMAN Isoform 3 of Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.00 21.0 1 1 0 PRT sp|Q14739|LBR_HUMAN Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|Q8TAF3-4|WDR48_HUMAN Isoform 4 of WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 260-UNIMOD:4,268-UNIMOD:4 0.04 21.0 1 1 1 PRT sp|O60343-2|TBCD4_HUMAN Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.01 21.0 1 1 0 PRT sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q9NVI7-3|ATD3A_HUMAN Isoform 3 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|Q14980|NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.01 21.0 1 1 1 PRT sp|Q96RT1|ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 781-UNIMOD:35 0.01 21.0 1 1 0 PRT sp|Q8TEM1|PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 211-UNIMOD:35 0.01 21.0 1 1 1 PRT sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 224-UNIMOD:4 0.02 21.0 1 1 1 PRT sp|O43681|GET3_HUMAN ATPase GET3 OS=Homo sapiens OX=9606 GN=GET3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|O43422|P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|Q16799|RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 189-UNIMOD:35 0.01 21.0 1 1 1 PRT sp|Q12860|CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.01 21.0 1 1 0 PRT sp|Q6NZY4|ZCHC8_HUMAN Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.05 21.0 2 2 1 PRT sp|O15511|ARPC5_HUMAN Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.09 20.0 1 1 1 PRT sp|P54578-2|UBP14_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|O43149|ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 2541-UNIMOD:35,2546-UNIMOD:4 0.01 20.0 1 1 1 PRT sp|Q99436-2|PSB7_HUMAN Isoform 2 of Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.08 20.0 1 1 1 PRT sp|Q16832|DDR2_HUMAN Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q8N3R3-4|TCAIM_HUMAN Isoform 4 of T-cell activation inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=TCAIM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P30038-2|AL4A1_HUMAN Isoform 2 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 384-UNIMOD:35 0.02 20.0 1 1 1 PRT sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM9SF3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 261-UNIMOD:35,264-UNIMOD:35 0.02 20.0 1 1 1 PRT sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens OX=9606 GN=MRTO4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|Q96A49|SYAP1_HUMAN Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 294-UNIMOD:35 0.03 20.0 1 1 1 PRT sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 181-UNIMOD:4 0.07 20.0 1 1 1 PRT sp|Q8NC56-2|LEMD2_HUMAN Isoform 2 of LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LEMD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.07 20.0 1 1 1 PRT sp|Q9Y448-2|SKAP_HUMAN Isoform 2 of Small kinetochore-associated protein OS=Homo sapiens OX=9606 GN=KNSTRN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P10606|COX5B_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.09 20.0 1 1 1 PRT sp|P22681|CBL_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9BPX3|CND3_HUMAN Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 835-UNIMOD:4,843-UNIMOD:4 0.02 20.0 1 1 1 PRT sp|Q9Y3E7-2|CHMP3_HUMAN Isoform 2 of Charged multivesicular body protein 3 OS=Homo sapiens OX=9606 GN=CHMP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 61-UNIMOD:35 0.06 20.0 1 1 1 PRT sp|O00203-3|AP3B1_HUMAN Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q9BYD2|RM09_HUMAN 39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q53GS9-2|SNUT2_HUMAN Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q8IWA4|MFN1_HUMAN Mitofusin-1 OS=Homo sapiens OX=9606 GN=MFN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens OX=9606 GN=ARF6 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 130-UNIMOD:35 0.05 20.0 1 1 1 PRT sp|P28288-2|ABCD3_HUMAN Isoform 2 of ATP-binding cassette sub-family D member 3 OS=Homo sapiens OX=9606 GN=ABCD3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q6NZY4-2|ZCHC8_HUMAN Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 0 PRT sp|Q9H4B0-3|OSGP2_HUMAN Isoform 3 of Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OSGEPL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 200-UNIMOD:35 0.04 20.0 1 1 1 PRT sp|O15260-2|SURF4_HUMAN Isoform 2 of Surfeit locus protein 4 OS=Homo sapiens OX=9606 GN=SURF4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 141-UNIMOD:35,148-UNIMOD:35 0.07 20.0 1 1 1 PRT sp|P03897|NU3M_HUMAN NADH-ubiquinone oxidoreductase chain 3 OS=Homo sapiens OX=9606 GN=MT-ND3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 39-UNIMOD:4,44-UNIMOD:35 0.14 20.0 1 1 1 PRT sp|Q99590|SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q9Y2R9|RT07_HUMAN 28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|O00429-7|DNM1L_HUMAN Isoform 7 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.05 20.0 1 1 1 PRT sp|P11172-3|UMPS_HUMAN Isoform 3 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q86V21-2|AACS_HUMAN Isoform 2 of Acetoacetyl-CoA synthetase OS=Homo sapiens OX=9606 GN=AACS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P32121-5|ARRB2_HUMAN Isoform 5 of Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|O14957|QCR10_HUMAN Cytochrome b-c1 complex subunit 10 OS=Homo sapiens OX=9606 GN=UQCR11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 1-UNIMOD:35 0.16 20.0 2 1 0 PRT sp|Q9NQW7-2|XPP1_HUMAN Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q96T37-4|RBM15_HUMAN Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|P50150|GBG4_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 OS=Homo sapiens OX=9606 GN=GNG4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.23 20.0 1 1 1 PRT sp|Q9UNE7-2|CHIP_HUMAN Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 172-UNIMOD:4 0.06 20.0 1 1 1 PRT sp|O15013-7|ARHGA_HUMAN Isoform 3 of Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q6P2E9|EDC4_HUMAN Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.02 20.0 2 2 2 PRT sp|P29372-5|3MG_HUMAN Isoform 4 of DNA-3-methyladenine glycosylase OS=Homo sapiens OX=9606 GN=MPG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.06 20.0 2 1 0 PRT sp|Q9NQC3-2|RTN4_HUMAN Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.04 20.0 1 1 0 PRT sp|P42771-2|CDN2A_HUMAN Isoform 2 of Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.13 20.0 1 1 1 PRT sp|Q14152-2|EIF3A_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 310-UNIMOD:35 0.01 20.0 1 1 0 PRT sp|Q9UKA4|AKA11_HUMAN A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P18206|VINC_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 0 PRT sp|Q14966|ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 586-UNIMOD:35 0.02 20.0 1 1 0 PRT sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 0 PRT sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 0 PRT sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.01 20.0 1 1 0 PRT sp|Q9H845|ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P56182|RRP1_HUMAN Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.04 20.0 1 1 1 PRT sp|P52565|GDIR1_HUMAN Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.08 20.0 1 1 1 PRT sp|Q14168|MPP2_HUMAN MAGUK p55 subfamily member 2 OS=Homo sapiens OX=9606 GN=MPP2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q9NQS7|INCE_HUMAN Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 1 1 1 PRT sp|Q14152|EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 344-UNIMOD:35 0.01 20.0 1 1 0 PRT sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 62-UNIMOD:35 0.03 20.0 2 1 0 PRT sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 152-UNIMOD:4,156-UNIMOD:4 0.05 20.0 1 1 0 PRT sp|Q6IN85|P4R3A_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 125-UNIMOD:35,135-UNIMOD:4 0.02 20.0 1 1 1 PRT sp|Q9NXE8|CWC25_HUMAN Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens OX=9606 GN=CWC25 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 1518-UNIMOD:35 0.00 19.0 1 1 1 PRT sp|P16402|H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|Q5JTJ3-3|COA6_HUMAN Isoform 3 of Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 22-UNIMOD:4,33-UNIMOD:4 0.18 19.0 1 1 0 PRT sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q14677-2|EPN4_HUMAN Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 1075-UNIMOD:4 0.01 19.0 1 1 1 PRT sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 111-UNIMOD:35 0.02 19.0 1 1 1 PRT sp|Q7L3T8|SYPM_HUMAN Probable proline--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=PARS2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q8WYQ5-3|DGCR8_HUMAN Isoform 3 of Microprocessor complex subunit DGCR8 OS=Homo sapiens OX=9606 GN=DGCR8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q8TC07-2|TBC15_HUMAN Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 230-UNIMOD:35 0.02 19.0 1 1 1 PRT sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ANKRD16 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P21926|CD9_HUMAN CD9 antigen OS=Homo sapiens OX=9606 GN=CD9 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 248-UNIMOD:35 0.03 19.0 1 1 1 PRT sp|Q9UPP1-5|PHF8_HUMAN Isoform 5 of Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q6ZRQ5|MMS22_HUMAN Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 990-UNIMOD:35 0.01 19.0 1 1 1 PRT sp|P35659-2|DEK_HUMAN Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 25-UNIMOD:35 0.03 19.0 2 1 0 PRT sp|Q9P016-2|THYN1_HUMAN Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 127-UNIMOD:35 0.06 19.0 1 1 1 PRT sp|Q96RU2-3|UBP28_HUMAN Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q9NX46|ADPRS_HUMAN ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRS PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q9Y5Y2|NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 269-UNIMOD:4 0.04 19.0 1 1 1 PRT sp|Q13247-3|SRSF6_HUMAN Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|O43684-2|BUB3_HUMAN Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q9UJ83-3|HACL1_HUMAN Isoform 3 of 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens OX=9606 GN=HACL1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 167-UNIMOD:35 0.02 19.0 2 1 0 PRT sp|Q9UKG1|DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|O60568|PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.07 19.0 1 1 1 PRT sp|P06396-2|GELS_HUMAN Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q8N0X7|SPART_HUMAN Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P38398-8|BRCA1_HUMAN Isoform 8 of Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|Q96MG7|NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 167-UNIMOD:35 0.07 19.0 1 1 1 PRT sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|Q969X6-2|UTP4_HUMAN Isoform 2 of U3 small nucleolar RNA-associated protein 4 homolog OS=Homo sapiens OX=9606 GN=UTP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q14974-2|IMB1_HUMAN Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 410-UNIMOD:35 0.01 19.0 1 1 1 PRT sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 176-UNIMOD:35,202-UNIMOD:4 0.09 19.0 2 2 2 PRT sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 85-UNIMOD:35 0.06 19.0 2 2 2 PRT sp|P13804-2|ETFA_HUMAN Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 277-UNIMOD:35 0.09 19.0 2 2 2 PRT sp|Q9Y3D0|CIA2B_HUMAN Cytosolic iron-sulfur assembly component 2B OS=Homo sapiens OX=9606 GN=CIAO2B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.12 19.0 1 1 1 PRT sp|P07910-3|HNRPC_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.04 19.0 4 1 0 PRT sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 461-UNIMOD:4 0.02 19.0 1 1 0 PRT sp|Q8WWM7|ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q9BTE3|MCMBP_HUMAN Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 580-UNIMOD:35 0.02 19.0 1 1 0 PRT sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 105-UNIMOD:35,111-UNIMOD:4 0.02 19.0 1 1 0 PRT sp|A8MWD9|RUXGL_HUMAN Putative small nuclear ribonucleoprotein G-like protein 15 OS=Homo sapiens OX=9606 GN=SNRPGP15 PE=5 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19.0 null 2-UNIMOD:1 0.12 19.0 1 1 0 PRT sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|P46937|YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 86-UNIMOD:35 0.02 19.0 1 1 0 PRT sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.02 19.0 1 1 1 PRT sp|Q96BJ3|AIDA_HUMAN Axin interactor, dorsalization-associated protein OS=Homo sapiens OX=9606 GN=AIDA PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 0 PRT sp|O43708|MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens OX=9606 GN=GSTZ1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19.0 null 0.07 19.0 2 1 0 PRT sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 316-UNIMOD:35 0.01 19.0 1 1 0 PRT sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 2 2 2 PRT sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 1 PRT sp|Q86XP3-2|DDX42_HUMAN Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 263-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|O94817|ATG12_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens OX=9606 GN=ATG12 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 68-UNIMOD:35 0.07 18.0 1 1 1 PRT sp|B2RTY4-3|MYO9A_HUMAN Isoform 3 of Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 152-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q13242|SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.05 18.0 1 1 1 PRT sp|O00139-2|KIF2A_HUMAN Isoform 2 of Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9C0B1|FTO_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q9UNM6|PSD13_HUMAN 26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|P49591|SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|O15126-2|SCAM1_HUMAN Isoform 2 of Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q07157-2|ZO1_HUMAN Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 932-UNIMOD:35,933-UNIMOD:35 0.01 18.0 1 1 1 PRT sp|P51665|PSMD7_HUMAN 26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q5JRA6-2|TGO1_HUMAN Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 2 2 2 PRT sp|Q9UGI8-2|TES_HUMAN Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q9UKL0|RCOR1_HUMAN REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q69YN4-3|VIR_HUMAN Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q92791|SC65_HUMAN Endoplasmic reticulum protein SC65 OS=Homo sapiens OX=9606 GN=P3H4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q52LJ0-1|FA98B_HUMAN Isoform 1 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q9HAB8-2|PPCS_HUMAN Isoform 2 of Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.09 18.0 1 1 1 PRT sp|Q8N1G0-2|ZN687_HUMAN Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 91-UNIMOD:4 0.03 18.0 1 1 1 PRT sp|Q9ULL5-2|PRR12_HUMAN Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P46019|KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q14141-3|SEPT6_HUMAN Isoform IV of Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 170-UNIMOD:35 0.03 18.0 1 1 1 PRT sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q8IXI2-6|MIRO1_HUMAN Isoform 6 of Mitochondrial Rho GTPase 1 OS=Homo sapiens OX=9606 GN=RHOT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|P61086-3|UBE2K_HUMAN Isoform 3 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.10 18.0 1 1 1 PRT sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.02 18.0 1 1 0 PRT sp|Q05519|SRS11_HUMAN Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 754-UNIMOD:35 0.02 18.0 1 1 1 PRT sp|Q96ST2|IWS1_HUMAN Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18.0 null 0.02 18.0 1 1 0 PRT sp|P23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 350-UNIMOD:35 0.04 18.0 1 1 0 PRT sp|Q8IU81|I2BP1_HUMAN Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 546-UNIMOD:4 0.03 18.0 1 1 1 PRT sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens OX=9606 GN=SLC38A10 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q9H773|DCTP1_HUMAN dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.08 18.0 1 1 1 PRT sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|Q14139|UBE4A_HUMAN Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 490-UNIMOD:4 0.01 18.0 1 1 1 PRT sp|Q9NZB2|F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 523-UNIMOD:35,531-UNIMOD:4,535-UNIMOD:35 0.02 18.0 1 1 1 PRT sp|Q9NQC3|RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 0 PRT sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens OX=9606 GN=RNF126 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q12849|GRSF1_HUMAN G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18.0 null 302-UNIMOD:35 0.04 18.0 1 1 1 PRT sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 482-UNIMOD:35 0.01 18.0 1 1 1 PRT sp|P07910|HNRPC_HUMAN Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q7Z589|EMSY_HUMAN BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.01 18.0 1 1 1 PRT sp|P62333|PRS10_HUMAN 26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 1 PRT sp|Q5H9R7|PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 794-UNIMOD:35,798-UNIMOD:35 0.01 18.0 1 1 1 PRT sp|P62913|RL11_HUMAN 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.08 18.0 1 1 0 PRT sp|O60664|PLIN3_HUMAN Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.03 18.0 1 1 0 PRT sp|O15321-2|TM9S1_HUMAN Isoform 2 of Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|Q9H2U1-2|DHX36_HUMAN Isoform 2 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q53F19|NCBP3_HUMAN Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|P07203|GPX1_HUMAN Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|P62277|RS13_HUMAN 40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.09 17.0 1 1 1 PRT sp|Q9NRC6|SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens OX=9606 GN=SPTBN5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.00 17.0 1 1 1 PRT sp|Q9NPD8|UBE2T_HUMAN Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.00 17.0 1 1 1 PRT sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens OX=9606 GN=DHCR7 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q6P6C2-3|ALKB5_HUMAN Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|P06753-2|TPM3_HUMAN Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens OX=9606 GN=RECQL4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q9UI26|IPO11_HUMAN Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q86Y97-2|KMT5C_HUMAN Isoform 2 of Histone-lysine N-methyltransferase KMT5C OS=Homo sapiens OX=9606 GN=KMT5C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 1-UNIMOD:35 0.09 17.0 1 1 1 PRT sp|Q99877|H2B1N_HUMAN Histone H2B type 1-N OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.09 17.0 1 1 1 PRT sp|Q9BZL4-2|PP12C_HUMAN Isoform 2 of Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|Q07955-3|SRSF1_HUMAN Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|P82675|RT05_HUMAN 28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 377-UNIMOD:4 0.03 17.0 1 1 1 PRT sp|P62310|LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.13 17.0 1 1 1 PRT sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17.0 null 680-UNIMOD:35 0.02 17.0 1 1 1 PRT sp|Q16222|UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 218-UNIMOD:35 0.03 17.0 1 1 1 PRT sp|Q6FI81|CPIN1_HUMAN Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 0 PRT sp|O43464|HTRA2_HUMAN Serine protease HTRA2, mitochondrial OS=Homo sapiens OX=9606 GN=HTRA2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 0 PRT sp|Q3ZAQ7|VMA21_HUMAN Vacuolar ATPase assembly integral membrane protein VMA21 OS=Homo sapiens OX=9606 GN=VMA21 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17.0 null 0.13 17.0 1 1 1 PRT sp|P29374|ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens OX=9606 GN=ELAVL2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 50-UNIMOD:35 0.05 17.0 1 1 1 PRT sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|Q8IV61-2|GRP3_HUMAN Isoform 2 of Ras guanyl-releasing protein 3 OS=Homo sapiens OX=9606 GN=RASGRP3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.00 17.0 1 1 0 PRT sp|Q8TEL6|TP4AP_HUMAN Short transient receptor potential channel 4-associated protein OS=Homo sapiens OX=9606 GN=TRPC4AP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|P07951-2|TPM2_HUMAN Isoform 2 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|Q96GC5|RM48_HUMAN 39S ribosomal protein L48, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL48 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.07 17.0 1 1 1 PRT sp|P20810|ICAL_HUMAN Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 0 PRT sp|Q86YP4|P66A_HUMAN Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.00 17.0 1 1 1 PRT sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 0.01 17.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE 1 sp|P49006|MRP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 67 ms_run[2]:scan=5239 21.664 3 3752.6409 3752.6409 A - 157 196 PSM KSEDPPGQEAGSEEEGSSASGLA 2 sp|O75153|CLU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 61 ms_run[2]:scan=4731 20.397 2 2217.9509 2217.9509 S K 653 676 PSM KASPAGTAGGPGAGAAAGGTGPLAA 3 sp|Q12962|TAF10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 60 ms_run[2]:scan=5309 21.842 2 1934.981 1934.9810 N R 42 67 PSM RVGPADDGPAPSGEEEGEGGGEAGG 4 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 60 ms_run[2]:scan=4449 19.438 2 2252.9418 2252.9418 A K 8 33 PSM KPGTTGSGAGSGGPGGLTSAAPAGGD 5 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 59 ms_run[2]:scan=4811 20.596 2 2083.977 2083.9770 T K 26 52 PSM KEAAEAESGMAPGGPGEGDGSLVNAS 6 sp|Q7L2E3-2|DHX30_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 57 10-UNIMOD:35 ms_run[2]:scan=5243 21.677 2 2403.0496 2403.0496 T R 46 72 PSM KVLAALAASSGSSSASSSSAPVAASSGQATTQS 7 sp|Q5T4S7-3|UBR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56 ms_run[2]:scan=5807 22.839 3 2923.4371 2923.4371 S K 3307 3340 PSM RGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEE 8 sp|P08621-2|RU17_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56 7-UNIMOD:35 ms_run[2]:scan=6069 23.282 3 3416.3859 3416.3859 L K 301 337 PSM KATLVESSTSGFTPGGGGSSVSMIAS 9 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 54 23-UNIMOD:35 ms_run[2]:scan=6962 24.726 2 2430.1584 2430.1584 L R 607 633 PSM RGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEE 10 sp|P08621-2|RU17_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 54 7-UNIMOD:35 ms_run[2]:scan=6334 23.694 3 3416.3859 3416.3859 L K 301 337 PSM RLPNLSSPSAEGPPGPPSGPAP 11 sp|O60784-3|TOM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 54 ms_run[2]:scan=6874 24.573 2 2081.0542 2081.0542 D R 411 433 PSM REGEAAAVEGPCPSQESLSQEENPEPTEDE 12 sp|Q86W50|MET16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 12-UNIMOD:4 ms_run[2]:scan=5870 22.94 3 3270.3743 3270.3743 L R 437 467 PSM KTIQNSSVSPTSSSSSSSSTGETQTQSSS 13 sp|Q7Z417|NUFP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 53 ms_run[1]:scan=3884 17.227746735733334 3 2863.283076 2863.280277 N R 368 397 PSM KEAAEAESGMAPGGPGEGDGSLVNAS 14 sp|Q7L2E3-2|DHX30_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 52 10-UNIMOD:35 ms_run[2]:scan=5233 21.645 2 2403.0496 2403.0496 T R 46 72 PSM RGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEE 15 sp|P08621-2|RU17_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 52 ms_run[2]:scan=6509 23.977 3 3400.391 3400.3910 L K 301 337 PSM RALASGTEASSTDPGAPGGPGGAEGPMA 16 sp|Q16763|UBE2S_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51 27-UNIMOD:35 ms_run[2]:scan=5039 21.182 3 2484.1187 2484.1187 G K 169 197 PSM KAADPPAENSSAPEAEQGGAE 17 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 51 ms_run[1]:scan=3936 17.443343268 2 2024.891139 2024.892307 T - 304 325 PSM RVNDGVCDCCDGTDEYNSGVICENTC 18 sp|P14314|GLU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 51 7-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4,22-UNIMOD:4,26-UNIMOD:4 ms_run[1]:scan=6026 23.2142526624 3 3069.136217 3068.131070 N K 91 117 PSM KAGEAPTENPAPPTQQSSAE 19 sp|P16989-2|YBOX3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=4130 18.203 2 2008.9338 2008.9338 A - 284 304 PSM KDYEEVGADSADGEDEGEEY 20 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=5570 22.4 2 2205.8346 2205.8346 E - 430 450 PSM KDYEEVGVDSVEGEGEEEGEEY 21 sp|Q71U36-2|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=7032 24.845 2 2475.9925 2475.9925 E - 395 417 PSM KVELPSEEQVSGSQGPSEE 22 sp|Q02952-3|AKA12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=5753 22.751 2 2014.9331 2014.9331 E K 271 290 PSM RDNLTLWTSDTQGDEAEAGEGGEN 23 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=7676 25.968 3 2564.0899 2564.0899 L - 222 246 PSM KAADPPAENSSAPEAEQGGAE 24 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 50 ms_run[1]:scan=4035 17.826682304533332 2 2024.891139 2024.892307 T - 304 325 PSM KASAEGPLLGPEAAPSGEGAGS 25 sp|Q9BRJ6|CG050_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=6014 23.196 2 1951.9487 1951.9487 K K 21 43 PSM KDDGISFSNQTGPAWAGSE 26 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=7727 26.064 2 1965.8704 1965.8704 K R 153 172 PSM KDPGMGAMGGMGGGMGGGMF 27 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5091 21.309 2 1865.6875 1865.6875 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 28 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=6723 24.324 2 1849.6926 1849.6926 E - 554 574 PSM KEGAAGAGVAQAGPLVDGELL 29 sp|Q4V328-4|GRAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=8657 28.14 2 1922.0109 1922.0109 L R 118 139 PSM KQPAIMPGQSYGLEDGSCSY 30 sp|P14866-2|HNRPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 18-UNIMOD:4 ms_run[2]:scan=7321 25.334 2 2186.9613 2186.9613 S K 322 342 PSM KSETSVANGSQSESSVSTPSASFEPNNTCENSQS 31 sp|Q92575|UBXN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 29-UNIMOD:4 ms_run[2]:scan=5485 22.211 3 3533.4972 3533.4972 L R 116 150 PSM RELDPSLVSANDSPSGMQT 32 sp|Q5UIP0-2|RIF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 17-UNIMOD:35 ms_run[2]:scan=5906 23.002 2 2018.9215 2018.9215 L R 2149 2168 PSM RESELELPVPGAGGDGADPGLS 33 sp|O43251-6|RFOX2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 ms_run[2]:scan=8355 27.346 2 2122.0178 2122.0178 K K 24 46 PSM KDPGMGAMGGMGGGMGGGMF 34 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 49 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=4520 19.699778358666666 2 1881.678589 1881.682398 E - 554 574 PSM KSVSTPSEAGSQDSGDGAVGS 35 sp|Q13409|DC1I2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 49 ms_run[1]:scan=3940 17.4548077408 2 1921.851070 1921.850108 S R 91 112 PSM KANLYPPSNTPGDALSPGGGL 36 sp|Q9GZT9-2|EGLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=7541 25.716 2 2025.0167 2025.0167 E R 159 180 PSM KCISEVQANNVVLGQYVGNPDGEGEAT 37 sp|P11413|G6PD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 2-UNIMOD:4 ms_run[2]:scan=7742 26.09 3 2847.3345 2847.3345 L K 293 320 PSM KDPGMGAMGGMGGGMGGGMF 38 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 5-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=7626 25.875 2 1833.6977 1833.6977 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 39 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 19-UNIMOD:35 ms_run[2]:scan=7961 26.527 2 1817.7027 1817.7027 E - 554 574 PSM KDVSDQIGNEEQVEDTFQ 40 sp|Q9NU22|MDN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=6968 24.736 2 2079.9233 2079.9233 M K 4687 4705 PSM RDNLTLWTSDTQGDEAEAGEGGEN 41 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=7867 26.34 3 2564.0899 2564.0899 L - 222 246 PSM RGAPEPAQTQPQPQPQPAAPEGPEQP 42 sp|A0A0U1RRL7|MMPOS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=5099 21.323 3 2702.3049 2702.3049 G R 9 35 PSM KDPGMGAMGGMGGGMGGGMF 43 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48 15-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=7033 24.847015046133333 2 1833.696045 1833.697653 E - 554 574 PSM KPDGVTATAADEEEDEYSGGLC 44 sp|Q99747|SNAG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 48 22-UNIMOD:4 ms_run[1]:scan=6332 23.6910620776 2 2312.944014 2312.959066 A - 291 313 PSM KAYSDPSTGEPATYGELQQ 45 sp|Q15149-7|PLEC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=5697 22.643 2 2040.9276 2040.9276 A R 3147 3166 PSM KDPGMGAMGGMGGGMGGGMF 46 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 5-UNIMOD:35,8-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5249 21.695 2 1865.6875 1865.6875 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 47 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 8-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5824 22.87 2 1849.6926 1849.6926 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 48 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=6032 23.226 2 1849.6926 1849.6926 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 49 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 15-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=7045 24.865 2 1833.6977 1833.6977 E - 554 574 PSM KELGGLEGDPSPEEDEGIQ 50 sp|Q9BT09|CNPY3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=6201 23.49 2 1997.9066 1997.9066 R K 247 266 PSM KMAEESSSSSSSSSPTAATSQQQQL 51 sp|Q13620-1|CUL4B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 2-UNIMOD:35 ms_run[2]:scan=4438 19.395 3 2559.1242 2559.1242 A K 115 140 PSM KPGNPPAEIGQNISSNSSASILES 52 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=7260 25.227 2 2396.1819 2396.1819 Y K 800 824 PSM KQEPLGSDSEGVNCLAYDEAIMAQQD 53 sp|Q96FW1|OTUB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 14-UNIMOD:4,22-UNIMOD:35 ms_run[2]:scan=7971 26.545 3 2883.2539 2883.2539 Q R 10 36 PSM KVVSQYSSLLSPMSVNAVM 54 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 19-UNIMOD:35 ms_run[2]:scan=8605 28.024 2 2055.038 2055.0380 S K 174 193 PSM REDEGEPGDEGQLEDEGSQE 55 sp|Q969E4|TCAL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=4834 20.659 2 2203.8625 2203.8625 K K 48 68 PSM RFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG 56 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=6752 24.371 3 3375.4148 3375.4148 F - 772 807 PSM KDPGMGAMGGMGGGMGGGMF 57 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=7419 25.505 2 1833.6977 1833.6977 E - 554 574 PSM KEEPAAAGSGAASPSAAE 58 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=3798 16.823 2 1599.7376 1599.7376 D K 69 87 PSM KGIGMGNIGPAGMGMEGIGFGIN 59 sp|P52272-2|HNRPM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 5-UNIMOD:35,13-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=7948 26.505 3 2225.0279 2225.0279 N K 283 306 PSM KGTMDDISQEEGSSQGEDSVSGSQ 60 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 4-UNIMOD:35 ms_run[2]:scan=4398 19.24 3 2473.0034 2473.0035 S R 944 968 PSM KGTMDDISQEEGSSQGEDSVSGSQ 61 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=5072 21.267 3 2457.0085 2457.0085 S R 944 968 PSM KPQQASQAPTAPSVIPPAVE 62 sp|Q5T0F9-3|C2D1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=6629 24.166 3 2015.0688 2015.0688 L R 33 53 PSM KQAQVATGGGPGAPPGSQPDYSAAWAEYY 63 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=8552 27.87 3 2923.3413 2923.3413 K R 654 683 PSM KTDNSVASSPSSAISTATPSP 64 sp|O15550|KDM6A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=5561 22.38 2 2003.9647 2003.9647 T K 810 831 PSM RALLAPLVAPEAGEAEPGSQE 65 sp|Q9H0B6-2|KLC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=8238 27.074 2 2104.08 2104.0800 H R 36 57 PSM REDEEESLNEVGYDDIGGC 66 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 19-UNIMOD:4 ms_run[2]:scan=7181 25.085 2 2184.8753 2184.8753 K R 191 210 PSM REECPVFTPPGGETLDQV 67 sp|Q9NQ88|TIGAR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 4-UNIMOD:4 ms_run[2]:scan=8138 26.854 2 2029.9415 2029.9415 A K 111 129 PSM RGADTAPTLAPEALPSQGEVE 68 sp|Q8IZL8|PELP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=6957 24.716 2 2108.0386 2108.0386 E R 1018 1039 PSM RIPSAVGYQPTLATDMGTMQE 69 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 16-UNIMOD:35 ms_run[2]:scan=7113 24.967 2 2281.0719 2281.0719 G R 324 345 PSM RLAEDAPNFDGPAAEGQPGQ 70 sp|P78344-2|IF4G2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=6096 23.326 2 2038.9344 2038.9344 L K 138 158 PSM RVTEAPCYPGAPSTEASGQTGPQEPTSA 71 sp|P40222|TXLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 7-UNIMOD:4 ms_run[2]:scan=5684 22.619 3 2845.2825 2845.2825 P R 517 545 PSM KAIEDEGGNPDEIEITSEGN 72 sp|Q15424-2|SAFB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=6076 23.295 2 2115.9444 2115.9444 K K 63 83 PSM KDPGMGAMGGMGGGMGGGMF 73 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5414 22.071 2 1865.6875 1865.6875 E - 554 574 PSM KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEG 74 sp|P49006|MRP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 25-UNIMOD:4 ms_run[2]:scan=5003 21.102 3 3412.3605 3412.3605 R K 110 144 PSM KELLELDSVETGGQDSV 75 sp|O95429-2|BAG4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=8033 26.656 2 1817.8895 1817.8895 T R 382 399 PSM KETFGVNNAVYGIDAMNPSS 76 sp|O75822-3|EIF3J_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 16-UNIMOD:35 ms_run[2]:scan=7406 25.482 2 2128.9735 2128.9735 A R 84 104 PSM KETPGTLSSDTNDSGVELGEES 77 sp|O75410-3|TACC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=5896 22.989 2 2250.9976 2250.9976 L R 97 119 PSM KNLEAVETLGSTSTICSD 78 sp|P05023-3|AT1A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 16-UNIMOD:4 ms_run[2]:scan=6757 24.382 2 1923.9095 1923.9095 V K 328 346 PSM KSCVEEPEPEPEAAEGDGD 79 sp|P51858-2|HDGF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 3-UNIMOD:4 ms_run[2]:scan=4766 20.481 2 2043.8215 2043.8215 K K 99 118 PSM KSIEGTADDEEEGVSPDTAI 80 sp|Q29RF7|PDS5A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=6188 23.467 2 2061.9226 2061.9226 N R 637 657 PSM KTLVSTVGSMVFNEGEAQ 81 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 10-UNIMOD:35 ms_run[2]:scan=7853 26.315 2 1911.9248 1911.9248 Y R 651 669 PSM REVIAEEEPPTVTEPLPEN 82 sp|Q02952-3|AKA12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=6860 24.553 2 2148.0586 2148.0586 E R 834 853 PSM RQPGSTAQYDAGAGSPEAEPTDSDSPPSSSADAS 83 sp|O14976-2|GAK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=4908 20.867 3 3292.3876 3292.3876 P R 677 711 PSM RQQAAYYGQTPGPGGPQPPPTQQGQQQAQ 84 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=5307 21.837 3 3063.4547 3063.4547 Y - 683 712 PSM RVSPGLPSPNLENGAPAVGPVQP 85 sp|Q9UGP4|LIMD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=7829 26.264 3 2252.1913 2252.1913 Q R 270 293 PSM KAADPPAENSSAPEAEQGGAE 86 sp|P67809|YBOX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 45 ms_run[1]:scan=4079 17.991691684266666 2 2024.891139 2024.892307 T - 304 325 PSM KAAAGQESEGPAVGPPQPLG 87 sp|O14497-2|ARI1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5793 22.817 2 1859.9377 1859.9377 M K 51 71 PSM KAAAPAPEEEMDECEQALAAEP 88 sp|P26641|EF1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 11-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=5969 23.125 2 2372.0148 2372.0148 K K 253 275 PSM KAAGDTTVIENSDVSPETESSE 89 sp|Q86UP2-2|KTN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5310 21.844 2 2265.0132 2265.0132 V K 1242 1264 PSM KAVPMAPAPASPGSSNDSSA 90 sp|Q66K74-2|MAP1S_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 5-UNIMOD:35 ms_run[2]:scan=4327 18.951 2 1856.8574 1856.8574 R R 723 743 PSM KDATNVGDEGGFAPNILEN 91 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=7956 26.518 2 1959.9174 1959.9174 G K 202 221 PSM KDTSATSQSVNGSPQAEQPSLESTS 92 sp|Q86WB0-3|NIPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4942 20.949 3 2535.1572 2535.1572 A K 50 75 PSM KEALELTDTGLLSGSEE 93 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=8312 27.251 2 1790.8786 1790.8786 A R 1301 1318 PSM KEDGSEVGVGGAQVTGSNT 94 sp|Q13618-3|CUL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4662 20.19 2 1790.8282 1790.8282 K R 503 522 PSM KEDSQPGEQNDQGETGSLPGQQE 95 sp|Q9NUA8|ZBT40_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4643 20.115 3 2457.0528 2457.0528 A K 700 723 PSM KEELQSGVDAANSAAQQYQ 96 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5957 23.105 2 2035.9447 2035.9447 Q R 368 387 PSM KELQGDGPPSSPTNDPTV 97 sp|Q12873-2|CHD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5133 21.398 2 1837.8694 1837.8694 K K 703 721 PSM KGAEPETGSAVSAAQCQVGPT 98 sp|Q9UI10|EI2BD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 16-UNIMOD:4 ms_run[2]:scan=5086 21.298 2 2043.9531 2043.9531 E R 54 75 PSM KIGGDAGTSLNSNDYGYGGQ 99 sp|Q96AE4|FUBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5781 22.797 2 1972.8763 1972.8763 A K 44 64 PSM KNAEVTGTMSQDTEVDM 100 sp|P08195|4F2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 9-UNIMOD:35,17-UNIMOD:35 ms_run[2]:scan=4069 17.944 2 1886.7874 1886.7874 S K 94 111 PSM KQQPPEPEWIGDGESTSPSD 101 sp|Q8NE71-2|ABCF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=6661 24.216 2 2182.9655 2182.9655 P K 6 26 PSM KSLSDNGQPGTPDPADSGGTSA 102 sp|O75691|UTP20_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4513 19.671 2 2057.9138 2057.9138 C K 1731 1753 PSM KSSATVTGEPPSYSSGSDSS 103 sp|P35658-2|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4400 19.245 2 1929.844 1929.8440 L K 490 510 PSM KTAENATSGETLEENEAGD 104 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4504 19.637 2 1964.8447 1964.8447 S - 376 395 PSM KTAEPAQPSSASGSGNSDDAI 105 sp|P39880-4|CUX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4503 19.632 2 1988.8923 1988.8923 Q R 584 605 PSM KTQPSMVSNPGSCSDPQPSPEM 106 sp|Q9H000-2|MKRN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 6-UNIMOD:35,13-UNIMOD:4,22-UNIMOD:35 ms_run[2]:scan=4227 18.552 3 2391.9981 2391.9981 R K 78 100 PSM KVIPAADLSQQISTAGTEASGTGNM 107 sp|P11216|PYGB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 25-UNIMOD:35 ms_run[2]:scan=7125 24.983 3 2462.1959 2462.1959 E K 656 681 PSM RDSSQGPCEPLPGPLTQP 108 sp|O15027-3|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 8-UNIMOD:4 ms_run[2]:scan=7116 24.971 2 1934.9156 1934.9156 A R 100 118 PSM RESAAPAAAPTAEAPPPSVVT 109 sp|Q92841|DDX17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5548 22.353 2 1989.0167 1989.0167 E R 35 56 PSM RQLLSDYGPPSLGYTQGTGNSQVPQS 110 sp|O14519-2|CDKA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=7925 26.458 3 2749.3307 2749.3307 Y K 8 34 PSM RYFEADPPGQVAASPDPTT 111 sp|O43598|DNPH1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=6165 23.435 2 2017.9381 2017.9381 D - 156 175 PSM KSISGTAQDGNTEPLPPDSGD 112 sp|Q86T24|KAISO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=4900 20.844691506666667 2 2086.959403 2084.949822 V K 124 145 PSM KSADGSAPAGEGEGVTLQ 113 sp|Q01650|LAT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 44 ms_run[1]:scan=4973 21.013308945333332 2 1672.790692 1672.790408 A R 30 48 PSM KAASADSTTEGTPADGFTVLST 114 sp|O75367-2|H2AY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=7507 25.659 2 2126.0015 2126.0015 S K 167 189 PSM KDLYANTVLSGGTTMYPGIAD 115 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=8661 28.151 2 2186.0565 2186.0565 R R 291 312 PSM KDPGMGAMGGMGGGMGGGMF 116 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=5403 22.04 2 1865.6875 1865.6875 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 117 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5628 22.516 2 1865.6875 1865.6875 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 118 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 5-UNIMOD:35,8-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=6262 23.587 2 1849.6926 1849.6926 E - 554 574 PSM KEAGSEPAPEQESTEATPAE 119 sp|Q6UN15-5|FIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=4245 18.634 2 2056.9073 2056.9073 G - 569 589 PSM KEDSGSVPSTGPSQGTPISL 120 sp|Q13111|CAF1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6919 24.648 2 1942.9484 1942.9484 P K 850 870 PSM KELASQPDVDGFLVGGASL 121 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=9033 29.445 2 1901.9735 1901.9735 C K 219 238 PSM KEPLTQAVGLSTQAEGT 122 sp|Q5SRE5-2|NU188_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6439 23.861 2 1728.8894 1728.8894 K R 1517 1534 PSM KETFGVNNAVYGIDAMNPSS 123 sp|O75822-3|EIF3J_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=8346 27.322 2 2112.9786 2112.9786 A R 84 104 PSM KEVIAVSCGPAQCQETI 124 sp|P38117|ETFB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 8-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=6357 23.735 2 1888.9023 1888.9023 V R 59 76 PSM KGSLESPATDVFGSTEEGE 125 sp|O00232-2|PSD12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=7332 25.36 2 1938.8694 1938.8694 R K 310 329 PSM KISYIPDEEVSSPSPPQ 126 sp|Q9Y6M1-5|IF2B2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6673 24.237 2 1871.9153 1871.9153 F R 88 105 PSM KLGLGLDDESNNQQAAATQSPGDS 127 sp|Q09472|EP300_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6209 23.505 3 2415.115 2415.1150 E R 1707 1731 PSM KLLEVQPQVANSPSSAAQ 128 sp|Q8NDI1-3|EHBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=5907 23.004 2 1865.9847 1865.9847 K K 882 900 PSM KNVGTGLVGAPACGDVM 129 sp|Q9H1K1-2|ISCU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 13-UNIMOD:4,17-UNIMOD:35 ms_run[2]:scan=5691 22.635 2 1660.7913 1660.7913 S K 32 49 PSM KNVMSAFGLTDDQVSGPPSAPAED 130 sp|Q92734-2|TFG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 4-UNIMOD:35 ms_run[2]:scan=7375 25.43 3 2448.1115 2448.1115 N R 179 203 PSM KPSQVNGAPGSPTEPAGQ 131 sp|Q9BQG0|MBB1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=4082 18.003 2 1720.838 1720.8380 Q K 1257 1275 PSM KQIDSSPVGGETDETTVSQNY 132 sp|O15027-3|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=5648 22.557 3 2254.0237 2254.0237 F R 564 585 PSM KSEIIPMFSNLASDEQDSV 133 sp|P30153|2AAA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 7-UNIMOD:35 ms_run[2]:scan=8555 27.877 2 2124.9885 2124.9885 V R 202 221 PSM KSVPVTVDDDDDDNDPEN 134 sp|P46100-6|ATRX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=4696 20.28 2 1987.8131 1987.8131 S R 1184 1202 PSM KVAAPEIVSGVSGESEQ 135 sp|O15381-3|NVL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6022 23.209 2 1685.8472 1685.8472 L K 131 148 PSM KVTDDMYAEQTENPENPL 136 sp|Q2TAL8|QRIC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6959 24.72 2 2092.9259 2092.9259 Q R 682 700 PSM KYAALSVDGEDENEGEDYAE 137 sp|P23588-2|IF4B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6263 23.588 2 2202.9077 2202.9077 S - 553 573 PSM RALPVEAPPPGPEGAPSAP 138 sp|Q9BVL4|SELO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=6237 23.545 2 1808.9421 1808.9421 L R 56 75 PSM RDASALLDPMECTDTAEEQ 139 sp|Q9BTE3-3|MCMBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 12-UNIMOD:4 ms_run[2]:scan=7869 26.344 2 2150.9096 2150.9096 E R 103 122 PSM RIPSAVGYQPTLATDMGTMQE 140 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=8179 26.946 2 2265.077 2265.0770 G R 324 345 PSM RQPPPAPPEQADGNAPGPQPPPV 141 sp|Q12948|FOXC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=5618 22.497 3 2313.1502 2313.1502 G R 199 222 PSM KPVTTPEEIAQVATISANGD 142 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 43 ms_run[1]:scan=8093 26.77210382666667 2 2040.037136 2040.037515 S K 160 180 PSM KPVTTPEEIAQVATISANGD 143 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 43 ms_run[1]:scan=8263 27.130566006933336 2 2040.037136 2040.037515 S K 160 180 PSM KSGGGTGEEPGSQGLNGEAGPEDST 144 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 43 ms_run[1]:scan=4669 20.210076828266665 3 2316.983376 2316.994206 S R 172 197 PSM KAADIGVAMGQTGTDVC 145 sp|P98194-2|AT2C1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 9-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=4994 21.081 2 1708.776 1708.7760 L K 653 670 PSM KANDGEGGDEEAGTEEAVP 146 sp|Q9H3Q1-2|BORG4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4787 20.534 2 1873.7814 1873.7814 K R 76 95 PSM KATESGAQSAPLPMEGVDISP 147 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 14-UNIMOD:35 ms_run[2]:scan=6664 24.221 2 2100.0045 2100.0045 M K 7 28 PSM KIDLEEECDPPSYTAGQ 148 sp|Q92994-9|TF3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 8-UNIMOD:4 ms_run[2]:scan=6247 23.566 2 1950.8517 1950.8517 M R 44 61 PSM KIETAVTSTPSASGQFS 149 sp|P35658-2|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5576 22.416 2 1709.8472 1709.8472 A K 1184 1201 PSM KIMQSSSEVGYDAMAGDFVNMVE 150 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:35,14-UNIMOD:35,21-UNIMOD:35 ms_run[2]:scan=7471 25.596 3 2555.0866 2555.0866 E K 493 516 PSM KLGLVIPSSGSGSGNQSID 151 sp|Q9ULJ3-2|ZBT21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=7280 25.262 2 1814.9374 1814.9374 S R 312 331 PSM KLNINPEDGMADYSDPSYV 152 sp|Q99459|CDC5L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:35 ms_run[2]:scan=7330 25.358 2 2142.9416 2142.9416 D K 447 466 PSM KPMDTSVLSEEGGEPFQ 153 sp|Q12888|TP53B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 3-UNIMOD:35 ms_run[2]:scan=6859 24.552 2 1865.8353 1865.8353 D K 390 407 PSM KPPGGESSNLFGSPEEATPSS 154 sp|Q9H910-2|JUPI2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6396 23.794 2 2073.9491 2073.9491 M R 2 23 PSM KPVLMALAEGPGAEGP 155 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=8528 27.813 2 1535.8018 1535.8018 T R 575 591 PSM KQPQPPPPPPPAAAQPPPGAP 156 sp|Q5VSL9-4|STRP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5543 22.343 3 2036.0843 2036.0843 N R 16 37 PSM KSTPLSQPSANGVQTEGLDYD 157 sp|Q8N8S7-3|ENAH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6380 23.769 2 2206.039 2206.0390 P R 478 499 PSM KSVEEPTQPGGTGLSDS 158 sp|Q9H0B6-2|KLC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4666 20.2 2 1687.7901 1687.7901 N R 511 528 PSM KTPASGLQTPTSTPAPGSAT 159 sp|Q96DF8|ESS2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5027 21.154 2 1868.948 1868.9480 L R 429 449 PSM KTQTPPVSPAPQPTEE 160 sp|Q14247-3|SRC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4605 19.994 2 1705.8523 1705.8523 A R 361 377 PSM RAPPEPAPPAEATGAPAPS 161 sp|P84157-2|MXRA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4873 20.766 2 1782.8901 1782.8901 A R 39 58 PSM RDASALLDPMECTDTAEEQ 162 sp|Q9BTE3-3|MCMBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 10-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=6477 23.922 2 2166.9045 2166.9045 E R 103 122 PSM RDPQELLEGGNQGEGDPQAEG 163 sp|P49593-2|PPM1F_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6225 23.526 2 2194.9727 2194.9727 L R 310 331 PSM RELGPDGEEAEGPGAGDGPP 164 sp|P18615|NELFE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5301 21.826 2 1905.8341 1905.8341 L R 144 164 PSM RFIIGESQAGEQPTQTVMPGQVM 165 sp|Q9NQX3|GEPH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 18-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=6907 24.63 3 2535.2098 2535.2098 D R 387 410 PSM RGSLQPAPAQPPGDPAAQASVSNGEDAGGGAG 166 sp|O14562|UBFD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=5440 22.123 3 2886.3492 2886.3492 A R 51 83 PSM RIEDSGENLETEPLESQD 167 sp|P78345|RPP38_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6123 23.365 2 2059.9182 2059.9182 D R 211 229 PSM RIPSAVGYQPTLATDMGTMQE 168 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 16-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=6553 24.044 3 2297.0668 2297.0668 G R 324 345 PSM RPLSGPDVGTPQPAGLASGA 169 sp|O96013|PAK4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=6273 23.602 2 1846.9537 1846.9537 K K 178 198 PSM RPLVLPSPLVTPGSNSQE 170 sp|Q96QC0|PP1RA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=8232 27.061 2 1890.0211 1890.0211 P R 465 483 PSM KDATNVGDEGGFAPNILEN 171 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=8188 26.970481986133333 2 1960.905145 1959.917400 G K 202 221 PSM KMEDGTLQAGPGGASGP 172 sp|P54098|DPOG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 2-UNIMOD:35 ms_run[1]:scan=4654 20.158068847733333 2 1588.720822 1587.719886 P R 773 790 PSM KFVEEEDDDEEEEEENLDDQDEQGNL 173 sp|Q7KZ85|SPT6H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 42 ms_run[1]:scan=6837 24.5170085056 3 3141.222801 3140.222547 K K 29 55 PSM KAEAGPEGVAPAPEGE 174 sp|Q9Y4L1|HYOU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=4626 20.065 2 1507.7155 1507.7155 E K 669 685 PSM KAFLASPEYVNLPINGNG 175 sp|P09211|GSTP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8638 28.096 2 1902.984 1902.9840 L K 191 209 PSM KAPVGSVVSVPSQSSASSD 176 sp|P52594-2|AGFG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=5296 21.815 2 1787.8901 1787.8901 G K 314 333 PSM KDTYIIECQGIGMTNPNL 177 sp|O00442|RTCA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 8-UNIMOD:4,13-UNIMOD:35 ms_run[2]:scan=7630 25.882 2 2081.9762 2081.9762 A - 349 367 PSM KEIFEDVIDAANCSSAD 178 sp|Q8TCG1-2|CIP2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 13-UNIMOD:4 ms_run[2]:scan=8780 28.515 2 1882.8255 1882.8255 F R 208 225 PSM KELSQIEACQGPMQM 179 sp|Q96P70|IPO9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 9-UNIMOD:4,13-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5040 21.184 2 1780.7794 1780.7794 F R 631 646 PSM KGEPAAAAAPEAGASPVE 180 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=4762 20.473 2 1621.7948 1621.7948 E K 87 105 PSM KGTGVVTSVPSDSPDDIAAL 181 sp|Q9P2J5-2|SYLC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=7761 26.124 2 1927.9739 1927.9739 D R 330 350 PSM KIGGDAATTVNNSTPDFGFGGQ 182 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=7659 25.93 3 2153.0025 2153.0025 A K 87 109 PSM KIMQSSSEVGYDAMAGDFVNMVE 183 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:35,21-UNIMOD:35 ms_run[2]:scan=7774 26.152 3 2539.0917 2539.0917 E K 493 516 PSM KIMQSSSEVGYDAMAGDFVNMVE 184 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:35,21-UNIMOD:35 ms_run[2]:scan=8648 28.115 3 2539.0917 2539.0917 E K 493 516 PSM KLLSPYSPQTQETDSAVQ 185 sp|Q9P265|DIP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=6122 23.364 2 1990.9848 1990.9848 S K 47 65 PSM KLYDILGVPPGASENEL 186 sp|O60884|DNJA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8978 29.216 2 1813.9462 1813.9462 T K 8 25 PSM KMMDYLQGSGETPQTDV 187 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 2-UNIMOD:35,3-UNIMOD:35 ms_run[2]:scan=5789 22.811 2 1930.8288 1930.8288 G R 337 354 PSM KNPSTNFQEPVQPLTQQQVAQMQL 188 sp|P19623|SPEE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 22-UNIMOD:35 ms_run[2]:scan=7528 25.693 3 2769.3756 2769.3756 S K 253 277 PSM KNVMSAFGLTDDQVSGPPSAPAED 189 sp|Q92734-2|TFG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8588 27.977 3 2432.1166 2432.1166 N R 179 203 PSM KPGPPQPAPAPEGQDL 190 sp|A8CG34|P121C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=5320 21.866 2 1597.81 1597.8100 G R 130 146 PSM KQGLLPLTFADPADYN 191 sp|Q99798|ACON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=9169 30.069 2 1761.8938 1761.8938 K K 701 717 PSM KQSDDEVYAPGLDIESSL 192 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8846 28.735 2 1964.9215 1964.9215 E K 449 467 PSM KQVLVAPGNAGTACSE 193 sp|P22102|PUR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 14-UNIMOD:4 ms_run[2]:scan=4993 21.079 2 1600.7879 1600.7879 V K 28 44 PSM KSSPPSIAPLALDSADLSEE 194 sp|P41214|EIF2D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8539 27.838 2 2026.0106 2026.0106 N K 182 202 PSM KTASDVVQPAAVQAQGQVNDEN 195 sp|Q9BX40-3|LS14B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=5181 21.515 3 2268.0982 2268.0982 S R 151 173 PSM KVEQLGAEGNVEESQ 196 sp|Q9Y383-3|LC7L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=4730 20.396 2 1615.7689 1615.7689 A K 136 151 PSM KVIEGLDTGLQGMCVGE 197 sp|Q96AY3|FKB10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 13-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=6807 24.468 2 1820.8648 1820.8648 N R 434 451 PSM KVTLSFPSTLQTGTGTL 198 sp|P55786-2|PSA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=8769 28.486 2 1749.9513 1749.9513 E K 84 101 PSM KYVVVTGITPTPLGEG 199 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=7828 26.263 2 1629.8978 1629.8978 G K 370 386 PSM RAAVEDINPADDPNNQGEDEFEEAEQV 200 sp|O00461|GOLI4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=7772 26.149 3 3000.2857 3000.2857 D R 542 569 PSM RAIAELGIYPAVDPLDSTS 201 sp|P06576|ATPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=9011 29.35 2 1987.0262 1987.0262 S R 387 406 PSM RAMADPEVQQIMSDPAM 202 sp|P31948-3|STIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 3-UNIMOD:35,12-UNIMOD:35,17-UNIMOD:35 ms_run[2]:scan=5163 21.466 2 1936.8329 1936.8329 R R 464 481 PSM RAVYDEQGTVDEDSPVLTQD 203 sp|Q8WXX5|DNJC9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=6386 23.778 2 2236.0132 2236.0131 Q R 75 95 PSM RDEYDDLSDLNAVQMESV 204 sp|O15173|PGRC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:35 ms_run[2]:scan=8172 26.931 2 2113.911 2113.9110 L R 166 184 PSM RDLPIPGTISSAGDGNSES 205 sp|Q6ZRS2-3|SRCAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=6770 24.408 2 1871.8861 1871.8861 A R 2788 2807 PSM RFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG 206 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=6517 23.994 3 3375.4148 3375.4148 F - 772 807 PSM RIPSAVGYQPTLATDMGTMQE 207 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 19-UNIMOD:35 ms_run[2]:scan=7487 25.62 3 2281.0719 2281.0719 G R 324 345 PSM RLAVPTEVSTEVPEMDTST 208 sp|O00488|ZN593_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 15-UNIMOD:35 ms_run[2]:scan=6793 24.443 2 2076.9885 2076.9885 R - 116 135 PSM RPGTEPQPEMPDTVLQSETL 209 sp|O95202|LETM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:35 ms_run[2]:scan=7401 25.472 2 2240.0631 2240.0631 Q K 506 526 PSM RVSADAAPDCPETSNQTPPGPGAAAGPGID 210 sp|Q9NXH9-2|TRM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:4 ms_run[2]:scan=5698 22.645 3 2875.3043 2875.3043 P - 601 631 PSM RYFDEEEPEDAPSPELDGD 211 sp|Q96F63|CCD97_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=7003 24.789 2 2208.8971 2208.8971 E - 325 344 PSM KSLEYCSTASIDSENPPDLN 212 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 6-UNIMOD:4 ms_run[1]:scan=6508 23.971947497066665 2 2238.999029 2238.995058 W K 3009 3029 PSM KDATNVGDEGGFAPNILEN 213 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 ms_run[1]:scan=8181 26.9536859352 2 1960.905145 1959.917400 G K 202 221 PSM KQQQMPPPPPPPPPPPPAGGTGG 214 sp|O14654|IRS4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 41 5-UNIMOD:35 ms_run[1]:scan=5111 21.349735834133334 3 2243.124258 2242.120474 S K 623 646 PSM KAPPAPLAASEVTNSNSAE 215 sp|Q9Y2U8|MAN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5407 22.045 2 1852.9167 1852.9167 L R 171 190 PSM KASPVTTSPTAATTQNPVLS 216 sp|Q96JN0-2|LCOR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5687 22.626 2 1970.032 1970.0320 P K 35 55 PSM KATDLGGTSQAGTSQ 217 sp|Q7Z2W4-3|ZCCHV_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=3682 16.26 2 1420.6794 1420.6794 S R 314 329 PSM KAVLGSSPFLSEANAE 218 sp|Q8NI60-3|COQ8A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7706 26.023 2 1618.8203 1618.8203 K R 194 210 PSM KAVTVYTNYPFPGETFN 219 sp|P35573-2|GDE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8488 27.703 2 1946.9414 1946.9414 G R 25 42 PSM KDLGLSESGEDVNAAILDESG 220 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8084 26.757 2 2117.9964 2117.9964 V K 463 484 PSM KDLYANTVLSGGTTMYPGIAD 221 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 15-UNIMOD:35 ms_run[2]:scan=8150 26.877 3 2202.0514 2202.0515 R R 291 312 PSM KDPGMGAMGGMGGGMGGGMF 222 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=6804 24.462 2 1833.6977 1833.6977 E - 554 574 PSM KEAAGEGPALYEDPPDQ 223 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5606 22.477 2 1785.8057 1785.8057 D K 35 52 PSM KEEVMGLCIGELNDDT 224 sp|P46736-5|BRCC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 5-UNIMOD:35,8-UNIMOD:4 ms_run[2]:scan=7764 26.134 2 1837.8074 1837.8074 E R 31 47 PSM KEGTSNSTSEDGPGDGFTILSS 225 sp|Q9P0M6|H2AW_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7776 26.156 2 2184.9659 2184.9659 D K 167 189 PSM KENVATTDTLESTTVGTSV 226 sp|Q15046|SYK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6287 23.629 2 1951.9586 1951.9586 K - 579 598 PSM KEVNVSPCPTQPCQLS 227 sp|P61916-2|NPC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 8-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=5363 21.951 2 1842.8604 1842.8604 I K 35 51 PSM KFVLSGANIMCPGLTSPGA 228 sp|Q9ULC4-2|MCTS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:35,11-UNIMOD:4 ms_run[2]:scan=8096 26.778 2 1934.9594 1934.9594 I K 91 110 PSM KGIINDDEDDEDLMMASG 229 sp|O75717|WDHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5771 22.778 2 1998.8034 1998.8034 S R 351 369 PSM KGLLLPSSEEPGPAQEAS 230 sp|Q14674-2|ESPL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6688 24.262 2 1808.9156 1808.9156 W R 1478 1496 PSM KGNDISSGTVLSDYVGSGPP 231 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8203 27.003 2 1948.9378 1948.9378 M K 93 113 PSM KGPASTPTYSPAPTQPAP 232 sp|Q6P1N0-2|C2D1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5144 21.43 2 1766.8839 1766.8839 G R 199 217 PSM KICEQFEAETPTDSETTQ 233 sp|P40855-5|PEX19_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 3-UNIMOD:4 ms_run[2]:scan=5669 22.591 2 2112.9157 2112.9157 C K 189 207 PSM KIIAEGANGPTTPEAD 234 sp|P00367-2|DHE3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=4864 20.736 2 1582.7839 1582.7839 A K 232 248 PSM KLTDEQGEGSQPFEGLE 235 sp|Q96BY7|ATG2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7203 25.13 2 1862.8534 1862.8534 Q K 135 152 PSM KLVPEEETTASENTEITSE 236 sp|Q96T23-3|RSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5642 22.545 2 2105.9852 2105.9852 Y R 457 476 PSM KPADVYLIDEPSAYLDSEQ 237 sp|P61221|ABCE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8817 28.627 2 2152.0212 2152.0212 G R 478 497 PSM KPASSSLPSSPPPQLLT 238 sp|Q99567|NUP88_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6940 24.685 2 1705.9251 1705.9251 E R 41 58 PSM KPIAEAPSAFTLGSEM 239 sp|P49792|RBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 16-UNIMOD:35 ms_run[2]:scan=7359 25.405 2 1663.8127 1663.8127 H K 1812 1828 PSM KSAEIDSDDTGGSAAQ 240 sp|P33176|KINH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=3671 16.205 2 1550.6696 1550.6696 K K 813 829 PSM KSPFVVQVGEACNPNAC 241 sp|O75369-5|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=7010 24.804 2 1875.8608 1875.8608 P R 439 456 PSM KTELEDTLDSTAAQQEL 242 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7933 26.48 2 1890.9058 1890.9058 L R 1145 1162 PSM KTIGGGDDSFNTFFSETGAG 243 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8836 28.697 2 2006.8858 2006.8858 D K 40 60 PSM KTLLVSTSAVDNNEAQ 244 sp|Q5T8P6-3|RBM26_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5657 22.571 2 1688.8581 1688.8581 Q K 682 698 PSM KTVDFTQDSNYLLTGGQD 245 sp|Q9Y3F4|STRAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8285 27.172 2 2000.9327 2000.9327 V K 104 122 PSM KVIEGLDTGLQGMCVGE 246 sp|Q96AY3|FKB10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:4 ms_run[2]:scan=8120 26.817 2 1804.8699 1804.8699 N R 434 451 PSM KVNEASGDGDGEDAVVILE 247 sp|Q96C86|DCPS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7353 25.397 2 1915.9011 1915.9011 G K 67 86 PSM KVTAQGPGLEPSGNIAN 248 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=5295 21.814 2 1651.8529 1651.8529 S K 383 400 PSM KVVAFTGDNPASLAGM 249 sp|O75191-2|XYLB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 16-UNIMOD:35 ms_run[2]:scan=6963 24.728 2 1592.7868 1592.7868 C R 136 152 PSM RAESAPLPVSADDTPEVLN 250 sp|O95674|CDS2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=7266 25.238 2 1979.98 1979.9800 S R 38 57 PSM RATTPADGEEPAPEAEALAAA 251 sp|Q96S44|PRPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6827 24.502 2 2036.9651 2036.9651 A R 5 26 PSM RDDDEGPVSNQGYMPYLN 252 sp|Q9UH65|SWP70_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:35 ms_run[2]:scan=6592 24.1 2 2084.8745 2084.8745 F R 57 75 PSM REAEALLQSMGLTPESPIVPPPMSPSS 253 sp|Q13409-6|DC1I2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 10-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=8319 27.265 3 2852.3936 2852.3936 R K 58 85 PSM REDYDSVEQDGDEPGPQ 254 sp|Q9Y5S9-2|RBM8A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=4818 20.613 2 1934.7766 1934.7766 M R 50 67 PSM REEVDLSPAPESEVEAM 255 sp|Q9Y312|AAR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 17-UNIMOD:35 ms_run[2]:scan=6094 23.323 2 1902.8517 1902.8517 L R 95 112 PSM RGTEAGQVGEPGIPTGEAGPSCSSASD 256 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 22-UNIMOD:4 ms_run[2]:scan=5527 22.316 3 2573.13 2573.1300 E K 220 247 PSM RLPTDASEDADQPAGDSAILL 257 sp|O60826|CCD22_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=8304 27.232 2 2154.0441 2154.0441 E R 107 128 PSM RPQYSNPPVQGEVMEGADNQGAGEQG 258 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 14-UNIMOD:35 ms_run[2]:scan=5119 21.367 3 2730.194 2730.1940 R R 205 231 PSM RQAVLGAGLPISTPCTTIN 259 sp|P24752|THIL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 15-UNIMOD:4 ms_run[2]:scan=8211 27.019 2 1968.0462 1968.0462 T K 105 124 PSM RTQPSSGVDSAVGTLPATSPQSTSVQA 260 sp|Q13428-2|TCOF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=6239 23.547 3 2628.2991 2628.2991 A K 1016 1043 PSM RVADGLPLAASMQEDEQSG 261 sp|O75396|SC22B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 12-UNIMOD:35 ms_run[2]:scan=6234 23.54 2 1988.9109 1988.9109 A R 9 28 PSM RVLSQPMPPTAGEAEQAADQQE 262 sp|Q9NZL4-2|HPBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 7-UNIMOD:35 ms_run[2]:scan=5805 22.835 3 2368.0965 2368.0965 L R 98 120 PSM KPLENGTGFQAQDISGQ 263 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=5935 23.062047389866667 2 1788.874773 1788.864242 E K 1914 1931 PSM KTLSPGDSFSTFDTPYC 264 sp|Q9NQR4|NIT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40 17-UNIMOD:4 ms_run[1]:scan=8212 27.020418812533332 2 1921.839478 1921.840395 S R 130 147 PSM RCELLYEGPPDDEAAMGI 265 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40 2-UNIMOD:4,16-UNIMOD:35 ms_run[1]:scan=7957 26.5198663032 2 2050.897582 2050.897593 Y K 368 386 PSM RSADEPMTTFVVCNECGN 266 sp|P23193|TCEA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40 7-UNIMOD:35,13-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=6013 23.194498503200002 2 2101.847395 2101.850325 T R 279 297 PSM RAEGAAVAGGPGSSAGPPPPSAEAAEPEA 267 sp|O15534|PER1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 40 ms_run[1]:scan=5268 21.74169570533333 3 2558.209668 2557.204474 P R 994 1023 PSM KAALEDSSGSSELQEIM 268 sp|Q12929-2|EPS8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 17-UNIMOD:35 ms_run[2]:scan=6187 23.465 2 1809.8302 1809.8302 Q R 521 538 PSM KAEQLGAEGNVDESQ 269 sp|Q9NQ29-2|LUC7L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4317 18.916 2 1573.722 1573.7220 A K 139 154 PSM KAQGGTVLPTEPQSEEQLS 270 sp|Q14789-3|GOGB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5917 23.019 2 1997.9906 1997.9906 M K 76 95 PSM KATIEVFQQSAETGSSSGSTASNMPSSS 271 sp|Q93074-3|MED12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 24-UNIMOD:35 ms_run[2]:scan=6093 23.321 3 2791.2454 2791.2454 A K 1384 1412 PSM KDALLVGVPAGSNPF 272 sp|P50151|GBG10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8736 28.369 2 1483.8035 1483.8035 C R 45 60 PSM KDATNVGDEGGFAPNILEN 273 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=9315 30.551 2 1959.9174 1959.9174 G K 202 221 PSM KDATNVGDEGGFAPNILEN 274 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=9511 31.242 2 1959.9174 1959.9174 G K 202 221 PSM KDATNVGDEGGFAPNILEN 275 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=9613 31.581 2 1959.9174 1959.9174 G K 202 221 PSM KDFADILVQPTLEEN 276 sp|Q9NU22|MDN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8970 29.187 2 1730.8727 1730.8727 E K 3583 3598 PSM KDLDLLASVPSPSSSGS 277 sp|Q8WU79-3|SMAP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8146 26.87 2 1658.8363 1658.8363 E R 129 146 PSM KDNFTLIPEGTNGTEE 278 sp|Q16555-2|DPYL2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7609 25.843 2 1763.8214 1763.8214 G R 309 325 PSM KDPGMGAMGGMGGGMGGGMF 279 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35 ms_run[2]:scan=8365 27.374 2 1817.7027 1817.7027 E - 554 574 PSM KDVLQAETSQQLCCQ 280 sp|Q9UNH7-2|SNX6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 13-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=5859 22.921 2 1806.824 1806.8240 N K 219 234 PSM KEAAGTTAAAGTGGATEQPP 281 sp|O43290|SNUT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4154 18.305 2 1784.8541 1784.8541 E R 11 31 PSM KECVLPGGETAGDMG 282 sp|P43246-2|MSH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 3-UNIMOD:4,14-UNIMOD:35 ms_run[2]:scan=4956 20.978 2 1535.6596 1535.6596 P K 131 146 PSM KEFQDAGEQVVSSPADVAE 283 sp|P31937|3HIDH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6220 23.519 2 2004.9276 2004.9276 C K 76 95 PSM KEIFLTVPVGGGESL 284 sp|Q53HL2|BOREA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8906 28.958 2 1544.845 1544.8450 S R 225 240 PSM KELGSLPLPLSTSEQ 285 sp|Q86Y82|STX12_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8340 27.311 2 1597.8563 1597.8563 L R 82 97 PSM KEQGVTFPAIGSQAAEQA 286 sp|Q92783-2|STAM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7320 25.333 2 1830.9112 1830.9112 L K 136 154 PSM KEQGVTFPSGDIQEQLI 287 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8630 28.08 2 1887.9578 1887.9578 F R 257 274 PSM KEVIPVNVPEAQEEM 288 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7557 25.748 2 1710.8498 1710.8498 K K 513 528 PSM KFIQQTYPSGGEEQAQYC 289 sp|Q8WUM4|PDC6I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 18-UNIMOD:4 ms_run[2]:scan=5792 22.816 3 2132.9473 2132.9473 V R 23 41 PSM KGEDLCANDSYVTIQNSELMSGSMD 290 sp|O14802|RPC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:4,20-UNIMOD:35,24-UNIMOD:35 ms_run[2]:scan=7148 25.03 3 2795.1572 2795.1572 G K 627 652 PSM KGIGMGNIGPAGMGMEGIGFGIN 291 sp|P52272-2|HNRPM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=8565 27.902 3 2209.033 2209.0330 N K 283 306 PSM KGQPVDLSAMPPAPEDL 292 sp|Q5T0F9-3|C2D1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:35 ms_run[2]:scan=7236 25.187 2 1779.8713 1779.8713 E K 16 33 PSM KITENIGCVMTGMTADS 293 sp|P60900-2|PSA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 8-UNIMOD:4,10-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=5317 21.86 2 1858.8111 1858.8111 F R 52 69 PSM KLFVYDPNNPPSSEVL 294 sp|Q15165-3|PON2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8632 28.084 2 1817.92 1817.9200 Q R 277 293 PSM KLLQFQDLTGIESMDQC 295 sp|Q96CS3|FAF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 14-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=8838 28.704 2 2040.9496 2040.9496 E R 16 33 PSM KLNQSGTSVGTDEESDVTQEEE 296 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5026 21.152 3 2381.0354 2381.0354 A R 2283 2305 PSM KLVTEMGTYATQSALSSS 297 sp|P53618|COPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 6-UNIMOD:35 ms_run[2]:scan=5783 22.801 2 1888.9088 1888.9088 Q R 513 531 PSM KNVIVNGLVLASDGQ 298 sp|P41252|SYIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8006 26.608 2 1525.8464 1525.8464 F K 585 600 PSM KPPAPPSLPAGPPGV 299 sp|Q15428|SF3A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7024 24.826 2 1380.7765 1380.7765 E K 216 231 PSM KPQEVPQENGMEDPSISFS 300 sp|O00567|NOP56_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 11-UNIMOD:35 ms_run[2]:scan=6455 23.889 2 2133.9525 2133.9525 Q K 486 505 PSM KPVGSDPDFQPELSGAGS 301 sp|O43396|TXNL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6408 23.815 2 1786.8374 1786.8374 V R 5 23 PSM KPVLMALAEGPGAEGP 302 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35 ms_run[2]:scan=7055 24.879 2 1551.7967 1551.7967 T R 575 591 PSM KPVLMALAEGPGAEGP 303 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 5-UNIMOD:35 ms_run[2]:scan=7262 25.23 2 1551.7967 1551.7967 T R 575 591 PSM KPVLMALAEGPGAEGP 304 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8626 28.071 2 1535.8018 1535.8018 T R 575 591 PSM KPVSTTNLQDPGVLGCP 305 sp|Q92621|NU205_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 16-UNIMOD:4 ms_run[2]:scan=6653 24.201 2 1781.8982 1781.8982 K R 1013 1030 PSM KQIVGTPVNSEDSDT 306 sp|Q5QJE6|TDIF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4723 20.376 2 1588.758 1588.7580 E R 227 242 PSM KQTVIQDPMPMEPQGQ 307 sp|Q92538-3|GBF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 9-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4832 20.652 2 1857.8601 1857.8601 F K 1714 1730 PSM KSEDAEVLDATPSGIM 308 sp|Q5JSH3-4|WDR44_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 16-UNIMOD:35 ms_run[2]:scan=6345 23.716 2 1677.7767 1677.7767 E K 781 797 PSM KSSSPAPADIAQTVQEDL 309 sp|Q13283|G3BP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8717 28.316 2 1855.9163 1855.9163 Q R 229 247 PSM KTEDESLVENNDNIDEEA 310 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5782 22.799 2 2062.8815 2062.8815 E R 58 76 PSM KTEPVSGEENSPDISAT 311 sp|Q86T82-2|UBP37_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4756 20.456 2 1759.8112 1759.8112 W R 380 397 PSM KTILDPLTLVQGNQNED 312 sp|Q5W0B1|OBI1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=9016 29.366 2 1896.9793 1896.9793 I K 125 142 PSM KTTGYPQTEGLLGDCML 313 sp|Q99963-2|SH3G3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 15-UNIMOD:4,16-UNIMOD:35 ms_run[2]:scan=8157 26.893 2 1898.8754 1898.8754 V K 13 30 PSM KVLPMNTGVEAGETAC 314 sp|P04181|OAT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 16-UNIMOD:4 ms_run[2]:scan=5758 22.759 2 1675.7909 1675.7909 H K 135 151 PSM RAEPGQQQPAAEPPPAEGLL 315 sp|P55884|EIF3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7158 25.048 3 2055.0385 2055.0385 E R 16 36 PSM RDDDEGPVSNQGYMPYLN 316 sp|Q9UH65|SWP70_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=8038 26.668 2 2068.8796 2068.8796 F R 57 75 PSM REASDTGQPIVFSQPESDEA 317 sp|Q8TB37|NUBPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6632 24.17 2 2161.9764 2161.9764 I K 281 301 PSM RELGPDGEEAEGPGAGDGPP 318 sp|P18615|NELFE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5234 21.65 2 1905.8341 1905.8341 L R 144 164 PSM RPAEPVAGAATPSLVEQQ 319 sp|Q9BTC0|DIDO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5947 23.089 2 1819.9428 1819.9428 E K 1459 1477 PSM RPAGPAGDEPAESPSETPGP 320 sp|Q9NZT2-2|OGFR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4785 20.529 2 1917.8704 1917.8704 P S 545 565 PSM RPEVPEIQECPIAQESLESQEQ 321 sp|Q9H840|GEMI7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 10-UNIMOD:4 ms_run[2]:scan=8026 26.64 3 2595.2123 2595.2123 L R 35 57 PSM RPLETPLQSSTPTIVDADG 322 sp|Q8NCN5|PDPR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=7402 25.475 2 1996.0113 1996.0113 T R 271 290 PSM RQAEDVLPPTSDQPLPDT 323 sp|Q9NWA0|MED9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=6674 24.24 2 1977.9643 1977.9643 G K 10 28 PSM RQVMVVPVGPTCDEYAQ 324 sp|P26639|SYTC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 4-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=6285 23.623 2 1963.9132 1963.9132 P K 619 636 PSM RSADEPMTTFVVCNECGN 325 sp|P23193-2|TCEA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 13-UNIMOD:4,16-UNIMOD:4 ms_run[2]:scan=7336 25.367 2 2085.8554 2085.8554 T R 258 276 PSM RTQPDGTSVPGEPASPISQ 326 sp|Q14980-5|NUMA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5525 22.314 2 1922.9334 1922.9334 P R 607 626 PSM KVLLGFSSDESDVEASP 327 sp|Q9Y2U8|MAN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 39 ms_run[1]:scan=7773 26.150718505333334 2 1779.862022 1778.857425 S R 134 151 PSM KDPGMGAMGGMGGGMGGGMF 328 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 39 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=5382 21.9958902408 2 1865.686940 1865.687483 E - 554 574 PSM KAAPPPPPPPPPLESSP 329 sp|Q5T4S7-3|UBR4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5862 22.926 2 1674.8981 1674.8981 E R 605 622 PSM KAGAPPPSGSAVSTAPQQ 330 sp|P78362|SRPK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=3915 17.35 2 1649.8373 1649.8373 Q K 241 259 PSM KALTLPGSSENEYIM 331 sp|P55060-4|XPO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:35 ms_run[2]:scan=7056 24.88 2 1667.8076 1667.8076 F K 503 518 PSM KALVGLVNDESPEIQAQCN 332 sp|O43156|TTI1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 18-UNIMOD:4 ms_run[2]:scan=7084 24.922 2 2084.0208 2084.0208 L K 334 353 PSM KAPEDAGPQPGSYEI 333 sp|Q9Y5Z4|HEBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6173 23.444 2 1557.7311 1557.7311 W R 26 41 PSM KAPQETYADIGGLDNQIQEI 334 sp|P62191-2|PRS4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8620 28.059 3 2202.0804 2202.0804 E K 105 125 PSM KATLLEDQQDPSPSS 335 sp|Q9HC35-2|EMAL4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5083 21.294 2 1614.7737 1614.7737 A - 909 924 PSM KCDPSTPAPASSAALN 336 sp|Q8IZD4-2|DCP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:4 ms_run[2]:scan=4567 19.875 2 1585.7406 1585.7406 N R 266 282 PSM KDVQDSLTVSNEAQTA 337 sp|P52907|CAZA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5370 21.966 2 1704.8166 1704.8166 H K 210 226 PSM KEACGGPSAMATPENLASLM 338 sp|Q14781|CBX2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:4,10-UNIMOD:35,20-UNIMOD:35 ms_run[2]:scan=6564 24.061 2 2065.9119 2065.9119 A K 219 239 PSM KEEDGSLSLDGADSTGVVA 339 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6781 24.426 2 1848.8589 1848.8589 L K 676 695 PSM KEFLPEGQDIGAFVAEQ 340 sp|Q04637-6|IF4G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8792 28.559 2 1876.9207 1876.9207 W K 1208 1225 PSM KELGSLPLPLSTSEQ 341 sp|Q86Y82|STX12_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8296 27.205 2 1597.8563 1597.8563 L R 82 97 PSM KENPVLDVVSNPEQTAGEE 342 sp|Q12888|TP53B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=7315 25.323 2 2053.9804 2053.9804 H R 54 73 PSM KEPEPPGVVGGPGE 343 sp|Q86SF2|GALT7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5088 21.302 2 1347.667 1347.6670 P K 138 152 PSM KFFGGYVPEMVLTPDDQ 344 sp|P56192|SYMC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:35 ms_run[2]:scan=8686 28.229 2 1957.9132 1957.9132 S R 663 680 PSM KGAEAANVTGPDGVPVEGS 345 sp|P16989-2|YBOX3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5244 21.679 2 1753.8483 1753.8483 E R 150 169 PSM KGDVEEDETIPDSEQDI 346 sp|Q92973-3|TNPO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6272 23.599 2 1917.8327 1917.8327 L R 277 294 PSM KGEIGDATPFNDAVNVQ 347 sp|P30876|RPB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=7235 25.186 2 1773.8533 1773.8533 N K 993 1010 PSM KIIPLYSTLPPQQQQ 348 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8280 27.162 2 1752.9774 1752.9774 I R 384 399 PSM KLEAEGEAMEDAAAPGDD 349 sp|P56181-2|NDUV3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:35 ms_run[2]:scan=4631 20.078 2 1833.7575 1833.7575 L R 399 417 PSM KLISGDAEPTPEQEE 350 sp|O75592-2|MYCB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5022 21.141 2 1641.7734 1641.7734 G K 3912 3927 PSM KLLPEYPGVLSDVQEE 351 sp|P00374-2|DYR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8566 27.905 2 1814.9302 1814.9302 Y K 106 122 PSM KLNQVCFDDDGTSSPQD 352 sp|Q8N1F7-2|NUP93_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:4 ms_run[2]:scan=5749 22.744 2 1924.8109 1924.8109 L R 294 311 PSM KLPTPVNQATLSQTQGSE 353 sp|Q86T24|KAISO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5852 22.911 2 1897.9745 1897.9745 Q K 248 266 PSM KLVQNGTEPSSLPFLDPNA 354 sp|P27708|PYR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8763 28.459 2 2026.0371 2026.0371 G R 137 156 PSM KLVTEMGTYATQSALSSS 355 sp|P53618|COPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=7234 25.185 2 1872.9139 1872.9139 Q R 513 531 PSM KMELDLEPDTSYGGTL 356 sp|Q7Z309-4|F122B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35 ms_run[2]:scan=7903 26.408 2 1783.8186 1783.8186 E R 5 21 PSM KMNAQETATGMAFEEPIDE 357 sp|O43719|HTSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=6243 23.555 2 2142.9086 2142.9086 S K 410 429 PSM KMTNGFSGADLTEICQ 358 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 2-UNIMOD:35,15-UNIMOD:4 ms_run[2]:scan=7223 25.167 2 1786.7866 1786.7866 A R 677 693 PSM KPDVMYADIGGMDIQ 359 sp|P43686-2|PRS6B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 5-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=6350 23.724 2 1683.7484 1683.7484 Q K 128 143 PSM KSELVANNVTLPAGEQ 360 sp|P42167-3|LAP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6174 23.446 2 1668.8683 1668.8683 L R 17 33 PSM KSLLQMVPLDEGASE 361 sp|Q01968-2|OCRL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:35 ms_run[2]:scan=7779 26.163 2 1631.8076 1631.8076 E R 707 722 PSM KSYLPPPEQPSSGSL 362 sp|Q5T8P6-3|RBM26_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6195 23.48 2 1585.7988 1585.7988 T K 79 94 PSM KTDMDNQIVVSDYAQMD 363 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:35 ms_run[2]:scan=7046 24.866 2 1987.8503 1987.8503 P R 257 274 PSM KTGIEQGSDAGYLCESQ 364 sp|P40939|ECHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 14-UNIMOD:4 ms_run[2]:scan=5559 22.376 2 1841.8102 1841.8102 V K 309 326 PSM KTLGTMIAGDTSGDY 365 sp|P20073-2|ANXA7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 6-UNIMOD:35 ms_run[2]:scan=5806 22.837 2 1544.7028 1544.7028 Q R 442 457 PSM KVEDPTFLNQLQSGVN 366 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8424 27.527 2 1787.9054 1787.9054 D R 235 251 PSM KVIFPDAEMEDVNNPGL 367 sp|Q96SZ6-2|CK5P1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 9-UNIMOD:35 ms_run[2]:scan=7836 26.278 2 1902.9033 1902.9033 L R 442 459 PSM KVTDTQEAECAGPPVPDP 368 sp|Q99614|TTC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 10-UNIMOD:4 ms_run[2]:scan=5522 22.307 2 1909.8728 1909.8728 L K 19 37 PSM KVTNGAFTGEISPGMI 369 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 15-UNIMOD:35 ms_run[2]:scan=7511 25.667 2 1636.8131 1636.8131 Y K 69 85 PSM KYEEDYYEDDEEDDPDAL 370 sp|Q96P70|IPO9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6910 24.635 2 2251.8441 2251.8441 S K 978 996 PSM KYTEEDPSGETLSSEN 371 sp|Q2NKX8|ERC6L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=4781 20.52 2 1784.7588 1784.7588 S K 1140 1156 PSM KYVLVAGITPTPLGEG 372 sp|Q6UB35|C1TM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8475 27.664 2 1613.9029 1613.9029 G K 413 429 PSM PRAQPSSASYQPVPADPFAIVS 373 sp|Q4VCS5-2|AMOT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8835 28.695 3 2284.1488 2284.1488 M R 2 24 PSM RAGLAMPGPPLGPVLGQ 374 sp|Q9Y3B7-3|RM11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8782 28.52 2 1629.9025 1629.9025 V R 25 42 PSM RDADEEGEGDEETPTSAPGSSLAG 375 sp|P36915-2|GNL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5188 21.528 2 2375.9837 2375.9837 D R 395 419 PSM RDPDAQPGGELMLGGTDS 376 sp|P07339|CATD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 12-UNIMOD:35 ms_run[2]:scan=6020 23.206 2 1830.8054 1830.8054 S K 235 253 PSM RDVAWAPSIGLPTSTIASCSQDG 377 sp|P55735-2|SEC13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 19-UNIMOD:4 ms_run[2]:scan=8798 28.577 3 2388.138 2388.1380 V R 202 225 PSM REDSAPVATAAAAGQVQQQQQ 378 sp|Q8TAE6|PP14C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=4998 21.088 3 2153.0461 2153.0461 S R 44 65 PSM RFDPSAVPLPDTDMDSL 379 sp|Q8TEA1|NSUN6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 14-UNIMOD:35 ms_run[2]:scan=8432 27.549 2 1890.8669 1890.8669 Q R 423 440 PSM RGPIPSGMQGPSPINMGAVVPQGS 380 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=6254 23.575 3 2365.1518 2365.1519 P R 458 482 PSM RLPPNTNDEVDEDPTGN 381 sp|Q15393|SF3B3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=4715 20.352 2 1881.8341 1881.8341 V K 1057 1074 PSM RPVETTLENNEGGQEQGPSVEGLNVPT 382 sp|Q9NP61-2|ARFG3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=7453 25.556 3 2850.3632 2850.3632 S K 134 161 PSM RPVTVEPMDQLDDEEGLPE 383 sp|Q15233|NONO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 8-UNIMOD:35 ms_run[2]:scan=6824 24.498 2 2183.9892 2183.9892 P K 220 239 PSM RSAELPDAVGPIVQLQE 384 sp|Q96PU8-5|QKI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=8480 27.682 2 1820.9632 1820.9632 K K 68 85 PSM RSLDGAPIGVMDQSLM 385 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 11-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=6471 23.915 2 1720.8124 1720.8124 S K 549 565 PSM RTIAATPIQTLPQSQSTP 386 sp|P14859-4|PO2F1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=6490 23.939 2 1909.0269 1909.0269 T K 254 272 PSM RVEDYEPYPDDGMGYGDYP 387 sp|O95169-3|NDUB8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 13-UNIMOD:35 ms_run[2]:scan=7287 25.274 2 2252.8844 2252.8844 M K 27 46 PSM KGAEAANVTGPGGVPVQGS 388 sp|P67809|YBOX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 ms_run[1]:scan=4987 21.057631573600002 2 1694.858893 1694.858763 E K 118 137 PSM KDPGMGAMGGMGGGMGGGMF 389 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 38 19-UNIMOD:35 ms_run[1]:scan=7927 26.46073316 2 1817.702103 1817.702738 E - 554 574 PSM KAAAPAPEEEMDECEQALAAEP 390 sp|P26641|EF1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:4 ms_run[2]:scan=7499 25.642 2 2356.0199 2356.0199 K K 253 275 PSM KALTSADGASEEQSQNDEDNQGSE 391 sp|Q92552|RT27_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=3929 17.413 3 2509.0324 2509.0324 L K 288 312 PSM KAPPTACYAGAAPAPSQV 392 sp|P17676-3|CEBPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:4 ms_run[2]:scan=5442 22.126 2 1755.8614 1755.8614 A K 44 62 PSM KATEPPSPDAGELSLAS 393 sp|Q8IYB8|SUV3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6296 23.648 2 1668.8206 1668.8206 S R 719 736 PSM KDDPVTNLNNAFEVAE 394 sp|O43707|ACTN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8307 27.242 2 1774.8374 1774.8374 R K 217 233 PSM KDDVIVTASNFSSE 395 sp|O00178|GTPB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6692 24.27 2 1510.7151 1510.7151 S R 344 358 PSM KDIQDSLTVSNEVQTA 396 sp|P47755|CAZA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6498 23.951 2 1746.8636 1746.8636 H K 210 226 PSM KDPLLASGTDGVGT 397 sp|P22102|PUR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5876 22.952 2 1329.6776 1329.6776 F K 485 499 PSM KEEGETADTVGCCSL 398 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=5349 21.921 2 1654.6815 1654.6815 E R 493 508 PSM KELEALMPSAAGQE 399 sp|Q14562|DHX8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:35 ms_run[2]:scan=5432 22.107 2 1488.713 1488.7130 L K 147 161 PSM KELVQVQTLMDNMTLE 400 sp|Q15075|EEA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 10-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=7193 25.11 2 1922.9329 1922.9329 K R 228 244 PSM KEPGVEDTEWSNTQTEEAIQT 401 sp|Q99986|VRK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6789 24.435 3 2391.0714 2391.0714 S R 366 387 PSM KEPIEEEPTGAGLN 402 sp|Q6IQ49-3|SDE2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5251 21.699 2 1482.7202 1482.7202 S K 232 246 PSM KEQGVTFPSGDIQEQLI 403 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8771 28.491 2 1887.9578 1887.9578 F R 257 274 PSM KESDDALTVNEETSEENNQMEESDVSQAE 404 sp|Q9NY27-3|PP4R2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 20-UNIMOD:35 ms_run[2]:scan=5663 22.58 3 3272.327 3272.3270 E K 271 300 PSM KESLQDTQPVGVLVDCC 405 sp|Q9H0A0-2|NAT10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=7408 25.486 2 1946.9078 1946.9078 L K 167 184 PSM KESPGAPPAFASPPDPWG 406 sp|Q9HAH7|FBRS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8423 27.523 2 1806.8577 1806.8577 Q R 208 226 PSM KEVIPVNVPEAQEEM 407 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:35 ms_run[2]:scan=6548 24.037 2 1726.8448 1726.8448 K K 513 528 PSM KFAQEQIAPLVSTMDENS 408 sp|P45954|ACDSB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:35 ms_run[2]:scan=7095 24.937 2 2022.9568 2022.9568 K K 70 88 PSM KFSAPVVPSSFNFGGPAPGMN 409 sp|O95373|IPO7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 20-UNIMOD:35 ms_run[2]:scan=8731 28.354 3 2123.0146 2123.0146 Y - 1018 1039 PSM KFSIYPPIPGEESSL 410 sp|P82912-2|RT11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8894 28.912 2 1662.8505 1662.8505 T R 58 73 PSM KGAEPETGSAVSAAQCQGPT 411 sp|Q9UI10-3|EI2BD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:4 ms_run[2]:scan=4516 19.685 2 1944.8847 1944.8847 E R 54 74 PSM KGEVYPFGIVGMAN 412 sp|O75534-2|CSDE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:35 ms_run[2]:scan=8264 27.133 2 1496.7334 1496.7334 M K 597 611 PSM KGILFVGSGVSGGEEGA 413 sp|P52209-2|6PGD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7693 26 2 1562.794 1562.7940 A R 106 123 PSM KGVIQVYDLGQDGQGMS 414 sp|O75694-2|NU155_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:35 ms_run[2]:scan=7100 24.948 2 1809.8567 1809.8567 E R 238 255 PSM KIAEENGAAFAGGTSLIQ 415 sp|Q9BYD6|RM01_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7411 25.49 2 1775.9054 1775.9054 V K 168 186 PSM KIIPLYSTLPPQQQQ 416 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7377 25.434 2 1752.9774 1752.9774 I R 384 399 PSM KIIQGQGVDEPLSETGF 417 sp|Q9NQ88|TIGAR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7927 26.461 2 1816.9207 1816.9207 E K 20 37 PSM KLEDTENWLYEDGEDQP 418 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8121 26.82 2 2079.8909 2079.8909 L K 651 668 PSM KLEEDINSSMTNSTAAS 419 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5408 22.048 2 1796.8098 1796.8098 D R 78 95 PSM KLGIYDADGDGDFDVDDA 420 sp|Q12797-10|ASPH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8176 26.942 2 1899.801 1899.8010 G K 57 75 PSM KLGLPPLTPEQQEALQ 421 sp|Q9UHX1-4|PUF60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8047 26.691 2 1760.9672 1760.9672 A K 10 26 PSM KLLENISPADVGGMEET 422 sp|Q92538-3|GBF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:35 ms_run[2]:scan=6971 24.74 2 1817.8717 1817.8717 T R 1595 1612 PSM KLMTIMDSMNDQELDSTDGA 423 sp|P61011-2|SRP54_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35,6-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=5546 22.348 3 2261.9338 2261.9338 K K 325 345 PSM KLMTIMDSMNDQELDSTDGA 424 sp|P61011-2|SRP54_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=6578 24.08 3 2245.9389 2245.9389 K K 325 345 PSM KLPQVAEEISGPLTSAN 425 sp|O75955-2|FLOT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8171 26.929 2 1752.9258 1752.9258 E K 312 329 PSM KLSEGSQPAEEEEDQETPS 426 sp|Q9UKV3-5|ACINU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=4369 19.124 2 2088.8971 2088.8971 A R 238 257 PSM KLSPPYSSPQEFAQDVG 427 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7823 26.254 2 1848.8894 1848.8894 E R 750 767 PSM KLVQDVANNTNEEAGDGTTTATVLA 428 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6460 23.898 3 2531.2351 2531.2351 A R 96 121 PSM KMDAPDGCPPAVYEVM 429 sp|P41240|CSK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 2-UNIMOD:35,8-UNIMOD:4 ms_run[2]:scan=7531 25.698 2 1794.7627 1794.7627 Y K 404 420 PSM KNAVITVPAYFNDSQ 430 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7875 26.354 2 1665.8362 1665.8362 A R 187 202 PSM KNAVITVPAYFNDSQ 431 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8055 26.709 2 1665.8362 1665.8362 A R 187 202 PSM KNPGYPQSEGLLGECMI 432 sp|Q99961|SH3G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:4,16-UNIMOD:35 ms_run[2]:scan=7819 26.245 2 1907.8757 1907.8757 V R 82 99 PSM KPAVAPPAPPSSSQLC 433 sp|Q6PJT7-8|ZC3HE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:4 ms_run[2]:scan=5475 22.191 2 1605.8185 1605.8185 P R 213 229 PSM KQDLLPADQAQVLNEMA 434 sp|Q6PL24|TMED8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:35 ms_run[2]:scan=7221 25.164 2 1898.9408 1898.9408 V K 95 112 PSM KQLIEPVQYDEQGMAFS 435 sp|P82933|RT09_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:35 ms_run[2]:scan=7308 25.312 2 1997.9404 1997.9404 K K 254 271 PSM KQMTDVLLTPATDAL 436 sp|Q8N1F7-2|NUP93_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8734 28.363 2 1615.8491 1615.8491 V K 105 120 PSM KSAEIDSDDTGGSAAQ 437 sp|P33176|KINH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=3593 15.824 2 1550.6696 1550.6696 K K 813 829 PSM KSEAAGSPDQGSTYSPA 438 sp|Q96S66-4|CLCC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=4215 18.506 2 1651.7326 1651.7326 L R 333 350 PSM KSVVIDCSSSQPQFCNAGSN 439 sp|Q9HAS0|NJMU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=5654 22.567 3 2183.9576 2183.9576 H R 274 294 PSM KTAENATSGETLEENEAGD 440 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=4587 19.927 2 1964.8447 1964.8447 S - 376 395 PSM KTDMDNQIVVSDYAQMD 441 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 16-UNIMOD:35 ms_run[2]:scan=6551 24.041 2 1987.8503 1987.8503 P R 257 274 PSM KTQQGVPAQPADFQAEVESDT 442 sp|P10586-2|PTPRF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7275 25.257 3 2245.0499 2245.0499 V R 506 527 PSM KTVTNAVVTVPAYFNDSQ 443 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8133 26.847 2 1952.9844 1952.9844 G R 137 155 PSM KVGVSQQPEDSQQDLPGE 444 sp|O15031|PLXB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5154 21.449 2 1939.9123 1939.9123 S R 1560 1578 PSM KVLPMNTGVEAGETAC 445 sp|P04181|OAT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 5-UNIMOD:35,16-UNIMOD:4 ms_run[2]:scan=4824 20.632 2 1691.7859 1691.7859 H K 135 151 PSM KVPSPLEGSEGDGDTD 446 sp|Q9Y606-2|TRUA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5165 21.473 2 1601.7057 1601.7057 A - 384 400 PSM KVQEETTLVDDPFQM 447 sp|Q9NZ63|TLS1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 15-UNIMOD:35 ms_run[2]:scan=7966 26.537 2 1794.8346 1794.8346 E K 57 72 PSM KVSYIPDEQIAQGPENG 448 sp|Q9NZI8|IF2B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6472 23.917 2 1843.8952 1843.8952 L R 150 167 PSM KVTDDMYAEQTENPENPL 449 sp|Q2TAL8|QRIC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 6-UNIMOD:35 ms_run[2]:scan=6155 23.416 2 2108.9208 2108.9208 Q R 682 700 PSM KYEFVVTSGSPVAAD 450 sp|Q8NFG4|FLCN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7209 25.142 2 1568.7722 1568.7722 S R 462 477 PSM RALGEPITLFGEGPAE 451 sp|O43172-2|PRP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8827 28.666 2 1655.8519 1655.8519 L R 112 128 PSM RDMESDYSGQGVDQLQ 452 sp|P04818|TYSY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 3-UNIMOD:35 ms_run[2]:scan=5311 21.847 2 1842.769 1842.7690 Y R 147 163 PSM RDPDAQPGGELMLGGTDS 453 sp|P07339|CATD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6863 24.558 2 1814.8105 1814.8105 S K 235 253 PSM RELPYDPVDTEGFGEGGDMQE 454 sp|Q8NC60|NOA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 19-UNIMOD:35 ms_run[2]:scan=7843 26.292 3 2355.9801 2355.9801 G R 50 71 PSM RGIVNGAAPELPVPTGGPAVGA 455 sp|P21281|VATB2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8017 26.625 2 1999.0851 1999.0851 M R 7 29 PSM RLGAPQQPGPGPPPS 456 sp|Q96CX2|KCD12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=4799 20.567 2 1454.763 1454.7630 R R 128 143 PSM RLPEQPVDVPSEIADSSMT 457 sp|P18583-2|SON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 18-UNIMOD:35 ms_run[2]:scan=7534 25.702 2 2085.9888 2085.9889 L R 338 357 PSM RNPIPFPETFDGDTD 458 sp|Q9BWD3|RTL8A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8479 27.68 2 1719.774 1719.7740 W R 24 39 PSM RPAMEPGNGSLDLGGDSAG 459 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 4-UNIMOD:35 ms_run[2]:scan=5555 22.368 2 1815.8057 1815.8057 G R 50 69 PSM RPAPVAQPPAAAPPSAVGSSAAAP 460 sp|Q9Y6H1|CHCH2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5451 22.142 3 2137.128 2137.1280 P R 27 51 PSM RPVTVEPMDQLDDEEGLPE 461 sp|Q15233|NONO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=7993 26.584 2 2167.9943 2167.9943 P K 220 239 PSM RQDLPSSLPEPETQAPP 462 sp|P49593-2|PPM1F_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6610 24.131 2 1860.9218 1860.9218 R R 332 349 PSM RSAGLAPDCEASATAETTVSSVGTCEAAG 463 sp|Q9NQE9|HINT3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 9-UNIMOD:4,25-UNIMOD:4 ms_run[2]:scan=6666 24.225 3 2825.2444 2825.2444 N K 8 37 PSM RSPSGGAAGPLLTPSQSLDGS 464 sp|Q96CX2|KCD12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=6852 24.542 2 1953.9756 1953.9756 S R 184 205 PSM RTDYNASVSVPDSSGPE 465 sp|P61978-3|HNRPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5420 22.083 2 1779.7911 1779.7911 L R 69 86 PSM RTTITTTTTSSSGLGSPMIVGSP 466 sp|Q96S97|MYADM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 18-UNIMOD:35 ms_run[2]:scan=6509 23.977 2 2267.1315 2267.1315 T R 7 30 PSM RVADGLPLAASMQEDEQSG 467 sp|O75396|SC22B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 12-UNIMOD:35 ms_run[2]:scan=6002 23.175 2 1988.9109 1988.9109 A R 9 28 PSM RVPASETSPGPPPMGPPPPSS 468 sp|Q9HD15|SRA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 14-UNIMOD:35 ms_run[2]:scan=4847 20.691 3 2056.9888 2056.9888 P K 62 83 PSM RYDSIPVSTSLLGDTSDTTSTGLAQ 469 sp|Q5JS54-3|PSMG4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=8545 27.851 3 2584.2504 2584.2504 S R 57 82 PSM KTDLNPDNLQGGDDLD 470 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 37 ms_run[1]:scan=6144 23.397170109599998 2 1728.7822 1728.7797 H P 107 123 PSM REVEEELATSGGQSPTGEQIPQFQQ 471 sp|Q9UPN3|MACF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=7407 25.484458784266668 3 2746.294375 2744.288932 L R 5579 5604 PSM KTSSAETPTIPLGSAVEAI 472 sp|Q16891|MIC60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 37 ms_run[1]:scan=8650 28.119545012533333 2 1870.980979 1870.988774 M K 581 600 PSM KADQGNPYDADDIQESISQEL 473 sp|Q9NQ92|COPRS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8811 28.613 3 2335.0452 2335.0452 L K 121 142 PSM KADVIQATGDAICIF 474 sp|Q08945|SSRP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:4 ms_run[2]:scan=8985 29.245 2 1620.8181 1620.8181 S R 188 203 PSM KADVLTTGAGNPVGD 475 sp|P04040|CATA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5305 21.834 2 1413.71 1413.7100 Q K 23 38 PSM KAECSEDVENLNAPPAEAGYDQN 476 sp|Q86UP3|ZFHX4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4 ms_run[2]:scan=5773 22.782 3 2520.0711 2520.0711 F K 2729 2752 PSM KAGAFPPPAIPSAPGSQA 477 sp|Q9Y6R0|NUMBL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6708 24.294 2 1662.873 1662.8730 G R 536 554 PSM KAGAPPPSGSAVSTAPQQ 478 sp|P78362|SRPK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=4014 17.74 2 1649.8373 1649.8373 Q K 241 259 PSM KALGDSSPSQAMQEYIAVV 479 sp|Q9BR61|ACBD6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:35 ms_run[2]:scan=7568 25.768 2 2008.9776 2008.9776 W K 100 119 PSM KALLGPAPEDEDE 480 sp|Q96EK5|KBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5448 22.135 2 1382.6565 1382.6565 V R 47 60 PSM KALQDMSSTAPPAPQPST 481 sp|O15357-2|SHIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35 ms_run[2]:scan=4417 19.313 2 1841.8829 1841.8829 L R 42 60 PSM KAPAQTPAEPTPGYEVGQ 482 sp|P49815-7|TSC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5229 21.63 2 1839.9003 1839.9003 S R 1660 1678 PSM KAPGEQTVPALNLQNAF 483 sp|Q9Y5B9|SP16H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8741 28.385 2 1796.9421 1796.9421 I R 606 623 PSM KASVPTIQDQASAMQLSQCA 484 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 14-UNIMOD:35,19-UNIMOD:4 ms_run[2]:scan=6120 23.362 3 2149.0144 2149.0144 A K 1005 1025 PSM KAVGTPGGGGGGAVPGISAMS 485 sp|P48634-2|PRC2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 20-UNIMOD:35 ms_run[2]:scan=5381 21.994 2 1742.8621 1742.8621 P R 1336 1357 PSM KAVLEQFGFPLTGTEA 486 sp|Q9Y2C4|EXOG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=9125 29.855 2 1706.8879 1706.8879 E R 59 75 PSM KAVTEGAQAVEEPSIC 487 sp|P28331-3|NDUS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:4 ms_run[2]:scan=5537 22.335 2 1687.8087 1687.8087 V - 601 617 PSM KAVTEQGAELSNEE 488 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=4497 19.617 2 1503.7053 1503.7053 M R 27 41 PSM KCAEAGANMIVSGSAIM 489 sp|Q96AT9-5|RPE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:4,9-UNIMOD:35,17-UNIMOD:35 ms_run[2]:scan=5496 22.238 2 1740.7845 1740.7845 H R 117 134 PSM KDAGEGLLAVQITDPEG 490 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8422 27.52 2 1711.8628 1711.8628 A K 1573 1590 PSM KDATNVGDEGGFAPNILEN 491 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=9414 30.904 2 1959.9174 1959.9174 G K 202 221 PSM KDEVDGGPPCAPGGTA 492 sp|Q9NV96-2|CC50A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 10-UNIMOD:4 ms_run[2]:scan=4533 19.749 2 1526.6671 1526.6671 A K 8 24 PSM KDGSTTAGNSSQVSDGAAAILLA 493 sp|P09110|THIK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8359 27.361 3 2133.055 2133.0550 K R 266 289 PSM KEAYMGNVLQGGEGQAPT 494 sp|P24752|THIL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6405 23.813 2 1848.8676 1848.8676 V R 87 105 PSM KEDEIPETVSLEMLDAA 495 sp|Q96A26|F162A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=9180 30.118 2 1888.8976 1888.8976 K K 79 96 PSM KEGEAVSAGDALCEIETD 496 sp|O00330-2|ODPX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:4 ms_run[2]:scan=7596 25.816 2 1892.831 1892.8310 K K 79 97 PSM KEILGTAQSVGCNVDG 497 sp|P30050|RL12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:4 ms_run[2]:scan=5679 22.611 2 1646.7934 1646.7934 I R 130 146 PSM KELTVSNNDINEAGV 498 sp|P13489|RINI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5931 23.055 2 1601.7897 1601.7897 F R 173 188 PSM KEMSTSNFESSPEVEE 499 sp|Q9UQ35-2|SRRM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35 ms_run[2]:scan=5122 21.374 2 1844.7622 1844.7622 L R 1261 1277 PSM KEQIQMDDYGLCQCC 500 sp|Q92990-2|GLMN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35,12-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=5738 22.717 2 1962.758 1962.7580 S K 163 178 PSM KEQNSALPTSSQDEELMEVVE 501 sp|Q9UQ35-2|SRRM2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 17-UNIMOD:35 ms_run[2]:scan=7374 25.429 3 2378.0795 2378.0795 T K 1223 1244 PSM KEQPAVVGLDSEEME 502 sp|Q9NPI6-2|DCP1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 14-UNIMOD:35 ms_run[2]:scan=5609 22.48 2 1675.7611 1675.7611 P R 191 206 PSM KESLPPAAEPSPVS 503 sp|Q9NWT1|PK1IP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5117 21.362 2 1407.7246 1407.7246 M K 310 324 PSM KEVCPSAIDPEDGE 504 sp|Q9H1Y0-2|ATG5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4 ms_run[2]:scan=5264 21.729 2 1544.6665 1544.6665 L K 142 156 PSM KEYIPTVFDNYSAQSAVDG 505 sp|P84095|RHOG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8521 27.793 2 2102.9797 2102.9797 P R 30 49 PSM KFAMEPEEFDSDTL 506 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35 ms_run[2]:scan=7414 25.498 2 1673.7131 1673.7131 K R 485 499 PSM KGDVEEDEAVPDSEQDI 507 sp|O14787-2|TNPO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5827 22.874 2 1873.8065 1873.8065 L K 317 334 PSM KGEETPVIVGSALCALEG 508 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 14-UNIMOD:4 ms_run[2]:scan=9170 30.074 2 1828.9241 1828.9241 Y R 209 227 PSM KGMSLNLEPDNVGVVVFGND 509 sp|P25705-2|ATPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35 ms_run[2]:scan=8934 29.054 3 2119.0256 2119.0256 L K 53 73 PSM KGTPEQPQCGFSNAVVQIL 510 sp|Q86SX6|GLRX5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 9-UNIMOD:4 ms_run[2]:scan=8943 29.082 2 2072.0361 2072.0361 L R 59 78 PSM KGVDIVMDPLGGSDTA 511 sp|Q99536-3|VAT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:35 ms_run[2]:scan=7231 25.181 2 1589.7607 1589.7607 P K 187 203 PSM KGVNLPGAAVDLPAVSE 512 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8186 26.965 2 1635.8832 1635.8832 K K 207 224 PSM KIEEVSDTSSLQPQASL 513 sp|Q9H6T3-3|RPAP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6672 24.236 2 1830.9211 1830.9211 L K 339 356 PSM KIIPLYSTLPPQQQQ 514 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7581 25.786 2 1752.9774 1752.9774 I R 384 399 PSM KLASQADSTEQVDDTILT 515 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6583 24.087 2 1933.948 1933.9480 K - 2654 2672 PSM KLEESSTIGQDQTLME 516 sp|Q96SB4-4|SRPK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:35 ms_run[2]:scan=5459 22.162 2 1823.8459 1823.8459 E R 313 329 PSM KLESVSEDPTQLEEVE 517 sp|Q96KG9-5|SCYL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6776 24.418 2 1830.8735 1830.8735 S K 536 552 PSM KLGLPPLTPEQQEALQ 518 sp|Q9UHX1-4|PUF60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8233 27.063 2 1760.9672 1760.9672 A K 10 26 PSM KLLSPQMSGEEEDSDLAA 519 sp|P42858|HD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:35 ms_run[2]:scan=5882 22.962 2 1934.8779 1934.8779 T K 1867 1885 PSM KLSPPYSSPQEFAQDVG 520 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7634 25.889 2 1848.8894 1848.8894 E R 750 767 PSM KLTLQPVDNSTISLQMGTN 521 sp|Q15417-3|CNN3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:35 ms_run[2]:scan=7450 25.55 2 2075.0569 2075.0569 Q K 186 205 PSM KMPGAPETAPGDGAGAS 522 sp|O75116|ROCK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:35 ms_run[2]:scan=3871 17.178 2 1528.6828 1528.6828 G R 9 26 PSM KMSASDPNSSIFLTDTA 523 sp|P23381-2|SYWC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:35 ms_run[2]:scan=7297 25.293 2 1799.8247 1799.8247 T K 308 325 PSM KMVMIQDGPLPTGAD 524 sp|Q96I24|FUBP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:35,4-UNIMOD:35 ms_run[2]:scan=5964 23.116 2 1603.7586 1603.7586 V K 195 210 PSM KNLEYDDETMELILPSGA 525 sp|Q969S3|ZN622_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 10-UNIMOD:35 ms_run[2]:scan=8279 27.16 2 2052.9562 2052.9562 E R 372 390 PSM KPAEGNPTDQAGFSED 526 sp|Q86XL3-2|ANKL2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=4830 20.647 2 1661.7169 1661.7169 L R 139 155 PSM KPIYDDDPSLEGGVNG 527 sp|P26358|DNMT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6438 23.859 2 1674.7737 1674.7737 A K 440 456 PSM KPLLSTFSQVPGSENE 528 sp|Q96FV9-2|THOC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7784 26.172 2 1731.8679 1731.8679 I K 31 47 PSM KPSYDTETDPSEGLMNVL 529 sp|Q9HB71-3|CYBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:35 ms_run[2]:scan=7982 26.566 2 2010.9092 2010.9092 E K 135 153 PSM KPVNPVFCMPEEVLQ 530 sp|P53611|PGTB2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 8-UNIMOD:4,9-UNIMOD:35 ms_run[2]:scan=7902 26.406 2 1801.8743 1801.8743 I R 307 322 PSM KPVPDMTQVSGPNAQLV 531 sp|Q9P2D1-2|CHD7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35 ms_run[2]:scan=5973 23.131 2 1795.9138 1795.9138 E K 565 582 PSM KQPAIMPGQSYGLEDGSCSY 532 sp|P14866-2|HNRPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35,18-UNIMOD:4 ms_run[2]:scan=6530 24.013 3 2202.9562 2202.9562 S K 322 342 PSM KQVGETSAPGDTLDGTP 533 sp|Q9NZN5-2|ARHGC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5176 21.501 2 1671.7952 1671.7952 S R 669 686 PSM KSDVPIQLLSATNQFQ 534 sp|Q6ZSZ5-2|ARHGI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8818 28.631 2 1787.9418 1787.9418 A R 865 881 PSM KSLCEDSNDLQDPVLSSAQAQ 535 sp|Q93074-3|MED12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:4 ms_run[2]:scan=6686 24.259 3 2304.054 2304.0540 L R 1298 1319 PSM KSPPSPELQGPPSTE 536 sp|Q9HB09-3|B2L12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5031 21.165 2 1549.7624 1549.7624 L K 190 205 PSM KSSASAPDVDDPEAFPALA 537 sp|Q8NC51-4|PAIRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8045 26.688 2 1886.8898 1886.8898 D - 369 388 PSM KSSGVPVDGFYTEEV 538 sp|Q9BSD7|NTPCR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7685 25.985 2 1612.7621 1612.7621 L R 27 42 PSM KTDMDNQIVVSDYAQMD 539 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=5977 23.139 2 2003.8452 2003.8452 P R 257 274 PSM KTELEDTLDTTAAQQEL 540 sp|P35580|MYH10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7939 26.489 2 1904.9215 1904.9215 L R 1152 1169 PSM KTLETQSALGPALQAAF 541 sp|O95486|SC24A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8783 28.525 2 1744.9359 1744.9359 T K 608 625 PSM KTTTTNTQVEGDDEAAFLE 542 sp|Q05682-5|CALD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=6904 24.624 2 2068.9437 2068.9437 A R 74 93 PSM KTYDTINPTDGSTIC 543 sp|Q3SY69|AL1L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:4 ms_run[2]:scan=5834 22.887 2 1684.7614 1684.7614 G K 458 473 PSM KTYYMSGGLQPVPIVF 544 sp|P11177-2|ODPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35 ms_run[2]:scan=9082 29.654 2 1814.9277 1814.9277 A R 111 127 PSM KVAQMPQEEVELLPPAP 545 sp|Q15059-2|BRD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 5-UNIMOD:35 ms_run[2]:scan=7851 26.309 2 1890.9761 1890.9761 Q K 136 153 PSM KVLNNMEIGTSLFDEEGA 546 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35 ms_run[2]:scan=8223 27.044 2 1981.9303 1981.9303 L K 218 236 PSM KVMQQQQQTTQQQLPQ 547 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35 ms_run[2]:scan=4194 18.427 3 1956.9687 1956.9687 P K 115 131 PSM KVSPDMAIFITMNPGYAG 548 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 6-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=7913 26.429 2 1942.9169 1942.9169 V R 2007 2025 PSM KVTGPQATTGTPLVTM 549 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 16-UNIMOD:35 ms_run[2]:scan=5398 22.026 2 1616.8444 1616.8444 L R 419 435 PSM KYEAPQATDGLAGALDA 550 sp|O60784-3|TOM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7478 25.607 2 1689.821 1689.8210 V R 340 357 PSM RDALGDSLQVPVSPSSTTSS 551 sp|Q9Y2D5|AKAP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7133 24.999 2 2002.9807 2002.9807 P R 140 160 PSM RDPGPDPGPGPDPAA 552 sp|Q6PJ69|TRI65_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=4597 19.965 2 1414.6477 1414.6477 A R 79 94 PSM RDVMSDETNNEETESPSQEFVNIT 553 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35 ms_run[2]:scan=7595 25.813 3 2786.1825 2786.1825 P K 1140 1164 PSM REEAAAVPAAAPDDLALL 554 sp|Q86UE4|LYRIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8857 28.779 2 1791.9367 1791.9367 K K 89 107 PSM RELSEPMEFQYLPDTDD 555 sp|Q04206-2|TF65_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 7-UNIMOD:35 ms_run[2]:scan=8104 26.793 2 2099.8994 2099.8994 D R 265 282 PSM REMEEELVPTGSEPGDT 556 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 3-UNIMOD:35 ms_run[2]:scan=5676 22.605 2 1890.8153 1890.8153 P R 18 35 PSM RGPTQPPTLPAGSGSNDETCTGAGYPQG 557 sp|Q8IYD1|ERF3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 20-UNIMOD:4 ms_run[2]:scan=5762 22.764 3 2772.2409 2772.2409 L K 74 102 PSM RIAPPEAPVTGYMFG 558 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:35 ms_run[2]:scan=7726 26.062 2 1620.797 1620.7970 L K 878 893 PSM RLLPSAPQTLPDGPLASPA 559 sp|O15027-3|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=8249 27.099 2 1900.0418 1900.0418 V R 1948 1967 PSM RMDTDLETMDLDQGGEALAP 560 sp|O75643|U520_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 2-UNIMOD:35 ms_run[2]:scan=8288 27.181 2 2192.9566 2192.9566 S R 386 406 PSM RPLFSPLSSSPTPMTIC 561 sp|Q96F44-3|TRI11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 14-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=8301 27.218 2 1905.9329 1905.9329 L R 438 455 PSM RQATPGVPAQQSPSM 562 sp|O60341|KDM1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 15-UNIMOD:35 ms_run[2]:scan=4191 18.416 2 1569.7569 1569.7569 P - 838 853 PSM RQVMVVPVGPTCDEYAQ 563 sp|P26639|SYTC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 12-UNIMOD:4 ms_run[2]:scan=7190 25.103 2 1947.9183 1947.9183 P K 619 636 PSM RSAPTAPTPPPPPPPATP 564 sp|Q14202-2|ZMYM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5467 22.177 2 1747.9257 1747.9257 T R 798 816 PSM RSGEDESQEDVLMDEAPSNLSQASTLQAN 565 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 13-UNIMOD:35 ms_run[2]:scan=7331 25.359 3 3136.3739 3136.3739 S R 2371 2400 PSM RTGSETPQAPMSGVGPVSGGPGGFG 566 sp|Q8WXF1|PSPC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7373 25.427 3 2286.0699 2286.0699 S R 482 507 PSM RTVMDGGLESDGPNMTENGLEDES 567 sp|P51116|FXR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 4-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5640 22.541 3 2584.0541 2584.0541 D R 557 581 PSM RVPSAPAPSLAYGAPAAPLS 568 sp|Q96RK0|CIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=7544 25.722 2 1892.0156 1892.0156 A R 646 666 PSM KAAPPPPPPPPPLESSP 569 sp|Q5T4S7|UBR4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=5758 22.758920297866666 2 1674.898431 1674.898108 E R 605 622 PSM KALTSETNGTDSNGSNSSNIQ 570 sp|Q08209|PP2BA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 ms_run[1]:scan=4132 18.214034150133333 2 2124.942886 2123.956698 N - 501 522 PSM KITENIGCVMTGMTADS 571 sp|P60900|PSA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 8-UNIMOD:4,13-UNIMOD:35 ms_run[1]:scan=6643 24.186333668533333 2 1843.802550 1842.816171 F R 71 88 PSM KFFGGYVPEMVLTPDDQ 572 sp|P56192|SYMC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 10-UNIMOD:35 ms_run[1]:scan=8676 28.203526012266664 2 1957.910694 1957.913166 S R 663 680 PSM KVIEQLGTPSAEFM 573 sp|P45984|MK09_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 14-UNIMOD:35 ms_run[1]:scan=6817 24.4858108056 2 1564.780911 1564.780695 N K 236 250 PSM KTPENYPNAGLTMNYC 574 sp|P00747|PLMN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 13-UNIMOD:35,16-UNIMOD:4 ms_run[1]:scan=5885 22.9702607232 2 1887.812427 1887.813135 Q R 411 427 PSM KQQVTILATPLPEESM 575 sp|Q12846|STX4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 16-UNIMOD:35 ms_run[1]:scan=7697 26.005917273066665 2 1800.914717 1799.933902 E K 64 80 PSM RAGAIAPCEVTVPAQNTGLGPE 576 sp|Q8NHW5|RLA0L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 36 8-UNIMOD:4 ms_run[1]:scan=6955 24.713663799466666 3 2207.107510 2207.100467 A K 112 134 PSM KAGEVINQPMMMAA 577 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=4299 18.853 2 1537.6939 1537.6939 Q R 889 903 PSM KAGLESGAEPGDGDSDTT 578 sp|O60832|DKC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4187 18.404 2 1705.7279 1705.7279 A K 480 498 PSM KALDVGSGSGILTACFA 579 sp|P22061|PIMT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:4 ms_run[2]:scan=8663 28.158 2 1665.8396 1665.8396 A R 81 98 PSM KAPVPGTPDSLSSGSS 580 sp|Q9UJZ1-2|STML2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4961 20.989 2 1485.7311 1485.7311 T R 276 292 PSM KAVASLPPEQMFELM 581 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=7532 25.699 2 1721.8368 1721.8368 S K 130 145 PSM KAVTVMMDPNSTQ 582 sp|Q9HAV4|XPO5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:35,7-UNIMOD:35 ms_run[2]:scan=3772 16.692 2 1452.6589 1452.6589 V R 15 28 PSM KDAPPLLPSDTGQGY 583 sp|Q9NPF5|DMAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6896 24.612 2 1557.7675 1557.7675 K R 66 81 PSM KDAQASAAPAAPLPE 584 sp|Q99808|S29A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5172 21.488 2 1435.7307 1435.7307 S R 58 73 PSM KDEEAALADGEDVPYENSV 585 sp|Q96Q15-4|SMG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7246 25.204 2 2049.9015 2049.9015 A R 2165 2184 PSM KDFTATFGPLDSLNT 586 sp|P11498|PYC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8916 28.993 2 1625.7937 1625.7937 F R 1021 1036 PSM KDGLNDDDFEPYLSPQA 587 sp|Q9Y5A9|YTHD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8364 27.372 2 1922.8534 1922.8534 Q R 26 43 PSM KDIDLDSVDMDETE 588 sp|P78312-4|F193A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:35 ms_run[2]:scan=6044 23.242 2 1639.6771 1639.6771 P R 1068 1082 PSM KDNTTLLTQVQTTM 589 sp|Q13561|DCTN2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:35 ms_run[2]:scan=6312 23.666 2 1608.8029 1608.8029 L R 365 379 PSM KDPQQPAQQQQPAQQP 590 sp|O75909-1|CCNK_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=3632 16.019 2 1815.8864 1815.8864 Q K 305 321 PSM KDPSVDITQDLVDESEEE 591 sp|Q6IN85-5|P4R3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8510 27.762 2 2046.9117 2046.9117 G R 103 121 PSM KDPVTTGTPQPPQ 592 sp|Q9UGU0-2|TCF20_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4446 19.423 2 1364.6936 1364.6936 N R 96 109 PSM KDSEDMGVVVSLGTGN 593 sp|P55265-5|DSRAD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:35 ms_run[2]:scan=6180 23.455 2 1622.7458 1622.7458 K R 581 597 PSM KDSSSTNLESMDTS 594 sp|Q86VP6-2|CAND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:35 ms_run[2]:scan=3740 16.536 2 1516.6199 1516.6199 Q - 1049 1063 PSM KEAVAPVQEESDLE 595 sp|Q13409-6|DC1I2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5360 21.946 2 1542.7413 1542.7413 K K 41 55 PSM KEEFAVPENSSVQQF 596 sp|Q9UMX0-4|UBQL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7420 25.506 2 1737.821 1737.8210 E K 47 62 PSM KEELQANGSAPAAD 597 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4037 17.831 2 1399.6579 1399.6579 A K 55 69 PSM KEENPESDGEPVVEDGTSV 598 sp|Q13439-3|GOGA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5516 22.285 2 2015.8807 2015.8807 T K 260 279 PSM KEFQQYLPVVMGPLM 599 sp|O00410-2|IPO5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=8754 28.428 2 1810.8998 1810.8998 G K 557 572 PSM KEICELTGIDQSVLE 600 sp|O43795-2|MYO1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:4 ms_run[2]:scan=8187 26.968 2 1732.8553 1732.8553 L R 307 322 PSM KEIFEQPESVVNTM 601 sp|Q06210-2|GFPT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:35 ms_run[2]:scan=6630 24.167 2 1665.792 1665.7920 Q R 327 341 PSM KELPTVTTNVQNSQD 602 sp|Q96B01-3|R51A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5093 21.313 2 1672.8268 1672.8268 V K 108 123 PSM KELSLAGNELGDEGA 603 sp|P13489|RINI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6581 24.085 2 1501.726 1501.7260 L R 287 302 PSM KEPLTQAVGLSTQAEGT 604 sp|Q5SRE5-2|NU188_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6411 23.819 2 1728.8894 1728.8894 K R 1517 1534 PSM KEPVPQPLPSDDT 605 sp|O43290|SNUT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5318 21.862 2 1421.7038 1421.7038 E R 454 467 PSM KESEITDEDIDGILE 606 sp|O60264|SMCA5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7435 25.528 2 1704.7942 1704.7942 S R 665 680 PSM KESPQEEEIDPFDVDSG 607 sp|Q9UJK0|TSR3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8056 26.71 2 1919.8272 1919.8272 A R 226 243 PSM KETEGSIPPTETSMSA 608 sp|Q9UPN3-4|MACF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:35 ms_run[2]:scan=4220 18.53 2 1679.756 1679.7560 L K 2277 2293 PSM KEVVECQSTSTVGGQSV 609 sp|Q96T23-3|RSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:4 ms_run[2]:scan=4877 20.779 2 1793.8465 1793.8465 E K 393 410 PSM KEVWEETDGLDPNDFDP 610 sp|P80303-2|NUCB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8785 28.534 2 2004.8589 2004.8589 L K 230 247 PSM KFNVTGTPEQYVPYSTT 611 sp|Q9UI09|NDUAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7588 25.798 2 1930.9313 1930.9313 H R 114 131 PSM KGLLSDSMTDVPVDTGVAA 612 sp|O43399-2|TPD54_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:35 ms_run[2]:scan=7267 25.239 2 1890.9245 1890.9245 N R 15 34 PSM KGLVYETSVLDPDEGI 613 sp|O75390|CISY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8542 27.844 2 1733.8723 1733.8723 M R 76 92 PSM KGSAPPGPVPEGSI 614 sp|P78417-2|GSTO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5635 22.529 2 1291.6772 1291.6772 G R 11 25 PSM KIFVGGLSPDTPEE 615 sp|Q14103-4|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7109 24.961 2 1487.7508 1487.7508 K K 164 178 PSM KIGDVVGSSGANQQTSG 616 sp|Q9Y263|PLAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4502 19.629 2 1603.7802 1603.7802 I K 376 393 PSM KIIASSPEMNLPTVSAL 617 sp|Q96C36|P5CR2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 9-UNIMOD:35 ms_run[2]:scan=8117 26.813 2 1785.9546 1785.9546 H R 29 46 PSM KITENIGCVMTGMTADS 618 sp|P60900-2|PSA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:4,10-UNIMOD:35 ms_run[2]:scan=6105 23.34 2 1842.8162 1842.8162 F R 52 69 PSM KLAGEELAGEEAPQE 619 sp|Q7Z4V5-2|HDGR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5474 22.189 2 1569.7522 1569.7522 E K 574 589 PSM KLAMQEFMILPVGAANF 620 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=9193 30.182 2 1910.9634 1910.9634 N R 162 179 PSM KLEAEGEAMEDAAAPGDD 621 sp|P56181-2|NDUV3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 9-UNIMOD:35 ms_run[2]:scan=4612 20.018 2 1833.7575 1833.7575 L R 399 417 PSM KLEEDINSSMTNSTAAS 622 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:35 ms_run[2]:scan=4465 19.501 2 1812.8047 1812.8047 D R 78 95 PSM KLEEDISSSMTNSTAAS 623 sp|Q15366-7|PCBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:35 ms_run[2]:scan=4574 19.899 2 1785.7938 1785.7938 D R 78 95 PSM KLEEDISSSMTNSTAAS 624 sp|Q15366-7|PCBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5705 22.657 2 1769.7989 1769.7989 D R 78 95 PSM KLGLQCLPSDGVQNVNQ 625 sp|P41440|S19A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:4 ms_run[2]:scan=7037 24.852 2 1868.9414 1868.9414 S - 575 592 PSM KLITSNTDASDGDSVALV 626 sp|Q14789-3|GOGB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7011 24.805 2 1804.9054 1804.9054 Q K 1090 1108 PSM KLLELTSSYSPDVSDY 627 sp|P38432|COIL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8377 27.401 2 1815.8778 1815.8778 F K 480 496 PSM KLLQSIGQAPESISE 628 sp|Q13564-3|ULA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6950 24.704 2 1598.8516 1598.8516 A K 274 289 PSM KLLQTCFSSPADDSMD 629 sp|Q9NZL4-2|HPBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:4,15-UNIMOD:35 ms_run[2]:scan=6541 24.028 2 1829.7812 1829.7812 E R 240 256 PSM KLMSSNSTDLPLNIECFMND 630 sp|Q92598-2|HS105_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:35,16-UNIMOD:4,18-UNIMOD:35 ms_run[2]:scan=8781 28.518 3 2360.0334 2360.0334 K K 275 295 PSM KLVDEDFPEDSSSQ 631 sp|A6NDU8|CE051_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5932 23.058 2 1594.6999 1594.6999 N K 81 95 PSM KLVDEDFPEDSSSQ 632 sp|A6NDU8|CE051_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6151 23.409 2 1594.6999 1594.6999 N K 81 95 PSM KLVQAAQMLQSDPYSVPA 633 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:35 ms_run[2]:scan=6903 24.623 2 1960.9928 1960.9928 T R 87 105 PSM KLYSPSQIGAFVLM 634 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:35 ms_run[2]:scan=9078 29.64 2 1568.8273 1568.8273 G K 159 173 PSM KMEVWAVGDPSEEQLA 635 sp|Q6P9B6|MEAK7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 2-UNIMOD:35 ms_run[2]:scan=7615 25.855 2 1803.8349 1803.8349 D K 405 421 PSM KPEEVLVVENDQGEVV 636 sp|O14980|XPO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7286 25.273 2 1781.9047 1781.9047 A R 426 442 PSM KPEPVLEETAPEDAQ 637 sp|Q13283|G3BP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5386 22.001 2 1651.7941 1651.7941 E K 214 229 PSM KPQPLQQPSQPQQPPPTQQAVA 638 sp|Q8WWM7-6|ATX2L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5021 21.14 3 2392.2499 2392.2499 L R 3 25 PSM KPSLVGDGEGAILSPSQ 639 sp|Q9Y2X9-2|ZN281_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6915 24.642 2 1653.8574 1653.8574 S K 206 223 PSM KPSTAYAPEGSPILMPAYT 640 sp|Q6P587|FAHD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:35 ms_run[2]:scan=7326 25.345 2 2008.9816 2008.9816 L R 47 66 PSM KPVLGICYGMQMMN 641 sp|P49915|GUAA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 7-UNIMOD:4,10-UNIMOD:35,12-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=6298 23.65 2 1688.7394 1688.7394 G K 98 112 PSM KPVNPVFCMPEEVLQ 642 sp|P53611|PGTB2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 8-UNIMOD:4 ms_run[2]:scan=8981 29.225 2 1785.8794 1785.8794 I R 307 322 PSM KPVPDEEPNSTDVEETLE 643 sp|P28289-2|TMOD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6432 23.847 2 2026.9219 2026.9219 Y R 44 62 PSM KSFPPPGPAEGLL 644 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8441 27.574 2 1308.7078 1308.7078 L R 5 18 PSM KSLQQPGLPSQSCSVQSSGGQPPG 645 sp|Q53ET0|CRTC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 13-UNIMOD:4 ms_run[2]:scan=5332 21.89 3 2410.1547 2410.1547 P R 503 527 PSM KSLVSTPAGPVNVL 646 sp|Q96T58|MINT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8089 26.766 2 1380.7977 1380.7977 L K 2680 2694 PSM KSPDASSAFSPASPATPNGT 647 sp|Q53GS7-2|GLE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5533 22.327 2 1888.8803 1888.8803 P K 87 107 PSM KSPDLAPTPAPQSTP 648 sp|Q9BY44-3|EIF2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5129 21.39 2 1505.7726 1505.7726 D R 480 495 PSM KSQPEPSPVLSQLSQ 649 sp|Q5T6F2|UBAP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6715 24.308 2 1623.8468 1623.8468 F R 426 441 PSM KSQPEPSPVLSQLSQ 650 sp|Q5T6F2|UBAP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6768 24.406 2 1623.8468 1623.8468 F R 426 441 PSM KSTAPETAIECTQAPAPASEDE 651 sp|Q14839|CHD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:4 ms_run[2]:scan=5394 22.017 3 2302.0271 2302.0271 V K 1584 1606 PSM KSTNCFGDNDPIDVCEIGS 652 sp|Q9H2U2|IPYR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 5-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=7785 26.174 2 2126.8885 2126.8885 D K 157 176 PSM KSVPLATAPMAEQ 653 sp|Q9Y678|COPG1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 10-UNIMOD:35 ms_run[2]:scan=4761 20.47 2 1357.6912 1357.6912 L R 577 590 PSM KTAPYVVTGSVDQTV 654 sp|P43034|LIS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6250 23.57 2 1563.8144 1563.8144 H K 390 405 PSM KTDPSSLGATSASFNFG 655 sp|Q9UKX7-2|NUP50_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7839 26.283 2 1685.7897 1685.7897 K K 230 247 PSM KTFPLDVGSIVGYSGQ 656 sp|P48147|PPCE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8993 29.277 2 1666.8566 1666.8566 L K 373 389 PSM KTIIDFEPNETTDLE 657 sp|P42694-2|HELZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8237 27.072 2 1763.8465 1763.8465 S K 411 426 PSM KTITYQAVPSEVPNEEP 658 sp|Q9BY44-3|EIF2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6362 23.744 2 1900.9418 1900.9418 A K 399 416 PSM KTTLPTFQSPEFSVT 659 sp|Q9Y5X3|SNX5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8478 27.675 2 1681.8563 1681.8563 T R 52 67 PSM KTYVDLTNEETTDSTTS 660 sp|O95551|TYDP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5625 22.51 2 1903.8535 1903.8535 P K 82 99 PSM KVAAIEALNDGELQ 661 sp|P50502|F10A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=6877 24.579 2 1469.7726 1469.7726 K K 118 132 PSM KVAQPPLSAQATGSGQPT 662 sp|Q86UK7-4|ZN598_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4854 20.707 2 1736.9057 1736.9057 K R 118 136 PSM KVEYTLGEESEAPGQ 663 sp|Q04637-6|IF4G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5659 22.574 2 1635.7628 1635.7628 Q R 1225 1240 PSM KVIVVGNPANTNCLTAS 664 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 13-UNIMOD:4 ms_run[2]:scan=6082 23.304 2 1756.9142 1756.9142 V K 125 142 PSM KVLTQMGSPLNPISSVS 665 sp|Q99717|SMAD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 6-UNIMOD:35 ms_run[2]:scan=7062 24.887 2 1772.9342 1772.9342 D - 449 466 PSM KVMVAPISGSVTTGT 666 sp|Q12830-4|BPTF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 3-UNIMOD:35 ms_run[2]:scan=5568 22.395 2 1462.7701 1462.7701 Q K 2074 2089 PSM KVNQIGSVTESLQAC 667 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:4 ms_run[2]:scan=6415 23.825 2 1632.8141 1632.8141 L K 343 358 PSM KVTLLDGTEYSCDLE 668 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 12-UNIMOD:4 ms_run[2]:scan=7991 26.581 2 1741.808 1741.8080 C K 221 236 PSM KVTLLDGTEYSCDLE 669 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 12-UNIMOD:4 ms_run[2]:scan=8000 26.599 2 1741.808 1741.8080 C K 221 236 PSM KVTTVVATPGQGPD 670 sp|P49841|GSK3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4850 20.697 2 1368.7249 1368.7249 S R 36 50 PSM KYDLTPAIQTTSTLYE 671 sp|Q6NUQ4-2|TM214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8125 26.826 2 1842.9251 1842.9251 W R 46 62 PSM KYEAPQATDGLAGALDA 672 sp|O60784-3|TOM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7169 25.067 2 1689.821 1689.8210 V R 340 357 PSM KYSQAVPAVTEGPIPEVL 673 sp|P07339|CATD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8742 28.386 2 1897.0197 1897.0197 S K 54 72 PSM RATQLQGDEEPSAPPTSTQAQQ 674 sp|O60231|DHX16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4670 20.214 3 2339.0989 2339.0989 V K 367 389 PSM RDPETLVGYSMVGCQ 675 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 11-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=6627 24.164 2 1726.7655 1726.7655 S R 122 137 PSM RDSAIPVESDTDDEGAP 676 sp|Q96D46|NMD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5433 22.109 2 1772.7701 1772.7701 Y R 460 477 PSM REIFDDDLEDDALDADE 677 sp|P09884|DPOLA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8569 27.916 2 1994.8229 1994.8229 G K 92 109 PSM RGDMVTEDADPYVQPEDENYENDSV 678 sp|Q9Y4J8-6|DTNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 4-UNIMOD:35 ms_run[2]:scan=6905 24.627 3 2902.1723 2902.1723 M R 339 364 PSM RGPGNPVPGPLAPLPDYMSEE 679 sp|Q6P2Q9|PRP8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 18-UNIMOD:35 ms_run[2]:scan=8175 26.939 3 2208.0521 2208.0521 Y K 8 29 PSM RGPVSGTEPEPVYSMEAADY 680 sp|Q14247-3|SRC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 15-UNIMOD:35 ms_run[2]:scan=6369 23.756 2 2169.9525 2169.9525 Y R 397 417 PSM RGQAAQPEPSTGFTATPPAPDSPQEPLVL 681 sp|Q9BVT8|TMUB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8591 27.985 3 2958.4723 2958.4723 H R 77 106 PSM RLENYPIPEPGPNEVLL 682 sp|Q00796-2|DHSO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8953 29.116 2 1949.0258 1949.0258 L R 21 38 PSM RLILPVGPAGGNQMLEQYD 683 sp|P22061|PIMT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 14-UNIMOD:35 ms_run[2]:scan=8406 27.468 3 2086.0517 2086.0517 G K 178 197 PSM RLLSMPGAQGAAAAGSEPPPATTSPEGQP 684 sp|Q96KQ7-2|EHMT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 5-UNIMOD:35 ms_run[2]:scan=5673 22.598 3 2761.3341 2761.3341 M K 150 179 PSM RLPPNTNDEVDEDPTGN 685 sp|Q15393|SF3B3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5641 22.543 2 1881.8341 1881.8341 V K 1057 1074 PSM RNPIPFPETFDGDTD 686 sp|Q9BWD3|RTL8A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8500 27.735 2 1719.774 1719.7740 W R 24 39 PSM RPGTEPQPEMPDTVLQSETL 687 sp|O95202|LETM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8277 27.157 3 2224.0682 2224.0682 Q K 506 526 PSM RPLGSGAGPGPTGAAPVSAPAPGPGPAG 688 sp|Q9NRL3|STRN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5902 22.998 3 2320.1924 2320.1924 C K 18 46 PSM RQGQETAVAPSLVAPALN 689 sp|Q15691|MARE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=7385 25.446 2 1820.9745 1820.9745 A K 130 148 PSM RSIYDDISSPGLGSTPLTS 690 sp|Q8NFH5-2|NUP35_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8576 27.937 2 1964.9691 1964.9691 V R 75 94 PSM RTLPETLDPAEYNISPET 691 sp|O95168-2|NDUB4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8311 27.249 2 2044.9953 2044.9953 L R 12 30 PSM RVLAPILPDNFSTPTGS 692 sp|Q9NQS7-2|INCE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=8654 28.13 2 1783.9468 1783.9468 E R 280 297 PSM KSPGSTPTTPTSSQAPQ 693 sp|P35658|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=3863 17.144834769066666 2 1670.812653 1670.811144 P K 429 446 PSM KETVYCLNDDDETEVL 694 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 6-UNIMOD:4 ms_run[1]:scan=7655 25.922722002666667 2 1941.850550 1941.851354 Q K 291 307 PSM RSGPTDDGEEEMEEDTVTNGS 695 sp|P09661|RU2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 12-UNIMOD:35 ms_run[1]:scan=4351 19.047999192533332 2 2270.861663 2269.876459 R - 235 256 PSM KNTAPDNGPILLQAQTTQ 696 sp|Q12788|TBL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=6582 24.08630357226667 3 1909.992924 1908.990505 S R 458 476 PSM KVNATVPSNMMSVNGQA 697 sp|Q9H3P7|GCP60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 10-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=4346 19.023930549333333 2 1778.816669 1778.829119 S K 322 339 PSM RGSLQPAPAQPPGDPAAQASVSNGEDAGGGAG 698 sp|O14562|UBFD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=5590 22.450097310133334 3 2887.333083 2886.349241 A R 51 83 PSM RGSLQPAPAQPPGDPAAQASVSNGEDAGGGAG 699 sp|O14562|UBFD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=5580 22.427651792 3 2887.333083 2886.349241 A R 51 83 PSM KSEQDQAENEGEDSAVLME 700 sp|Q99613|EIF3C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 18-UNIMOD:35 ms_run[1]:scan=5224 21.613511208533335 2 2124.877558 2123.880088 S R 531 550 PSM KDFTATFGPLDSLNT 701 sp|P11498|PYC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 35 ms_run[1]:scan=8910 28.97462665093333 2 1626.804059 1625.793703 F R 1021 1036 PSM KADFPAGIPECGTDAL 702 sp|P26640|SYVC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:4 ms_run[2]:scan=7914 26.431 2 1660.7767 1660.7767 Q R 907 923 PSM KADIGVAMGIAGSDVS 703 sp|P05023-3|AT1A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 8-UNIMOD:35 ms_run[2]:scan=5911 23.01 2 1505.7396 1505.7396 K K 696 712 PSM KAEEPSDLIGPEAP 704 sp|Q8N5F7|NKAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6734 24.34 2 1451.7144 1451.7144 T K 283 297 PSM KAILAGAQPIEEM 705 sp|Q8WWK9-6|CKAP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:35 ms_run[2]:scan=5836 22.889 2 1385.7225 1385.7225 E R 437 450 PSM KAISALVPQGGPVLC 706 sp|Q13330-2|MTA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 15-UNIMOD:4 ms_run[2]:scan=7856 26.321 2 1508.8385 1508.8385 S R 267 282 PSM KALELSGTAVPPDLE 707 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7519 25.68 2 1538.8192 1538.8192 I K 736 751 PSM KALLPLELQDDGSDS 708 sp|Q15906|VPS72_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8363 27.37 2 1599.7992 1599.7992 E R 115 130 PSM KAMGYQPLVTMDDAME 709 sp|Q15738|NSDHL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 3-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5646 22.554 2 1846.7787 1846.7787 K R 345 361 PSM KAPDGQTVAGEVMGPQ 710 sp|Q5JSH3-4|WDR44_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:35 ms_run[2]:scan=4871 20.758 2 1599.7563 1599.7563 G R 298 314 PSM KAPDGQTVAGEVMGPQ 711 sp|Q5JSH3-4|WDR44_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5858 22.92 2 1583.7614 1583.7614 G R 298 314 PSM KAPPPSLTDCIGTVDS 712 sp|Q9NZZ3-2|CHMP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 10-UNIMOD:4 ms_run[2]:scan=6482 23.93 2 1656.8029 1656.8029 P R 11 27 PSM KASAGPQPLLVQSC 713 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 14-UNIMOD:4 ms_run[2]:scan=5933 23.059 2 1454.7551 1454.7551 P K 943 957 PSM KASEVMGPVEAAPEY 714 sp|Q8WWY3-2|PRP31_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 6-UNIMOD:35 ms_run[2]:scan=5627 22.513 2 1592.7392 1592.7392 A R 76 91 PSM KAVTGQTTQVSPPVIAG 715 sp|Q6MZP7-3|LIN54_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5808 22.84 2 1652.9097 1652.9097 S R 33 50 PSM KDASDDLDDLNFFNQ 716 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9152 29.993 2 1755.7588 1755.7588 K K 64 79 PSM KDENATLDGGDVLFTG 717 sp|O94760-2|DDAH1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8127 26.834 2 1650.7737 1650.7737 M R 17 33 PSM KDIELSDDPYDCI 718 sp|Q15024|EXOS7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 12-UNIMOD:4 ms_run[2]:scan=7882 26.37 2 1581.6869 1581.6869 S R 178 191 PSM KDPFDTLATMTDQQ 719 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 10-UNIMOD:35 ms_run[2]:scan=7187 25.098 2 1625.7243 1625.7243 E R 993 1007 PSM KDSMSAAEVGTGQYATT 720 sp|Q9Y2J2-3|E41L3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 4-UNIMOD:35 ms_run[2]:scan=4629 20.073 2 1731.7621 1731.7621 M K 458 475 PSM KEAYMGNVLQGGEGQAPT 721 sp|P24752|THIL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 5-UNIMOD:35 ms_run[2]:scan=5382 21.996 2 1864.8625 1864.8625 V R 87 105 PSM KEDEIPETVSLEMLDAA 722 sp|Q96A26|F162A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:35 ms_run[2]:scan=8442 27.576 2 1904.8925 1904.8925 K K 79 96 PSM KEFADSLGIPFLETSA 723 sp|P62820-2|RAB1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9256 30.403 2 1723.8669 1723.8669 A K 76 92 PSM KEGFYDLSSEDPFGC 724 sp|P07942|LAMB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 15-UNIMOD:4 ms_run[2]:scan=8877 28.855 2 1749.7192 1749.7192 C K 441 456 PSM KEIDLLLGQTDDT 725 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8167 26.916 2 1459.7406 1459.7406 R R 155 168 PSM KELECAEDPGSAGEAA 726 sp|O94966-4|UBP19_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 5-UNIMOD:4 ms_run[2]:scan=4522 19.705 2 1632.6937 1632.6937 S R 1025 1041 PSM KENCPACSQLPQNIQFSPSA 727 sp|Q8TBC4-2|UBA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 4-UNIMOD:4,7-UNIMOD:4 ms_run[2]:scan=7333 25.362 3 2275.0362 2275.0362 R K 347 367 PSM KENDENCGPTTTVFVGNISE 728 sp|P49756-4|RBM25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 7-UNIMOD:4 ms_run[2]:scan=7388 25.45 3 2209.9797 2209.9797 A K 77 97 PSM KEQTADGVAVIPVLQ 729 sp|Q9UKK9|NUDT5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8239 27.077 2 1566.8617 1566.8617 R R 55 70 PSM KESEITDEDIDGILE 730 sp|O60264|SMCA5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8254 27.11 2 1704.7942 1704.7942 S R 665 680 PSM KESLPPAAEPSPVS 731 sp|Q9NWT1|PK1IP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5263 21.727 2 1407.7246 1407.7246 M K 310 324 PSM KETDGTEGTVEIETV 732 sp|Q8WY54|PPM1E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6090 23.315 2 1606.7574 1606.7574 P K 185 200 PSM KEVDVGLAADVGTLQ 733 sp|Q13011|ECH1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7670 25.955 2 1513.7988 1513.7988 V R 196 211 PSM KEYLPIGGLAEFC 734 sp|P00505|AATM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:4 ms_run[2]:scan=9099 29.729 2 1495.7381 1495.7381 D K 94 107 PSM KIEDLSQQAQLAAAE 735 sp|E9PAV3|NACAM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6393 23.788 2 1613.8261 1613.8261 A K 1990 2005 PSM KIEDVPAPSTSAD 736 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4800 20.569 2 1328.646 1328.6460 D K 20 33 PSM KIFVGGLNPEATEE 737 sp|Q99729-3|ROAA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7123 24.982 2 1502.7617 1502.7617 K K 155 169 PSM KIGQQPQQPGAPPQQDYT 738 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4928 20.915 3 1979.9701 1979.9701 K K 628 646 PSM KILDSVGIEADDD 739 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6501 23.956 2 1388.6671 1388.6671 K R 25 38 PSM KILQELPSVSQETL 740 sp|Q96ST2-2|IWS1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8177 26.943 2 1583.877 1583.8770 L K 314 328 PSM KIPVLVSCEDDLSDD 741 sp|Q9Y4C2-2|TCAF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 8-UNIMOD:4 ms_run[2]:scan=7648 25.911 2 1703.7924 1703.7924 P R 201 216 PSM KITAEDCTMEVTPGAEIQDG 742 sp|Q6UN15-5|FIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 7-UNIMOD:4,9-UNIMOD:35 ms_run[2]:scan=5730 22.702 2 2179.9613 2179.9613 N R 195 215 PSM KIVLTNPVCTEVGE 743 sp|P41091|IF2G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 9-UNIMOD:4 ms_run[2]:scan=7121 24.979 2 1557.8072 1557.8072 G K 426 440 PSM KLANPPPMVEGEGLAS 744 sp|Q12955-6|ANK3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 8-UNIMOD:35 ms_run[2]:scan=5549 22.354 2 1624.8131 1624.8131 H R 163 179 PSM KLETEETVPETDVET 745 sp|Q03701|CEBPZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5621 22.502 2 1718.8098 1718.8098 K K 659 674 PSM KLETLPEEMGDMQ 746 sp|Q96RT1-7|ERBIN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 9-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5186 21.524 2 1551.6797 1551.6797 N K 356 369 PSM KLLEGIGLENLDSPAAT 747 sp|O75165|DJC13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8684 28.224 2 1739.9305 1739.9305 L K 2139 2156 PSM KLLEPVVCMSDML 748 sp|Q9UN37|VPS4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 8-UNIMOD:4,9-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=7444 25.54 2 1565.7503 1565.7503 D R 396 409 PSM KLLLEETSSAPQEQYGECGE 749 sp|Q92794|KAT6A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 18-UNIMOD:4 ms_run[2]:scan=6831 24.508 3 2267.0264 2267.0264 S K 885 905 PSM KLLLLPPPSASSAF 750 sp|Q14558-2|KPRA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8935 29.057 2 1439.8388 1439.8388 K R 4 18 PSM KLLTECPPMMDTEYT 751 sp|P55060-4|XPO2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 6-UNIMOD:4,10-UNIMOD:35 ms_run[2]:scan=6690 24.266 2 1843.8042 1843.8042 T K 792 807 PSM KLLTGELLPTDGMI 752 sp|Q9UG63|ABCF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:35 ms_run[2]:scan=8739 28.379 2 1515.8218 1515.8218 L R 441 455 PSM KLLVPAAEGEDSL 753 sp|Q96PU8-5|QKI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7309 25.314 2 1340.7187 1340.7187 K K 177 190 PSM KLPGQDESTAGTSEQNDIL 754 sp|Q9Y520-3|PRC2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6611 24.132 2 2001.9491 2001.9491 E K 196 215 PSM KLTSSCPDLPSQTD 755 sp|P56962|STX17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 6-UNIMOD:4 ms_run[2]:scan=5143 21.426 2 1547.7137 1547.7137 E K 285 299 PSM KLVLLGADEEEPQL 756 sp|Q9BU02|THTPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8551 27.868 2 1552.8348 1552.8348 W R 129 143 PSM KLVTDCVAAMNPDAVL 757 sp|O95861-3|BPNT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 6-UNIMOD:4 ms_run[2]:scan=8541 27.842 2 1715.8586 1715.8586 N R 146 162 PSM KMILIQDGSQNTNVD 758 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 2-UNIMOD:35 ms_run[2]:scan=5319 21.864 2 1690.8196 1690.8196 V K 266 281 PSM KMLPTYVCATPDGTE 759 sp|P52789|HXK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 2-UNIMOD:35,8-UNIMOD:4 ms_run[2]:scan=5821 22.865 2 1697.7641 1697.7641 V K 510 525 PSM KMPGAPETAPGDGAGAS 760 sp|O75116|ROCK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4568 19.88 2 1512.6879 1512.6879 G R 9 26 PSM KNLLTVTSSDEMM 761 sp|P78527-2|PRKDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 12-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=5803 22.833 2 1499.6847 1499.6847 N K 868 881 PSM KPAPVPAEPFDNTTY 762 sp|P56181|NDUV3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6922 24.653 2 1645.7988 1645.7988 K K 57 72 PSM KPEPELNAAIPSANPA 763 sp|Q8WUM4|PDC6I_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6207 23.503 2 1617.8362 1617.8362 C K 525 541 PSM KPEYIQMLMPPLIQ 764 sp|Q92973-3|TNPO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 7-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=8324 27.278 2 1731.894 1731.8940 N K 516 530 PSM KPQTSPEYGQGINPIS 765 sp|O95793-2|STAU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6015 23.197 2 1714.8526 1714.8526 V R 193 209 PSM KQDLPNAMAISEMTD 766 sp|P18085|ARF4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 8-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=5604 22.474 2 1694.7491 1694.7491 N K 127 142 PSM KQGAPTSFLPPEASQL 767 sp|Q9BUJ2-3|HNRL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8483 27.692 2 1669.8675 1669.8675 M K 103 119 PSM KQLPLEPESPSGQVGP 768 sp|Q3KQU3-2|MA7D1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6330 23.689 2 1661.8625 1661.8625 S R 62 78 PSM KQVPVEPGPDPEL 769 sp|P41440|S19A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6135 23.383 2 1403.7296 1403.7296 E R 10 23 PSM KSEAPETPMEEEAELVLTE 770 sp|Q5JTH9-2|RRP12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 9-UNIMOD:35 ms_run[2]:scan=8217 27.031 2 2146.9828 2146.9828 G K 71 90 PSM KSLEYCSTASIDSENPPDLN 771 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 6-UNIMOD:4 ms_run[2]:scan=6519 23.998 3 2238.9951 2238.9951 W K 3009 3029 PSM KSLTINGVADDDALAEE 772 sp|O75190-4|DNJB6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7152 25.038 2 1759.8476 1759.8476 L R 176 193 PSM KSSSSVTTSETQPCTPSSSDYSDLQ 773 sp|P50552|VASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 14-UNIMOD:4 ms_run[2]:scan=5538 22.336 3 2678.1501 2678.1501 M R 321 346 PSM KTAENATSGETLEENEAGD 774 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4421 19.326 2 1964.8447 1964.8447 S - 376 395 PSM KTAVPPLSEGDGYSSENTS 775 sp|Q9BYW2|SETD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5510 22.271 2 1937.8854 1937.8854 T R 1831 1850 PSM KTDPPIIEGNMEAA 776 sp|Q12860-2|CNTN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=5140 21.418 2 1500.713 1500.7130 A R 642 656 PSM KTEESPASDEAGE 777 sp|P05114|HMGN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=3455 15.261 2 1348.563 1348.5630 T K 82 95 PSM KTESEPGQQPMELEN 778 sp|Q7L8L6|FAKD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=4236 18.589 2 1731.7621 1731.7621 G K 645 660 PSM KTETVEEPMEEEEAA 779 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 9-UNIMOD:35 ms_run[2]:scan=4464 19.498 2 1736.7298 1736.7298 S K 285 300 PSM KTGIDQLVVTPISQAQA 780 sp|Q14562|DHX8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8057 26.712 2 1767.9731 1767.9731 S K 868 885 PSM KTMQFEPSTMVYDAC 781 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 3-UNIMOD:35,10-UNIMOD:35,15-UNIMOD:4 ms_run[2]:scan=5942 23.08 2 1838.7525 1838.7525 V R 15 30 PSM KTMQFEPSTMVYDAC 782 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 10-UNIMOD:35,15-UNIMOD:4 ms_run[2]:scan=6710 24.299 2 1822.7576 1822.7576 V R 15 30 PSM KTPAPPAGPGGTL 783 sp|Q9NX70|MED29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5340 21.905 2 1162.6346 1162.6346 G - 188 201 PSM KTPVTQVNEVTGTL 784 sp|Q13405|RM49_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6737 24.346 2 1485.8039 1485.8039 G R 134 148 PSM KTQTPPVEENVTQ 785 sp|Q6P1Q9-2|MET2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4500 19.624 2 1469.7362 1469.7362 H K 86 99 PSM KTTTPGPSLSQGVSVDE 786 sp|O60934|NBN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5768 22.775 2 1701.8421 1701.8421 L K 334 351 PSM KTVTLPENEDELESTN 787 sp|P30876|RPB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6011 23.193 2 1817.8531 1817.8531 G R 869 885 PSM KTVTNAVVTVPAYFNDSQ 788 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9311 30.529 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 789 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9502 31.209 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 790 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9698 31.889 2 1952.9844 1952.9844 G R 137 155 PSM KVAMPVELNEPLNTLQ 791 sp|Q9H4L5-8|OSBL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 4-UNIMOD:35 ms_run[2]:scan=7663 25.939 2 1810.9499 1810.9499 S R 475 491 PSM KVFVGGLSPDTSEEQI 792 sp|O14979|HNRDL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7570 25.772 2 1704.857 1704.8570 K K 234 250 PSM KVLIIGGGDGGVL 793 sp|P19623|SPEE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8463 27.63 2 1196.7129 1196.7129 R R 96 109 PSM KVTADVTSAVMGNPVT 794 sp|Q6P3W7|SCYL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=5700 22.647 2 1604.808 1604.8080 T R 14 30 PSM KVVLLTGETSTDL 795 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7533 25.7 2 1374.7606 1374.7606 K K 1404 1417 PSM KYDPPLEDGAMPSA 796 sp|P47756-2|CAPZB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=5348 21.918 2 1505.6708 1505.6708 N R 78 92 PSM RAAVEGTVEAGATVESTAC 797 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 19-UNIMOD:4 ms_run[2]:scan=5361 21.948 2 1877.8789 1877.8789 S - 706 725 PSM RAIVAIENPADVSVISS 798 sp|P08865|RSSA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8061 26.718 2 1739.9418 1739.9418 A R 63 80 PSM RAPLPDLYPFGTM 799 sp|Q92841|DDX17_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 13-UNIMOD:35 ms_run[2]:scan=8898 28.931 2 1492.7384 1492.7384 I R 68 81 PSM RATGEGGASDLPEDPDEDAIPIT 800 sp|O15541|R113A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7440 25.536 3 2325.0608 2325.0608 H - 321 344 PSM RAVDTDGVEPMESVLED 801 sp|O43716|GATC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=6191 23.472 2 1876.836 1876.8360 L R 68 85 PSM RDPGVITYDLPTPPGE 802 sp|P26640|SYVC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8063 26.722 2 1725.8574 1725.8574 K K 273 289 PSM RDQSAVVVQGLPEGVAF 803 sp|P78347-5|GTF2I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=8839 28.706 2 1770.9264 1770.9264 L K 143 160 PSM READGSETPEPFAAEA 804 sp|Q7KZF4|SND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6186 23.464 2 1675.7326 1675.7326 R K 233 249 PSM RESTGAQVQVAGDMLPNSTE 805 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 14-UNIMOD:35 ms_run[2]:scan=5542 22.341 3 2104.9695 2104.9695 I R 124 144 PSM RFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG 806 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6622 24.157 3 3375.4148 3375.4148 F - 772 807 PSM RGAPAAAAAAAPPPTPAPPPPPAPVAAAAPA 807 sp|Q6SPF0|SAMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=6731 24.336 3 2661.4391 2661.4391 P R 116 147 PSM RLDGLVETPTGYIESLP 808 sp|P55209-2|NP1L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=9093 29.7 2 1858.9676 1858.9676 E R 55 72 PSM RLFVGNLPPDITEEEM 809 sp|Q15233|NONO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 16-UNIMOD:35 ms_run[2]:scan=8404 27.463 2 1874.9084 1874.9084 S R 75 91 PSM RMDTDLETMDLDQGGEALAP 810 sp|O75643|U520_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 2-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=7220 25.163 3 2208.9515 2208.9515 S R 386 406 PSM RPAPVAQPPAAAPPSAVGSSAAAP 811 sp|Q9Y6H1|CHCH2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5623 22.506 3 2137.128 2137.1280 P R 27 51 PSM RPQVTAVAQQNQGEVPEPQDM 812 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 21-UNIMOD:35 ms_run[2]:scan=5289 21.798 3 2337.1019 2337.1019 L K 485 506 PSM RSVPTSTVFYPSDGVATE 813 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=7040 24.859 2 1911.9214 1911.9214 F K 438 456 PSM RTGSETPQAPMSGVGPVSGGPGGFG 814 sp|Q8WXF1|PSPC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 11-UNIMOD:35 ms_run[2]:scan=6406 23.814 3 2302.0648 2302.0648 S R 482 507 PSM RVLAPASTLQSSYQIPTENSMTA 815 sp|Q14126|DSG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 21-UNIMOD:35 ms_run[2]:scan=7328 25.348 3 2480.2217 2480.2217 E R 1049 1072 PSM KLAVEALSSLDGDLAG 816 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=8571 27.922187901333334 2 1557.815648 1557.825003 E R 156 172 PSM KSVSTPSEAGSQDSGDGAVGS 817 sp|Q13409|DC1I2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=4049 17.869579934666667 2 1921.851070 1921.850108 S R 91 112 PSM KAGTATSPAGSSPAVAGGTQ 818 sp|Q13428|TCOF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=4003 17.692266777333334 2 1714.849793 1714.848592 R R 668 688 PSM RSGPTDDGEEEMEEDTVTNGS 819 sp|P09661|RU2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 12-UNIMOD:35 ms_run[1]:scan=4580 19.911993530933334 2 2270.868340 2269.876459 R - 235 256 PSM KGEVYPFGIVGMAN 820 sp|O75534|CSDE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 12-UNIMOD:35 ms_run[1]:scan=8255 27.11160183626667 2 1496.732734 1496.733351 M K 628 642 PSM RAAVDAGFVPNDMQVGQTG 821 sp|P13804|ETFA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 13-UNIMOD:35 ms_run[1]:scan=6185 23.4622264072 2 1948.927619 1947.910875 S K 249 268 PSM KDPQQPAQQQQPAQQP 822 sp|O75909|CCNK_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=3717 16.428479609333333 3 1815.885841 1815.886374 Q K 305 321 PSM KTAVVVGTITDDV 823 sp|Q07020|RL18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=6409 23.8166464176 2 1316.722564 1316.718747 N R 78 91 PSM KSFPPPGPAEGLL 824 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=7758 26.1172896312 2 1309.705597 1308.707788 L R 5 18 PSM KAIEEGIPAFTCEEYV 825 sp|Q9Y2L1-2|RRP44_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 12-UNIMOD:4 ms_run[2]:scan=8623 28.065 2 1854.871 1854.8710 E K 153 169 PSM KAIEFLNNPPEEAP 826 sp|Q4G0J3|LARP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7421 25.509 2 1567.7882 1567.7882 A R 181 195 PSM KALDIAENEMPGLM 827 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 10-UNIMOD:35,14-UNIMOD:35 ms_run[2]:scan=6107 23.344 2 1562.732 1562.7320 R R 20 34 PSM KALDSNSLENDDLSAPG 828 sp|Q32MZ4-3|LRRF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6059 23.263 2 1744.8115 1744.8115 R R 706 723 PSM KALEFIPSDQQNEMV 829 sp|Q14671-4|PUM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=7365 25.413 2 1763.84 1763.8400 Q R 881 896 PSM KAMDQEITVNPQFVQ 830 sp|Q9UNS2-2|CSN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 3-UNIMOD:35 ms_run[2]:scan=6815 24.483 2 1762.856 1762.8560 L K 371 386 PSM KAPIQTYVLGANNQETV 831 sp|Q69YN2|C19L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7322 25.336 2 1844.9632 1844.9632 K K 62 79 PSM KAQSLVISPPAPSP 832 sp|P46013-2|KI67_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6561 24.057 2 1390.782 1390.7820 V R 212 226 PSM KAVTVMMDPNSTQ 833 sp|Q9HAV4|XPO5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 7-UNIMOD:35 ms_run[2]:scan=4591 19.942 2 1436.664 1436.6640 V R 15 28 PSM KAVTVMMDPNSTQ 834 sp|Q9HAV4|XPO5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 6-UNIMOD:35 ms_run[2]:scan=4814 20.604 2 1436.664 1436.6640 V R 15 28 PSM KDASVQTVATEGDLL 835 sp|Q96SN8-4|CK5P2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7508 25.661 2 1545.7886 1545.7886 L R 869 884 PSM KDATNVGDEGGFAPNILEN 836 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=9715 31.934 2 1959.9174 1959.9174 G K 202 221 PSM KDDAAPAPPVADA 837 sp|Q92667-2|AKAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4703 20.302 2 1236.5986 1236.5986 A K 281 294 PSM KDDPLTNLNTAFDVAE 838 sp|P12814-2|ACTN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8908 28.965 2 1761.8421 1761.8421 R K 198 214 PSM KDDVAPESGDTTV 839 sp|O76021-2|RL1D1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4420 19.324 2 1332.6045 1332.6045 S K 98 111 PSM KDFIIFEAAPQET 840 sp|P60510|PP4C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8672 28.191 2 1507.7559 1507.7559 Q R 281 294 PSM KDGEEVVESPALLLQ 841 sp|O75147-2|OBSL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8644 28.106 2 1625.8512 1625.8512 T K 933 948 PSM KDPATQQAFVFGQNL 842 sp|Q9H6Z4-3|RANB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8633 28.086 2 1662.8366 1662.8366 K R 184 199 PSM KDPFDTLATMTDQQ 843 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8767 28.481 2 1609.7294 1609.7294 E R 993 1007 PSM KEALQDVEDENQ 844 sp|P62258-2|1433E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4434 19.376 2 1416.6369 1416.6369 N - 222 234 PSM KEDAYDGVTSENM 845 sp|Q9NUM4|T106B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 13-UNIMOD:35 ms_run[2]:scan=4389 19.208 2 1473.593 1473.5930 S R 14 27 PSM KEDIYAVEIVGGAT 846 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7955 26.516 2 1463.7508 1463.7508 K R 332 346 PSM KEEAPDILCLQET 847 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:4 ms_run[2]:scan=7923 26.454 2 1544.7392 1544.7392 V K 85 98 PSM KEEPADFPVEQPEEN 848 sp|Q5BKZ1-3|ZN326_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5849 22.906 2 1756.7792 1756.7792 A - 362 377 PSM KEESDDEAAVEEEEEE 849 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4647 20.133 2 1865.7174 1865.7174 E K 303 319 PSM KEEVSPEAVGVTSQ 850 sp|O15164-2|TIF1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5054 21.218 2 1458.7202 1458.7202 Q R 205 219 PSM KEIDDSVLGQTGPY 851 sp|O43615|TIM44_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7088 24.928 2 1520.7359 1520.7359 K R 188 202 PSM KEIFEQPESVVNTM 852 sp|Q06210-2|GFPT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7862 26.329 2 1649.7971 1649.7971 Q R 327 341 PSM KELYPEFGLDMND 853 sp|Q1ZZU3|SWI5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 11-UNIMOD:35 ms_run[2]:scan=8071 26.736 2 1585.697 1585.6970 T - 223 236 PSM KEMPQAPVLISCADQ 854 sp|Q8WY36-2|BBX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 3-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=6252 23.573 2 1701.8066 1701.8066 P - 897 912 PSM KEMPQAPVLISCADQ 855 sp|Q8WY36-2|BBX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 12-UNIMOD:4 ms_run[2]:scan=6973 24.744 2 1685.8117 1685.8117 P - 897 912 PSM KEPIMPAPGQEETV 856 sp|Q93052|LPP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 5-UNIMOD:35 ms_run[2]:scan=5076 21.278 2 1540.7443 1540.7443 C R 540 554 PSM KEVAELEANLPCTC 857 sp|Q969M7-5|UBE2F_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 12-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=6790 24.437 2 1632.7487 1632.7487 V K 39 53 PSM KFMQTFVLAPEGSVPN 858 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 3-UNIMOD:35 ms_run[2]:scan=7947 26.504 2 1779.8866 1779.8866 R K 107 123 PSM KGEVYPFGIVGMAN 859 sp|O75534-2|CSDE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8913 28.982 2 1480.7384 1480.7384 M K 597 611 PSM KGIINDDEDDEDLMMASG 860 sp|O75717|WDHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=6705 24.289 2 1982.8085 1982.8085 S R 351 369 PSM KGLQVGGCEPEPQVC 861 sp|P52888-2|THOP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 8-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=5626 22.512 2 1656.76 1656.7600 S - 244 259 PSM KGPAPAPQQCSEPET 862 sp|Q3YEC7|RABL6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 10-UNIMOD:4 ms_run[2]:scan=3966 17.55 2 1595.725 1595.7250 T K 482 497 PSM KGSPEEPVVGCPLGQ 863 sp|Q2TAK8-2|PWP3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 11-UNIMOD:4 ms_run[2]:scan=5949 23.092 2 1552.7555 1552.7555 S R 470 485 PSM KGTPEQPQCGFSNAVVQIL 864 sp|Q86SX6|GLRX5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:4 ms_run[2]:scan=8945 29.088 2 2072.0361 2072.0361 L R 59 78 PSM KGYLGPEQLPDCL 865 sp|P40926-2|MDHM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 12-UNIMOD:4 ms_run[2]:scan=8276 27.156 2 1488.7283 1488.7283 V K 78 91 PSM KGYVVPNVDLPPLCSS 866 sp|Q96B26|EXOS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:4 ms_run[2]:scan=8520 27.791 2 1743.8866 1743.8866 D R 76 92 PSM KIASLPQEVQDVSLLE 867 sp|Q9NQG5|RPR1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8950 29.104 2 1767.9618 1767.9618 Q K 200 216 PSM KIETTVPPSGLNLN 868 sp|P26358|DNMT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7672 25.958 2 1481.809 1481.8090 N R 530 544 PSM KILDQGEDFPASEMT 869 sp|P30040|ERP29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=6052 23.253 2 1695.7662 1695.7662 G R 208 223 PSM KILIANTGMDTD 870 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:35 ms_run[2]:scan=5168 21.48 2 1306.6439 1306.6439 A K 189 201 PSM KLDVEEPDSANSSFYST 871 sp|Q14980-5|NUMA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6750 24.366 2 1887.8374 1887.8374 K R 686 703 PSM KLIAPVAEEEATVPNN 872 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6261 23.584 2 1693.8887 1693.8887 E K 7 23 PSM KLLTECPPMMDTEYT 873 sp|P55060-4|XPO2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 6-UNIMOD:4,9-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=5854 22.914 2 1859.7991 1859.7991 T K 792 807 PSM KLLTECPPMMDTEYT 874 sp|P55060-4|XPO2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 6-UNIMOD:4,9-UNIMOD:35 ms_run[2]:scan=6912 24.638 2 1843.8042 1843.8042 T K 792 807 PSM KLMEALEPPLEEQQI 875 sp|Q96JM3|CHAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 3-UNIMOD:35 ms_run[2]:scan=7831 26.268 2 1782.9074 1782.9074 K - 798 813 PSM KLMGDEPDLDPDIN 876 sp|Q93008|USP9X_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7258 25.224 2 1570.7185 1570.7185 S K 703 717 PSM KLPEEVATPTTDEE 877 sp|O95602|RPA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5421 22.087 2 1557.741 1557.7410 Q K 350 364 PSM KLPGGELNPGEDEVEGL 878 sp|O43809|CPSF5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7748 26.1 2 1751.8578 1751.8578 F K 105 122 PSM KLQELEANPPSDVYLSS 879 sp|O60341|KDM1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7334 25.364 2 1888.9418 1888.9418 E R 507 524 PSM KLSFGLEDEPLETAT 880 sp|O94905|ERLN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8489 27.706 2 1648.8196 1648.8196 D K 322 337 PSM KLSVFSTVDAPVAPSD 881 sp|Q5JRX3-3|PREP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7911 26.425 2 1631.8407 1631.8407 A K 858 874 PSM KLTEQSNTPLLLPLAA 882 sp|Q9NYL2-2|M3K20_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=9052 29.528 2 1707.9771 1707.9771 Q R 321 337 PSM KLVLLTASDQDEDGVGS 883 sp|Q4VC44-2|FWCH1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7300 25.297 2 1745.8683 1745.8683 S K 41 58 PSM KLVLVSPTSEQYDSLL 884 sp|O00178|GTPB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8936 29.06 2 1790.9666 1790.9666 S R 64 80 PSM KLVQDVANNTNEEAGDGTTTATVLA 885 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5801 22.831 3 2531.2351 2531.2351 A R 96 121 PSM KMVIENELEDPAIM 886 sp|Q86TB9-4|PATL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 2-UNIMOD:35,14-UNIMOD:35 ms_run[2]:scan=6861 24.555 2 1662.7845 1662.7845 S R 92 106 PSM KNVTELNEPLSNEE 887 sp|P61981|1433G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5736 22.713 2 1614.7737 1614.7737 M R 28 42 PSM KPAAVVAPITTGYTV 888 sp|Q9HB71-3|CYBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7361 25.408 2 1486.8395 1486.8395 E K 16 31 PSM KPADTEPPPLLVY 889 sp|Q6P2Q9|PRP8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8297 27.207 2 1438.7708 1438.7708 I K 941 954 PSM KPGMVVTFAPVNVTTEV 890 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 4-UNIMOD:35 ms_run[2]:scan=8411 27.484 2 1803.9441 1803.9441 L K 273 290 PSM KPQAPPSQPLPQTQA 891 sp|Q2M2I8-2|AAK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4767 20.484 2 1586.8417 1586.8417 P K 419 434 PSM KPQPPVVQPPEEAMSGQQS 892 sp|O15027-3|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=5028 21.157 3 2048.9837 2048.9837 A R 752 771 PSM KPTPIQTQAIPAIMSG 893 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7893 26.391 2 1651.8967 1651.8967 E R 394 410 PSM KQEFMDGMTELGCDSIE 894 sp|Q96GG9|DCNL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:4 ms_run[2]:scan=6335 23.699 2 2020.8064 2020.8064 S K 119 136 PSM KQLLDLPLDTDLENE 895 sp|O43264-2|ZW10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=9070 29.604 2 1754.8938 1754.8938 Q K 305 320 PSM KQLSFISPPTPQP 896 sp|O43395|PRPF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7576 25.779 2 1438.782 1438.7820 K K 158 171 PSM KQPPVSPGTALVGSQ 897 sp|P17096|HMGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5532 22.325 2 1464.7936 1464.7936 R K 31 46 PSM KQQEVVVAGSSLPTSS 898 sp|Q9H3P7|GCP60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5636 22.531 2 1615.8417 1615.8417 Q K 306 322 PSM KQVFESDEAPDGNSYQDDQDDL 899 sp|Q96N67-7|DOCK7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6618 24.148 3 2514.0307 2514.0307 P K 155 177 PSM KSDIDEIVLVGGST 900 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8109 26.802 2 1431.7457 1431.7457 K R 353 367 PSM KSDSPTGDVLLDETL 901 sp|Q9H4A5-2|GLP3L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8495 27.721 2 1588.7832 1588.7832 L K 65 80 PSM KSEEPEVPDQEGLQ 902 sp|Q9H2V7-5|SPNS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5352 21.926 2 1583.7315 1583.7315 P R 35 49 PSM KSPISVPGGSALISNLG 903 sp|P51610-2|HCFC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8540 27.84 2 1595.8883 1595.8883 V K 596 613 PSM KSQETGDLDVGGLQETD 904 sp|P23142-2|FBLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6182 23.457 2 1790.817 1790.8170 V K 146 163 PSM KSQLLAPPPPSAPPGN 905 sp|P49750-3|YLPM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5672 22.597 2 1569.8515 1569.8515 S K 241 257 PSM KSSEPVVTMSVEYQM 906 sp|P18583-2|SON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5329 21.885 2 1745.7852 1745.7852 L K 258 273 PSM KSSGPTSLFAVTVAPPGA 907 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8624 28.067 2 1685.8988 1685.8988 G R 186 204 PSM KSSTVGLVTLNDM 908 sp|Q14320|FA50A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 13-UNIMOD:35 ms_run[2]:scan=6589 24.095 2 1379.6966 1379.6966 L K 61 74 PSM KSVPVPLQEAPQQ 909 sp|A1X283|SPD2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5495 22.237 2 1419.7722 1419.7722 S R 741 754 PSM KTAESQTPTPSATSFFSG 910 sp|P55265-5|DSRAD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7571 25.775 2 1842.8636 1842.8636 E K 300 318 PSM KTAVDGPDLEMLTGQE 911 sp|Q14318|FKBP8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 11-UNIMOD:35 ms_run[2]:scan=7438 25.532 2 1718.8033 1718.8033 L R 201 217 PSM KTAVDGPDLEMLTGQE 912 sp|Q14318|FKBP8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8395 27.44 2 1702.8084 1702.8084 L R 201 217 PSM KTAVVVGTITDDV 913 sp|Q07020-2|RL18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6932 24.673 2 1316.7187 1316.7187 N R 49 62 PSM KTEDSSVPETPDNE 914 sp|Q9H4L7|SMRCD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4148 18.276 2 1546.6635 1546.6635 E R 62 76 PSM KTIAPLVASGAVQLI 915 sp|Q9BRT9|SLD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8956 29.127 2 1479.9025 1479.9025 Y - 209 224 PSM KTLIDDDNPPVSFV 916 sp|P61964|WDR5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8461 27.626 2 1558.7879 1558.7879 L K 207 221 PSM KTTYDSSLSSYTVPLE 917 sp|Q8WWM7-6|ATX2L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7934 26.482 2 1789.8622 1789.8622 V K 267 283 PSM KTVQAEPLIQDNPECL 918 sp|Q8IXQ5-5|KLHL7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 15-UNIMOD:4 ms_run[2]:scan=7462 25.574 2 1853.9193 1853.9193 S K 197 213 PSM KTVQGPPTSDDIFE 919 sp|P04181|OAT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6858 24.551 2 1532.7359 1532.7359 K R 32 46 PSM KVALVYGQMNEPPGA 920 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:35 ms_run[2]:scan=5833 22.886 2 1588.7919 1588.7919 S R 264 279 PSM KVAYIPDEMAAQQNPLQQP 921 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 9-UNIMOD:35 ms_run[2]:scan=6952 24.709 3 2156.0572 2156.0572 L R 150 169 PSM KVDNSSLTGESEPQT 922 sp|P05023-3|AT1A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4470 19.516 2 1590.7373 1590.7373 C R 181 196 PSM KVIEQLGTPSAEFM 923 sp|P45984-3|MK09_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=6826 24.501 2 1564.7807 1564.7807 N K 236 250 PSM KVLCIINPGNPTGQVQS 924 sp|Q8TD30-2|ALAT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 4-UNIMOD:4 ms_run[2]:scan=7073 24.903 2 1823.9564 1823.9564 P R 162 179 PSM KVLEQLTGQTPVFS 925 sp|P62913-2|RL11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7803 26.213 2 1545.8403 1545.8403 A K 37 51 PSM KVTGPQATTGTPLVTM 926 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6882 24.587 2 1600.8494 1600.8494 L R 419 435 PSM KVVQNDAYTAPALPSSI 927 sp|Q9BY77-2|PDIP3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7647 25.909 2 1772.9309 1772.9309 T R 200 217 PSM KYPLNCADPTSE 928 sp|Q06124-3|PTN11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 6-UNIMOD:4 ms_run[2]:scan=5107 21.34 2 1393.6184 1393.6184 L R 99 111 PSM KYSVDPSIVNISDEMA 929 sp|Q9Y6M7-5|S4A7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 15-UNIMOD:35 ms_run[2]:scan=7540 25.714 2 1782.8346 1782.8346 L K 736 752 PSM RADSGPTQPPLSLSPAPET 930 sp|O15027-3|SC16A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6774 24.415 3 1919.9589 1919.9589 D K 2070 2089 PSM RDAEDAMDAMDGAVLDG 931 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 7-UNIMOD:35 ms_run[2]:scan=6060 23.265 2 1766.7087 1766.7087 K R 66 83 PSM RDALPEYSTFDVNM 932 sp|P49406|RM19_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=7619 25.862 2 1672.7403 1672.7403 L K 191 205 PSM RDDMIFEDCGDVPSEP 933 sp|P05026-2|AT1B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 4-UNIMOD:35,9-UNIMOD:4 ms_run[2]:scan=7259 25.225 2 1896.7506 1896.7506 Q K 118 134 PSM RDPAQPMSPGEATQSGA 934 sp|Q9BQG0|MBB1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4632 20.082 2 1698.7631 1698.7631 S R 4 21 PSM RDSLAAASGVLGGPQTPLAPEEETQA 935 sp|Q9Y5Y0|FLVC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=8107 26.8 3 2564.2718 2564.2718 P R 54 80 PSM RDSLLQDGEFSMDL 936 sp|P07737|PROF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 12-UNIMOD:35 ms_run[2]:scan=8564 27.898 2 1640.7352 1640.7352 I R 75 89 PSM RDVQIGDIVTVGEC 937 sp|P62280|RS11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:4 ms_run[2]:scan=8094 26.774 2 1559.7614 1559.7614 F R 118 132 PSM REEQLYDGYDEEYDCPILDED 938 sp|Q9Y3D8-2|KAD6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 15-UNIMOD:4 ms_run[2]:scan=8578 27.944 3 2665.065 2665.0650 A R 36 57 PSM REIVSSEDAVTPSAVTPSAPSASA 939 sp|O95714|HERC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6159 23.424 3 2328.1445 2328.1445 K R 3470 3494 PSM RELPVPGSAEEEPPSGGG 940 sp|P16383-2|GCFC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5509 22.269 2 1763.8326 1763.8326 P R 33 51 PSM RIYDPQEGAVVVLPADSQQ 941 sp|Q9NXF1-2|TEX10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7577 25.78 3 2084.0538 2084.0538 L R 601 620 PSM RMDIETNDTFSDEAVPESS 942 sp|O60934|NBN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 2-UNIMOD:35 ms_run[2]:scan=6141 23.392 2 2157.9008 2157.9008 P K 594 613 PSM RPLPPAAIESPAVAAPAYS 943 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=7089 24.929 2 1877.0047 1877.0047 V R 56 75 PSM RSGDSEVYQLGDVSQ 944 sp|Q04837|SSBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6317 23.672 2 1638.7485 1638.7485 W K 66 81 PSM RSLEEGEGPIAVIMTPT 945 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=7796 26.199 2 1814.9084 1814.9084 Q R 438 455 PSM RTTDGVYEGVAIGGD 946 sp|P53396-2|ACLY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=6257 23.579 2 1508.7107 1508.7107 S R 666 681 PSM RTVLVNADGEEVAM 947 sp|Q03252|LMNB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=5406 22.044 2 1518.7348 1518.7348 F R 561 575 PSM RVLIVSEDPELPYM 948 sp|O95831-6|AIFM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 14-UNIMOD:35 ms_run[2]:scan=8111 26.806 2 1675.8491 1675.8491 A R 71 85 PSM RVLVEPDAGAGVAVM 949 sp|P42126-2|ECI1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 15-UNIMOD:35 ms_run[2]:scan=6163 23.432 2 1498.7814 1498.7814 Q K 46 61 PSM KTIGGGDDSFNTFFSETGAG 950 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=8518 27.7864371008 2 2007.872999 2006.885765 D K 40 60 PSM KDYEEVGADSADGEDEGEEY 951 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=9369 30.756327238133334 2 2206.841160 2205.834577 E - 430 450 PSM RPAMEPGNGSLDLGGDSAG 952 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 4-UNIMOD:35 ms_run[1]:scan=5608 22.479234553866668 2 1816.789862 1815.805741 G R 50 69 PSM RTVGTPIASVPGSTNTGTVPGSE 953 sp|Q99460|PSMD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=6088 23.313864419466665 3 2185.103986 2184.102240 L K 269 292 PSM KAGEAPTENPAPPTQQSSAE 954 sp|P16989|YBOX3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=4268 18.722695192266666 2 2009.921053 2008.933778 A - 353 373 PSM KDSPPVSVQIPTGQN 955 sp|Q14674|ESPL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=6196 23.482100936266665 2 1566.809513 1565.804936 E K 1732 1747 PSM KLDFIESDSPCSSEALS 956 sp|O43432|IF4G3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 11-UNIMOD:4 ms_run[1]:scan=7651 25.9156763104 2 1883.845260 1883.845874 Q K 1401 1418 PSM KAPPVDDAEVDELVLQT 957 sp|Q9UIG0|BAZ1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=8486 27.6995538888 2 1838.930734 1837.930924 P K 1318 1335 PSM KAMSTLVPQGGPVLC 958 sp|O94776|MTA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 15-UNIMOD:4 ms_run[1]:scan=7504 25.653794827733336 2 1557.811069 1556.805470 A R 247 262 PSM KLPQVAEEISGPLTSAN 959 sp|O75955|FLOT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 ms_run[1]:scan=8135 26.84949080506667 2 1752.926815 1752.925779 E K 360 377 PSM KDPASGICTLLYDSAPSG 960 sp|P46020|KPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 33 8-UNIMOD:4 ms_run[1]:scan=8799 28.581820948266667 2 1850.872561 1850.872030 A R 1178 1196 PSM KAAPGPGPSTFSFVPPS 961 sp|P35658-2|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8070 26.734 2 1642.8355 1642.8355 S K 510 527 PSM KADTLTPEECQQF 962 sp|Q16181-2|SEPT7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 10-UNIMOD:4 ms_run[2]:scan=5999 23.171 2 1565.7032 1565.7032 A K 194 207 PSM KADTTSTVTPVPGQE 963 sp|Q9H9B1-4|EHMT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4581 19.915 2 1529.7573 1529.7573 A K 644 659 PSM KAGEVINQPMMMAA 964 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 11-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5052 21.213 2 1521.699 1521.6990 Q R 889 903 PSM KALQEGEGDLSISAD 965 sp|P49589-2|SYCC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5955 23.104 2 1531.7366 1531.7366 Q R 295 310 PSM KAPVSYPNTLPESFT 966 sp|Q8WX92|NELFB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7746 26.097 2 1649.8301 1649.8301 E K 398 413 PSM KAPVTVTSLPAGV 967 sp|P51610-2|HCFC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6976 24.751 2 1238.7234 1238.7234 G R 442 455 PSM KAQAAAPASVPAQAP 968 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4686 20.251 2 1376.7412 1376.7412 T K 134 149 PSM KAVAAAAAASAAASGGPSAAPSGENEAES 969 sp|O15164-2|TIF1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5164 21.471 3 2470.1572 2470.1572 E R 7 36 PSM KAVAEQIPLLVQGV 970 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8937 29.063 2 1463.8712 1463.8712 C R 957 971 PSM KDGSLEVTGQLGEVM 971 sp|P36776-3|LONM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 15-UNIMOD:35 ms_run[2]:scan=6662 24.217 2 1577.7607 1577.7607 D K 600 615 PSM KDLDVAILVGSMP 972 sp|P40925|MDHC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 12-UNIMOD:35 ms_run[2]:scan=8530 27.816 2 1372.7272 1372.7272 F R 79 92 PSM KDLVLGPSGVLQGI 973 sp|Q49A26-4|GLYR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8975 29.205 2 1394.8133 1394.8133 A R 269 283 PSM KDVFMPPSSSSELQES 974 sp|O95243-3|MBD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 5-UNIMOD:35 ms_run[2]:scan=6236 23.543 2 1782.7982 1782.7982 K R 186 202 PSM KDVNSSSPVMLAF 975 sp|Q99598|TSNAX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 10-UNIMOD:35 ms_run[2]:scan=8069 26.732 2 1409.6861 1409.6861 G K 27 40 PSM KDVSGPMPDSYSP 976 sp|P26640|SYVC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5667 22.587 2 1378.6075 1378.6075 K R 290 303 PSM KEADPGETPSEAPSEA 977 sp|Q9NQ66-2|PLCB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4164 18.339 2 1613.7057 1613.7057 K R 840 856 PSM KEALEPSGENVIQN 978 sp|O75477|ERLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5284 21.787 2 1526.7577 1526.7577 S K 330 344 PSM KEALQDVEDENQ 979 sp|P62258-2|1433E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4827 20.64 2 1416.6369 1416.6369 N - 222 234 PSM KEALTYDGALLGD 980 sp|Q15056-2|IF4H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7445 25.541 2 1364.6824 1364.6824 L R 96 109 PSM KECEGIVPVPLAE 981 sp|P82932|RT06_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 3-UNIMOD:4 ms_run[2]:scan=7841 26.288 2 1439.733 1439.7330 L K 103 116 PSM KEDNDTINDSLIVSET 982 sp|Q5UIP0-2|RIF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7281 25.264 2 1791.8374 1791.8374 L K 1801 1817 PSM KEIELPSGQLMGLFN 983 sp|Q9H0A0-2|NAT10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 11-UNIMOD:35 ms_run[2]:scan=8971 29.19 2 1690.86 1690.8600 E R 810 825 PSM KELSDPAGAIIYTS 984 sp|O15067|PUR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7094 24.936 2 1463.7508 1463.7508 L R 527 541 PSM KEPELLEPIPYEFMA 985 sp|P46778|RL21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=9162 30.039 2 1820.8906 1820.8906 G - 146 161 PSM KEQGQAPITPQQGQALA 986 sp|P84095|RHOG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5344 21.912 2 1763.9166 1763.9166 L K 130 147 PSM KEQVLEPMLNGTD 987 sp|Q02880-2|TOP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 8-UNIMOD:35 ms_run[2]:scan=5800 22.83 2 1488.713 1488.7130 Y K 952 965 PSM KEQVLEPMLNGTE 988 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 8-UNIMOD:35 ms_run[2]:scan=5845 22.902 2 1502.7287 1502.7287 Y K 936 949 PSM KEVEPALELLEPIDQ 989 sp|P31150|GDIA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9148 29.972 2 1721.9087 1721.9087 E K 364 379 PSM KEVGSPPLDPTE 990 sp|Q96EK5|KBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5146 21.434 2 1267.6296 1267.6296 M R 174 186 PSM KGAEEMETVIPVDVM 991 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 6-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=6857 24.55 2 1678.7794 1678.7794 A R 12 27 PSM KGAEEMETVIPVDVM 992 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8865 28.812 2 1646.7895 1646.7895 A R 12 27 PSM KGDILVVATGQPEMV 993 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=7290 25.279 2 1571.8229 1571.8229 N K 208 223 PSM KGLVVDMDGFEEE 994 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7759 26.12 2 1466.6599 1466.6599 E R 432 445 PSM KGPDGLTAFEATDNQAI 995 sp|P58546|MTPN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7979 26.56 2 1746.8424 1746.8424 V K 97 114 PSM KGSVSLTTGQPVDQPTTESCSTL 996 sp|Q9H582-2|ZN644_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 20-UNIMOD:4 ms_run[2]:scan=6208 23.504 3 2392.1428 2392.1428 N K 133 156 PSM KGSVSLTTGQPVDQPTTESCSTL 997 sp|Q9H582-2|ZN644_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 20-UNIMOD:4 ms_run[2]:scan=6221 23.521 3 2392.1428 2392.1428 N K 133 156 PSM KGTIQVITQGTSL 998 sp|O43175|SERA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7060 24.885 2 1344.7613 1344.7613 P K 351 364 PSM KGVGDGTVSWGLEDDEDMTLT 999 sp|Q13404-8|UB2V1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 18-UNIMOD:35 ms_run[2]:scan=8349 27.332 2 2239.9791 2239.9791 Q R 26 47 PSM KGVLFGVPGAFTPGCS 1000 sp|P30044-2|PRDX5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 15-UNIMOD:4 ms_run[2]:scan=8883 28.872 2 1592.8021 1592.8021 K K 34 50 PSM KIETVNESWNALATPSD 1001 sp|P21399|ACOC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7887 26.381 2 1873.9058 1873.9058 Q K 615 632 PSM KIGPILDNSTLQSEV 1002 sp|P30153|2AAA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7981 26.563 2 1612.8672 1612.8672 Q K 546 561 PSM KIISNASCTTNCLAPLA 1003 sp|P04406-2|G3P_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 8-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=6833 24.511 2 1832.9125 1832.9125 L K 103 120 PSM KIITIPATQLAQCQLQT 1004 sp|Q15723-4|ELF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 13-UNIMOD:4 ms_run[2]:scan=8161 26.902 2 1926.0608 1926.0608 A K 369 386 PSM KLAALNPESNTAGLDIFA 1005 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9063 29.576 2 1843.968 1843.9680 P K 95 113 PSM KLAPALATGNTVVM 1006 sp|P30837|AL1B1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=6008 23.188 2 1400.7697 1400.7697 W K 195 209 PSM KLATQSNEITIPVTFES 1007 sp|P04792|HSPB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8517 27.784 2 1876.9782 1876.9782 P R 171 188 PSM KLDEMEFNPVQQPQLNE 1008 sp|Q9Y2W2|WBP11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 5-UNIMOD:35 ms_run[2]:scan=7254 25.218 3 2073.9677 2073.9677 E K 59 76 PSM KLDQLDGSFDDPNTVVA 1009 sp|Q9UJC3-2|HOOK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7826 26.26 2 1832.8792 1832.8792 E K 186 203 PSM KLGPALATGNVVVM 1010 sp|P05091-2|ALDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=6658 24.212 2 1384.7748 1384.7748 W K 148 162 PSM KLGSTAPQVLSTSSPAQQAENEA 1011 sp|Q9UNZ2-6|NSF1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6102 23.335 3 2313.1448 2313.1448 Q K 148 171 PSM KLLEPVVSMSDML 1012 sp|O75351|VPS4B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 9-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=7363 25.412 2 1492.7517 1492.7517 D R 403 416 PSM KLLEPVVSMSDML 1013 sp|O75351|VPS4B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 9-UNIMOD:35 ms_run[2]:scan=8270 27.141 2 1476.7568 1476.7568 D R 403 416 PSM KLLGASELPIVTPAL 1014 sp|P52292|IMA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9123 29.845 2 1520.9178 1520.9178 V R 300 315 PSM KLNEAQPSTIATSM 1015 sp|P56537-2|IF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=4750 20.441 2 1505.7396 1505.7396 F R 204 218 PSM KLPTGTTLESAGVVCPY 1016 sp|P54098|DPOG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 15-UNIMOD:4 ms_run[2]:scan=7637 25.895 2 1791.9077 1791.9077 A R 633 650 PSM KLTITSNPEMTFPGE 1017 sp|Q9H3U1-2|UN45A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 10-UNIMOD:35 ms_run[2]:scan=6982 24.76 2 1679.8076 1679.8076 A R 699 714 PSM KLVINGNPITIFQE 1018 sp|P04406-2|G3P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9108 29.771 2 1584.8875 1584.8875 G R 24 38 PSM KMNLPGEVTFLPLN 1019 sp|Q9UQE7|SMC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 2-UNIMOD:35 ms_run[2]:scan=8847 28.738 2 1587.8331 1587.8331 N K 578 592 PSM KNDVLPLSNSVPEDVG 1020 sp|Q96EQ0|SGTB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7554 25.743 2 1681.8523 1681.8523 C K 68 84 PSM KNPSTNFQEPVQPLTQQQVAQMQL 1021 sp|P19623|SPEE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 22-UNIMOD:35 ms_run[2]:scan=7582 25.789 3 2769.3756 2769.3756 S K 253 277 PSM KNSVTPDMMEEMY 1022 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 8-UNIMOD:35,9-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=4655 20.163 2 1621.631 1621.6310 I K 228 241 PSM KPAEGNPTDQAGFSED 1023 sp|Q86XL3-2|ANKL2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4845 20.687 2 1661.7169 1661.7169 L R 139 155 PSM KPDQIGIITPYEGQ 1024 sp|Q92900-2|RENT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7430 25.523 2 1557.8039 1557.8039 A R 786 800 PSM KPEYIQMLMPPLIQ 1025 sp|Q92973-3|TNPO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 9-UNIMOD:35 ms_run[2]:scan=9061 29.565 2 1715.899 1715.8990 N K 516 530 PSM KPSPIQEESIPIALSG 1026 sp|P26196|DDX6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8098 26.782 2 1664.8985 1664.8985 E R 118 134 PSM KQALETVNDYNPLM 1027 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=7212 25.145 2 1650.7923 1650.7923 L K 323 337 PSM KQIDAPGDPFPLNP 1028 sp|Q2NL82|TSR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8114 26.81 2 1507.7671 1507.7671 M R 300 314 PSM KQPVTDPLLTPVE 1029 sp|Q9BVJ6-2|UT14A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7485 25.618 2 1435.7922 1435.7922 N K 28 41 PSM KSDIGEVILVGGMT 1030 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 13-UNIMOD:35 ms_run[2]:scan=7747 26.099 2 1433.7436 1433.7436 S R 377 391 PSM KSDVLQPGAEVTTDD 1031 sp|P53992-2|SC24C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5326 21.88 2 1573.7471 1573.7471 L R 161 176 PSM KSPFEVQVGPEAGMQ 1032 sp|O75369-5|FLNB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:35 ms_run[2]:scan=6987 24.767 2 1618.7661 1618.7661 P K 536 551 PSM KSPFEVQVGPEAGMQ 1033 sp|O75369-5|FLNB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7530 25.696 2 1602.7712 1602.7712 P K 536 551 PSM KSVTEQGAELSNEE 1034 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4641 20.109 2 1519.7002 1519.7002 M R 27 41 PSM KTADSEVNTDQDIE 1035 sp|Q8ND24-2|RN214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4440 19.403 2 1563.69 1563.6900 F K 55 69 PSM KTAFQEALDAAGD 1036 sp|P10599-2|THIO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6374 23.763 2 1335.6307 1335.6307 S K 8 21 PSM KTEPPQGEDQVDICNL 1037 sp|A1X283|SPD2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:4 ms_run[2]:scan=7051 24.872 2 1841.8465 1841.8465 P R 651 667 PSM KTFEGVDPQTTSM 1038 sp|P31150|GDIA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 13-UNIMOD:35 ms_run[2]:scan=4992 21.077 2 1455.6552 1455.6552 P R 156 169 PSM KTITLEVEPSDTIENV 1039 sp|P62987|RL40_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7989 26.578 2 1786.92 1786.9200 G K 11 27 PSM KTLQTDSIDSFETQ 1040 sp|P06400|RB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6549 24.039 2 1611.7628 1611.7628 D R 341 355 PSM KTLVGSENPPLTVI 1041 sp|Q13576-3|IQGA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8083 26.755 2 1466.8344 1466.8344 Y R 267 281 PSM KTPPAPSPFDLPEL 1042 sp|O95239|KIF4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9156 30.009 2 1507.7922 1507.7922 K K 1180 1194 PSM KTVCGENLPPLTYDQL 1043 sp|Q16850-2|CP51A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 4-UNIMOD:4 ms_run[2]:scan=8396 27.443 2 1846.9135 1846.9135 Q K 243 259 PSM KTVTNAVVTVPAYFNDSQ 1044 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9403 30.87 2 1952.9844 1952.9844 G R 137 155 PSM KTVYVSVLPTTADF 1045 sp|P41252|SYIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8815 28.622 2 1539.8185 1539.8185 M - 1249 1263 PSM KTYDPSGDSTLPTCS 1046 sp|Q9Y2X3|NOP58_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 14-UNIMOD:4 ms_run[2]:scan=5094 21.315 2 1627.7036 1627.7036 V K 426 441 PSM KVASSPVMVSNPAT 1047 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 8-UNIMOD:35 ms_run[2]:scan=4803 20.579 2 1402.7126 1402.7126 V R 525 539 PSM KVATLNSEEESDPPTY 1048 sp|Q00341-2|VIGLN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5530 22.322 2 1778.821 1778.8210 I K 61 77 PSM KVEDVSAVEIVGGAT 1049 sp|Q92598-2|HS105_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7108 24.959 2 1472.7722 1472.7722 L R 331 346 PSM KVEGFPTIYFAPSGD 1050 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8990 29.265 2 1626.793 1626.7930 Y K 596 611 PSM KVEQNSEPCAGSSSESDLQTVF 1051 sp|Q8N806|UBR7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 9-UNIMOD:4 ms_run[2]:scan=7484 25.617 3 2398.0594 2398.0594 V K 252 274 PSM KVGIPVTDENGN 1052 sp|Q9H9B4|SFXN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5007 21.11 2 1241.6252 1241.6252 L R 202 214 PSM KVLGMDPLPQMSQ 1053 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 5-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=5535 22.331 2 1474.716 1474.7160 H R 1028 1041 PSM KVLPGVDALSNI 1054 sp|P00558-2|PGK1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8166 26.915 2 1224.7078 1224.7078 G - 378 390 PSM KVLSVPESTPFTAVL 1055 sp|P61960|UFM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9041 29.484 2 1586.892 1586.8920 Y K 19 34 PSM KVPDPQMSMENLVES 1056 sp|Q8NEB9|PK3C3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 7-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=5354 21.932 2 1734.7804 1734.7804 V K 254 269 PSM KVPIPAPNEVLND 1057 sp|Q9C0J8|WDR33_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7144 25.02 2 1404.7613 1404.7613 N R 512 525 PSM KVQEETTLVDDPFQM 1058 sp|Q9NZ63|TLS1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8820 28.64 2 1778.8397 1778.8397 E K 57 72 PSM KVTPPAVTGSPEFE 1059 sp|Q99735-2|MGST2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6267 23.591 2 1457.7402 1457.7402 Y R 34 48 PSM KVVLASQPDLECGFS 1060 sp|Q9P2I0|CPSF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 12-UNIMOD:4 ms_run[2]:scan=7434 25.527 2 1648.8131 1648.8131 P R 324 339 PSM KVVLAYEPVWAIGTG 1061 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=9130 29.887 2 1601.8817 1601.8817 S K 160 175 PSM KYLVVNADEGEPGTC 1062 sp|P49821-2|NDUV1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 15-UNIMOD:4 ms_run[2]:scan=5872 22.945 2 1650.7559 1650.7559 P K 102 117 PSM RADAEAVLAPPEPAQ 1063 sp|Q8WZA9|IRGQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6057 23.26 2 1533.7787 1533.7787 M - 609 624 PSM RAGYIIPLQGPGLTTTES 1064 sp|P10253|LYAG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8464 27.633 2 1872.9945 1872.9945 L R 819 837 PSM RAPPEPAPPAEATGAPAPS 1065 sp|P84157-2|MXRA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5020 21.138 2 1782.8901 1782.8901 A R 39 58 PSM RDPAAPEPEEQEE 1066 sp|Q969T4|UB2E3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4129 18.199 2 1495.6427 1495.6427 Q R 25 38 PSM REDDCEEPIEDMQLTS 1067 sp|Q9NR09|BIRC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 5-UNIMOD:4 ms_run[2]:scan=7390 25.454 2 1965.7932 1965.7932 N K 870 886 PSM REEPVAIESPGQDLLGES 1068 sp|Q96RG2-4|PASK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7928 26.463 2 1924.9378 1924.9378 G R 516 534 PSM RELEDATETADAMN 1069 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 13-UNIMOD:35 ms_run[2]:scan=4142 18.25 2 1580.6624 1580.6624 Q R 1898 1912 PSM RFIIGESQAGEQPTQTVMPGQVM 1070 sp|Q9NQX3|GEPH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 23-UNIMOD:35 ms_run[2]:scan=7695 26.002 3 2519.2148 2519.2148 D R 387 410 PSM RGDGVTPPAGTAAPAPPPLSQDVPG 1071 sp|Q96KQ7-2|EHMT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6995 24.778 3 2324.1761 2324.1761 P R 516 541 PSM RGSFPLAAAGPSQSPAPPLPEED 1072 sp|Q8IY26|PLPP6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7953 26.513 3 2290.123 2290.1230 R R 68 91 PSM RGSMVGPFQEAAFALPVSGMD 1073 sp|Q9Y237|PIN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 4-UNIMOD:35,20-UNIMOD:35 ms_run[2]:scan=9024 29.403 3 2198.0136 2198.0136 T K 87 108 PSM RIDNDGDGFVTTEEL 1074 sp|Q15293|RCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7739 26.084 2 1679.7639 1679.7639 D K 90 105 PSM RLLAQDQGQGAPLLEPAP 1075 sp|Q15102|PA1B3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7632 25.885 2 1873.0058 1873.0058 L - 214 232 PSM RLPEEPVLEDEQQQLE 1076 sp|Q15811-13|ITSN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7546 25.729 2 1950.9535 1950.9535 Q K 328 344 PSM RMTEEPLMCAYCVTEPGAGSDVAGI 1077 sp|P11310|ACADM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 2-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=8191 26.977 3 2745.1754 2745.1754 G K 148 173 PSM RMTEEPLMCAYCVTEPGAGSDVAGI 1078 sp|P11310|ACADM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 2-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=8199 26.996 3 2745.1754 2745.1754 G K 148 173 PSM RPDEVPDDDEPAGPM 1079 sp|Q9Y639-1|NPTN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 15-UNIMOD:35 ms_run[2]:scan=4713 20.342 2 1654.6781 1654.6781 K K 249 264 PSM RSEPFPAPPEDDAATA 1080 sp|Q9BVA0|KTNB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=6116 23.356 2 1669.7584 1669.7584 R K 399 415 PSM RSLDGAPIGVMDQSLM 1081 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 11-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=6493 23.946 2 1720.8124 1720.8124 S K 549 565 PSM RSVPTSTVFYPSDGVATE 1082 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=7097 24.942 2 1911.9214 1911.9214 F K 438 456 PSM RTQIAPGSQTVLGIGPGPADLID 1083 sp|Q9Y3E5|PTH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=8976 29.211 3 2275.2172 2275.2172 G K 148 171 PSM RVVVDPVVTEQPSTSSAA 1084 sp|Q8WWQ0|PHIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5895 22.987 2 1840.9531 1840.9531 N K 1510 1528 PSM KSFYPEEVSSMVLT 1085 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 11-UNIMOD:35 ms_run[1]:scan=7512 25.6686216728 2 1631.774252 1631.775276 T K 112 126 PSM KDLYANTVLSGGTTMYPGIAD 1086 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 15-UNIMOD:35 ms_run[1]:scan=9471 31.101941570666668 2 2203.057718 2202.051451 R R 291 312 PSM KQQQMPPPPPPPPPPPPAGGTGG 1087 sp|O14654|IRS4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 5-UNIMOD:35 ms_run[1]:scan=5235 21.652181811200002 3 2243.124258 2242.120474 S K 623 646 PSM KEQVLEPMLNGTE 1088 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=6977 24.753080003466668 2 1486.723490 1486.733745 Y K 936 949 PSM KYPASTVQILGAE 1089 sp|O00567|NOP56_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=7034 24.847764577066666 2 1376.750646 1375.734731 A K 320 333 PSM RPLEVAIEASNGASDYGN 1090 sp|O15067|PUR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=6720 24.3171598152 2 1862.866813 1861.880620 A K 377 395 PSM KEAAGEGPALYED 1091 sp|P27695|APEX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 32 ms_run[1]:scan=5228 21.626356990133335 2 1348.6123 1348.6142 D P 35 48 PSM KINVPELPTPDEDN 1092 sp|O43264|ZW10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=7364 25.4124775488 2 1579.763887 1579.772967 S K 430 444 PSM KQMTDVLLTPATDAL 1093 sp|Q8N1F7|NUP93_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 3-UNIMOD:35 ms_run[1]:scan=8145 26.868699016266664 2 1632.836149 1631.844024 V K 228 243 PSM RIPTPLNTSGVQVICM 1094 sp|Q96CW1|AP2M1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 15-UNIMOD:4,16-UNIMOD:35 ms_run[1]:scan=7740 26.085258383733333 2 1800.914717 1800.922626 V K 323 339 PSM KVEQLGAEGNVEESQ 1095 sp|Q9Y383|LC7L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=4924 20.906282612 2 1616.754400 1615.768944 A K 139 154 PSM KYMDVSGLASSSVPANEVPA 1096 sp|P35453|HXD13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 3-UNIMOD:35 ms_run[1]:scan=6615 24.139605242400002 2 2036.982581 2036.972472 E R 166 186 PSM KEVTDMNLNVINEGGID 1097 sp|Q96TA1|NIBA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 6-UNIMOD:35 ms_run[1]:scan=6951 24.705998895466667 2 1875.869237 1875.888408 F K 367 384 PSM KAEGDSAGTAGTPGGTPAGD 1098 sp|Q92925|SMRD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=3747 16.573411574933335 2 1715.761441 1715.759836 S K 206 226 PSM KPVEYTAVSVLAGP 1099 sp|Q9BW91|NUDT9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 32 ms_run[1]:scan=7945 26.499989140533334 2 1429.784209 1429.781681 Y R 95 109 PSM KAAAPGVEDEPLL 1100 sp|P31350|RIR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7076 24.908 2 1308.6925 1308.6925 T R 61 74 PSM KAAATPESQEPQA 1101 sp|P49006|MRP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=3753 16.599 2 1326.6416 1326.6416 G K 144 157 PSM KAAIPPPVYEEQD 1102 sp|Q96I25|SPF45_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5528 22.317 2 1455.7246 1455.7246 S R 206 219 PSM KAALDGTPGMIGYGMA 1103 sp|P09417-2|DHPR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5986 23.15 2 1583.7324 1583.7324 A K 107 123 PSM KAAPAAPPVPAANEIATN 1104 sp|Q12816-2|TROP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5751 22.748 2 1701.905 1701.9050 T K 81 99 PSM KAEDGATPSPSNETP 1105 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4097 18.068 2 1499.674 1499.6740 P K 137 152 PSM KAEMTCSGILPIDQM 1106 sp|Q9H089|LSG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 4-UNIMOD:35,6-UNIMOD:4,15-UNIMOD:35 ms_run[2]:scan=6702 24.284 2 1724.7783 1724.7783 T R 450 465 PSM KALEIADFSGNPLS 1107 sp|Q14160-2|SCRIB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8547 27.858 2 1460.7511 1460.7511 C R 24 38 PSM KAMDQEITVNPQFVQ 1108 sp|Q9UNS2-2|CSN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7412 25.492 2 1746.8611 1746.8611 L K 371 386 PSM KAMGIMNSFVNDIFE 1109 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=9046 29.502 2 1746.7957 1746.7957 S R 58 73 PSM KAQGAGVTLPPTPSGS 1110 sp|Q6P996-4|PDXD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5393 22.015 2 1466.7729 1466.7729 Y R 652 668 PSM KASIPFSVVGSNQLIEA 1111 sp|Q15019|SEPT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8813 28.618 2 1758.9516 1758.9516 L K 232 249 PSM KATTLPDAQDTEALQE 1112 sp|Q4AC94|C2CD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5912 23.011 2 1729.837 1729.8370 N R 1984 2000 PSM KAVASLPPEQMFELM 1113 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 15-UNIMOD:35 ms_run[2]:scan=8709 28.296 2 1705.8419 1705.8419 S K 130 145 PSM KDAEAEGLSGTTLLP 1114 sp|Q9UI14|PRAF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8011 26.616 2 1500.7672 1500.7672 Q K 9 24 PSM KDCEVVMMIGLPGAG 1115 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:4,7-UNIMOD:35 ms_run[2]:scan=8527 27.81 2 1591.7408 1591.7408 K K 476 491 PSM KDCEVVMMIGLPGAG 1116 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:4 ms_run[2]:scan=9013 29.354 2 1575.7459 1575.7459 K K 476 491 PSM KDDPPPPEDDEN 1117 sp|P63208-2|SKP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=3449 15.245 2 1366.5525 1366.5525 H K 66 78 PSM KDLTPAVTDNDEAD 1118 sp|P57772-2|SELB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4783 20.525 2 1502.6736 1502.6736 S K 355 369 PSM KDMEPEMVCIDSCG 1119 sp|Q9NQT5|EXOS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=5726 22.696 2 1685.6405 1685.6405 N R 172 186 PSM KDMEPEMVCIDSCG 1120 sp|Q9NQT5|EXOS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=6240 23.55 2 1685.6405 1685.6405 N R 172 186 PSM KDMEPEMVCIDSCG 1121 sp|Q9NQT5|EXOS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 9-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=6871 24.568 2 1669.6456 1669.6456 N R 172 186 PSM KDMYLIPLGATD 1122 sp|Q92576-2|PHF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35 ms_run[2]:scan=8165 26.913 2 1351.6694 1351.6694 V K 1221 1233 PSM KDPPSEANSIQSANATT 1123 sp|Q8N488|RYBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4344 19.016 2 1729.8119 1729.8119 L K 119 136 PSM KDQGPPPSFLELM 1124 sp|Q9UL42|PNMA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 13-UNIMOD:35 ms_run[2]:scan=8300 27.216 2 1473.7174 1473.7174 L K 316 329 PSM KDVDQETGEDLNPN 1125 sp|Q14562|DHX8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4557 19.842 2 1572.6904 1572.6904 M R 336 350 PSM KDVEFEVVGDAPE 1126 sp|Q9UBT2-2|SAE2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7031 24.843 2 1432.6722 1432.6722 G K 444 457 PSM KDVIELTDDSFD 1127 sp|Q15084-3|PDIA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7817 26.24 2 1395.6406 1395.6406 K K 157 169 PSM KDYEEVGADSADGEDEGEEY 1128 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9490 31.168 2 2205.8346 2205.8346 E - 430 450 PSM KEADASPASAGIC 1129 sp|Q9BW27-2|NUP85_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 13-UNIMOD:4 ms_run[2]:scan=4395 19.231 2 1275.5765 1275.5765 S R 50 63 PSM KEAGEGGEAEAPAAEGG 1130 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=3693 16.315 2 1528.6641 1528.6641 K K 176 193 PSM KEAMEDGEIDGN 1131 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4235 18.586 2 1306.5347 1306.5347 A K 627 639 PSM KEAMEDGEIDGN 1132 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4345 19.021 2 1306.5347 1306.5347 A K 627 639 PSM KEDNGIGILTLNNPS 1133 sp|Q9NTX5-5|ECHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8122 26.821 2 1583.8155 1583.8155 Q R 53 68 PSM KEDTSEQVVPVLV 1134 sp|P33527-8|MRP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7988 26.576 2 1441.7664 1441.7664 N K 246 259 PSM KEIFQTTVPYMVE 1135 sp|Q9Y4A5-2|TRRAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:35 ms_run[2]:scan=7755 26.112 2 1599.7854 1599.7854 F R 648 661 PSM KEIGINEDQFQEACTSPLA 1136 sp|Q96G28|CFA36_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 14-UNIMOD:4 ms_run[2]:scan=7698 26.007 2 2148.9997 2148.9997 L K 70 89 PSM KEIQEPDPTYEE 1137 sp|O60264|SMCA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5018 21.132 2 1476.662 1476.6620 Q K 71 83 PSM KEPFPTIYVDSQ 1138 sp|O43776|SYNC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7892 26.389 2 1422.7031 1422.7031 G K 38 50 PSM KESLPPAAEPSPVS 1139 sp|Q9NWT1|PK1IP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5829 22.877 2 1407.7246 1407.7246 M K 310 324 PSM KETIPLQETSLYTQD 1140 sp|P50897-2|PPT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7273 25.251 2 1764.8782 1764.8782 A R 150 165 PSM KETPPPLVPPAA 1141 sp|Q9BQA1-2|MEP50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5979 23.141 2 1215.6863 1215.6863 R R 3 15 PSM KEVGSPPLDPTE 1142 sp|Q96EK5|KBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5045 21.2 2 1267.6296 1267.6296 M R 174 186 PSM KEVGSPPLDPTE 1143 sp|Q96EK5|KBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5246 21.686 2 1267.6296 1267.6296 M R 174 186 PSM KEVMNADDPDLQ 1144 sp|Q13573|SNW1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 4-UNIMOD:35 ms_run[2]:scan=4266 18.715 2 1389.6082 1389.6082 P R 122 134 PSM KFAMEPEEFDSDTL 1145 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8557 27.882 2 1657.7182 1657.7182 K R 485 499 PSM KFYPPDPSQLTEDIT 1146 sp|O43491-3|E41L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8508 27.757 2 1749.8461 1749.8461 V R 295 310 PSM KGAEEMETVIPVDVM 1147 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 15-UNIMOD:35 ms_run[2]:scan=7944 26.498 2 1662.7845 1662.7845 A R 12 27 PSM KGAPEPGTQDASIPVE 1148 sp|Q9NXA8-4|SIR5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5470 22.183 2 1594.7839 1594.7839 G K 79 95 PSM KGDGPVQGIINFEQ 1149 sp|P00441|SODC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8197 26.992 2 1500.7573 1500.7573 L K 10 24 PSM KGMEPIEVPLEENSE 1150 sp|Q96EN8|MOCOS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35 ms_run[2]:scan=6886 24.593 2 1715.7924 1715.7924 A R 653 668 PSM KGTPEPGPLNAVDE 1151 sp|Q9ULA0-2|DNPEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5959 23.11 2 1422.6991 1422.6991 E R 201 215 PSM KGVAYDVPNPVFLEQ 1152 sp|Q16850-2|CP51A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8659 28.144 2 1674.8617 1674.8617 G K 42 57 PSM KGVGIISEGNETVEDIAA 1153 sp|P05023-3|AT1A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7790 26.188 2 1800.9105 1800.9105 A R 598 616 PSM KGYVVPNVDLPPLCSS 1154 sp|Q96B26|EXOS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 14-UNIMOD:4 ms_run[2]:scan=8665 28.168 2 1743.8866 1743.8866 D R 76 92 PSM KIAVYSCPFDGMITET 1155 sp|P50990-3|TCPQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:4 ms_run[2]:scan=8687 28.231 2 1830.8532 1830.8532 A K 165 181 PSM KIIPLYSTLPPQQQQ 1156 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7838 26.281 2 1752.9774 1752.9774 I R 384 399 PSM KILDSVGIEADDD 1157 sp|P05387|RLA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6724 24.326 2 1388.6671 1388.6671 K R 25 38 PSM KILETTMTPTGIDTA 1158 sp|Q9UMZ2-6|SYNRG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=5890 22.98 2 1606.8124 1606.8124 K K 227 242 PSM KIMQSSSEVGYDAMAGDFVNMVE 1159 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,14-UNIMOD:35 ms_run[2]:scan=8507 27.754 3 2539.0917 2539.0917 E K 493 516 PSM KIPGVSTPQTLAGTQ 1160 sp|Q8IWI9|MGAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6147 23.402 2 1496.8199 1496.8199 Q K 1552 1567 PSM KLAPITYPQGLAMA 1161 sp|P60763|RAC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 13-UNIMOD:35 ms_run[2]:scan=7551 25.739 2 1488.801 1488.8010 K R 133 147 PSM KLASEEPPDDEEALATI 1162 sp|Q9UBB4-2|ATX10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7610 25.845 2 1826.8786 1826.8786 L R 224 241 PSM KLEDGDIEEAPGAGG 1163 sp|Q9Y613|FHOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5139 21.415 2 1456.6682 1456.6682 L R 335 350 PSM KLIAPVAEEEATVPNN 1164 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6308 23.663 3 1693.8887 1693.8887 E K 7 23 PSM KLSVISVEDPPQ 1165 sp|P38117|ETFB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6485 23.933 2 1310.7082 1310.7082 S R 221 233 PSM KLTPITYPQGLAMA 1166 sp|P63000|RAC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 13-UNIMOD:35 ms_run[2]:scan=7572 25.776 2 1518.8116 1518.8116 K K 133 147 PSM KLVTDCVAAMNPDAVL 1167 sp|O95861-3|BPNT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 6-UNIMOD:4,10-UNIMOD:35 ms_run[2]:scan=7295 25.287 2 1731.8535 1731.8535 N R 146 162 PSM KLVYAPLSGVGGVLYD 1168 sp|Q14692|BMS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8983 29.236 2 1649.9029 1649.9029 E K 333 349 PSM KMDATANDVPSPYEV 1169 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 2-UNIMOD:35 ms_run[2]:scan=6230 23.536 2 1651.74 1651.7400 A R 433 448 PSM KMLPTYVCATPDGTE 1170 sp|P52789|HXK2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 8-UNIMOD:4 ms_run[2]:scan=6544 24.031 2 1681.7691 1681.7691 V K 510 525 PSM KMVVPGLDGAQIP 1171 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8481 27.686 2 1323.7221 1323.7221 L R 1158 1171 PSM KNALTTLAGPLTPPV 1172 sp|Q9H3P2|NELFA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8800 28.585 2 1491.8661 1491.8661 N K 146 161 PSM KNDFEIVLPENAE 1173 sp|Q99459|CDC5L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8408 27.474 2 1516.7409 1516.7409 P K 487 500 PSM KPAEQAEETAPIEATAT 1174 sp|Q8N4Q1|MIA40_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5001 21.097 2 1755.8527 1755.8527 K K 119 136 PSM KPAPPPAPPQAT 1175 sp|Q86VM9|ZCH18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4105 18.099 2 1170.6397 1170.6397 K K 639 651 PSM KPAVTLTSTPTQGES 1176 sp|Q9HCK8|CHD8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4921 20.897 2 1515.7781 1515.7781 L K 270 285 PSM KPDVTYSDVGGC 1177 sp|P35998-2|PRS7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:4 ms_run[2]:scan=4851 20.699 2 1296.5656 1296.5656 E K 32 44 PSM KPEGLPPISDVVLD 1178 sp|O43432-4|IF4G3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8751 28.412 2 1477.8028 1477.8028 Q K 361 375 PSM KPLAGTDDSVVSED 1179 sp|Q9ULF5-2|S39AA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4905 20.86 2 1431.6729 1431.6729 L R 112 126 PSM KPMMPQESLNGTGC 1180 sp|Q5JSZ5-5|PRC2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,4-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=4303 18.866 2 1580.6633 1580.6633 M R 706 720 PSM KPPPELCPEDINTF 1181 sp|Q16891-3|MIC60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:4 ms_run[2]:scan=8091 26.769 2 1655.7865 1655.7865 L K 643 657 PSM KPTDDIVLMAQTLE 1182 sp|P25440-4|BRD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 9-UNIMOD:35 ms_run[2]:scan=7735 26.078 2 1588.8018 1588.8018 N K 37 51 PSM KPTVFGGVQDDM 1183 sp|P30837|AL1B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:35 ms_run[2]:scan=5652 22.562 2 1308.602 1308.6020 I R 399 411 PSM KPVESPGDPNQLT 1184 sp|Q96QC0|PP1RA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4753 20.448 2 1380.6885 1380.6885 A R 378 391 PSM KQDLPNAMNAAEITD 1185 sp|P61204-2|ARF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 8-UNIMOD:35 ms_run[2]:scan=5499 22.245 2 1645.7618 1645.7618 N K 90 105 PSM KQEVAPVQYNIVEQN 1186 sp|Q9Y6N7-6|ROBO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6344 23.715 2 1757.8948 1757.8948 Q K 1006 1021 PSM KSAVCIADPLPTPSQE 1187 sp|Q99575|POP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 5-UNIMOD:4 ms_run[2]:scan=7183 25.089 2 1711.8451 1711.8451 I K 354 370 PSM KSIDLPIQSSLC 1188 sp|O95757|HS74L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:4 ms_run[2]:scan=7760 26.121 2 1359.7068 1359.7068 V R 578 590 PSM KSPELPGVQEDEAAS 1189 sp|Q8N5S9|KKCC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5581 22.429 2 1555.7366 1555.7366 G - 491 506 PSM KSPQPDPVDTPAST 1190 sp|P46013-2|KI67_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4377 19.159 2 1438.694 1438.6940 C K 1983 1997 PSM KSVPLATAPMAEQ 1191 sp|Q9Y678|COPG1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5551 22.358 2 1341.6962 1341.6962 L R 577 590 PSM KSVVTGGVQSVMGS 1192 sp|O60664-4|PLIN3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:35 ms_run[2]:scan=4676 20.228 2 1350.6813 1350.6813 T R 154 168 PSM KTADVTSLFGGEDTS 1193 sp|O00443|P3C2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7858 26.325 2 1526.71 1526.7100 S R 613 628 PSM KTAVWEEGPGGELVIQQ 1194 sp|O75616|ERAL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7962 26.53 2 1839.9367 1839.9367 Q K 371 388 PSM KTEDSLMPEEEFL 1195 sp|Q15459|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=8230 27.057 2 1582.7073 1582.7073 L R 686 699 PSM KTEEMPNDSVLEN 1196 sp|P49321-4|NASP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 5-UNIMOD:35 ms_run[2]:scan=4391 19.213 2 1520.6665 1520.6665 D K 425 438 PSM KTEQGPQVDETQF 1197 sp|P05091-2|ALDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5704 22.655 2 1505.6998 1505.6998 S K 308 321 PSM KTETVEEPMEEEEAA 1198 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5262 21.727 2 1720.7349 1720.7349 S K 285 300 PSM KTFIGPGGNMPGYL 1199 sp|P41250|GARS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:35 ms_run[2]:scan=7403 25.477 2 1466.7228 1466.7228 F R 283 297 PSM KTGADTTAAGPLFQQ 1200 sp|O60828-5|PQBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6349 23.722 2 1504.7522 1504.7522 A R 128 143 PSM KTIPNDPGFVVTLSN 1201 sp|Q93009-3|UBP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7873 26.351 2 1600.8461 1600.8461 D R 785 800 PSM KTIQPDLNGFIPGSAA 1202 sp|Q96D71-2|REPS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8376 27.399 2 1627.857 1627.8570 F K 294 310 PSM KTLAQAMLNNAQPDQYEAPD 1203 sp|Q92973-3|TNPO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=5888 22.977 3 2233.0321 2233.0321 Q K 576 596 PSM KTLEDIDLGPTE 1204 sp|Q8N0X4-2|CLYBL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6939 24.684 2 1329.6664 1329.6664 V K 92 104 PSM KTLINAEDPPMVVV 1205 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8352 27.34 2 1524.8222 1524.8222 Y R 856 870 PSM KTLQTISLLGYM 1206 sp|O60264|SMCA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:35 ms_run[2]:scan=8494 27.719 2 1382.7479 1382.7479 G K 211 223 PSM KTLSEVDYAPAGPA 1207 sp|O15357-2|SHIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5856 22.918 2 1417.7089 1417.7089 A R 886 900 PSM KTMQFEPSTMVYDAC 1208 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,15-UNIMOD:4 ms_run[2]:scan=7143 25.019 2 1822.7576 1822.7576 V R 15 30 PSM KTTTAAAVASTGPSS 1209 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=3882 17.223 2 1348.6834 1348.6834 A R 809 824 PSM KTVIEPMASEGL 1210 sp|P20020-5|AT2B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=5767 22.772 2 1289.6537 1289.6537 V R 634 646 PSM KTVTNAVVTVPAYFNDSQ 1211 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8054 26.706 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 1212 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9603 31.551 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 1213 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9626 31.631 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 1214 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9794 32.226 2 1952.9844 1952.9844 G R 137 155 PSM KVAEQEMQLEPITDE 1215 sp|Q8N3R9-2|MPP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=5826 22.872 2 1774.8295 1774.8295 D R 192 207 PSM KVASPSPSGSVLFTDEGVP 1216 sp|P56181-2|NDUV3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8123 26.823 2 1872.9469 1872.9469 R K 95 114 PSM KVAYIPDEMAAQQNPLQQP 1217 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 9-UNIMOD:35 ms_run[2]:scan=6989 24.771 3 2156.0572 2156.0572 L R 150 169 PSM KVDENFDCVEADDVEG 1218 sp|O14929-2|HAT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 8-UNIMOD:4 ms_run[2]:scan=6363 23.745 2 1839.7469 1839.7469 S K 9 25 PSM KVEPSDNGPLFTEL 1219 sp|Q99986|VRK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8643 28.104 2 1544.7722 1544.7722 V K 71 85 PSM KVIDSSDVVVQVLDA 1220 sp|Q13823|NOG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8958 29.135 2 1585.8563 1585.8563 Y R 212 227 PSM KVITDIAGVIPAE 1221 sp|P35249|RFC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8058 26.713 2 1324.7602 1324.7602 E K 260 273 PSM KVLISDSLDPCC 1222 sp|O43175|SERA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=6923 24.654 2 1405.6581 1405.6581 R R 8 20 PSM KVPDSTYEMIGGLD 1223 sp|P62195-2|PRS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 9-UNIMOD:35 ms_run[2]:scan=6738 24.347 2 1539.7127 1539.7127 E K 134 148 PSM KVVDYSQFQESDDADEDYG 1224 sp|Q9H1E3|NUCKS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6617 24.146 2 2208.8971 2208.8971 R R 9 28 PSM KVVLEAPDETTL 1225 sp|Q6GMV3|PTRD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7042 24.861 2 1313.7078 1313.7078 R K 80 92 PSM KVVPSFLPVDQGGSLVG 1226 sp|Q14126|DSG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8816 28.625 2 1697.9352 1697.9352 D R 667 684 PSM KVVSTPPSVTEPPE 1227 sp|Q92667-2|AKAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5173 21.49 2 1465.7664 1465.7664 P K 66 80 PSM KVVYGDTDSVMC 1228 sp|P28340|DPOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=4717 20.358 2 1388.5952 1388.5952 A R 750 762 PSM KYDPPLEDGAMPSA 1229 sp|P47756-2|CAPZB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:35 ms_run[2]:scan=5204 21.56 2 1505.6708 1505.6708 N R 78 92 PSM KYPASTVQILGAE 1230 sp|O00567|NOP56_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7078 24.911 2 1375.7347 1375.7347 A K 320 333 PSM MKLNISFPATGCQ 1231 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 1-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=7317 25.326 2 1481.7007 1481.7007 - K 1 14 PSM MKLNISFPATGCQ 1232 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 12-UNIMOD:4 ms_run[2]:scan=8220 27.038 2 1465.7058 1465.7058 - K 1 14 PSM PVWGGGNKCGACG 1233 sp|Q16527|CSRP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 9-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=4898 20.839 2 1318.5547 1318.5547 M R 2 15 PSM RAILVDLEPGTMDSV 1234 sp|Q13509|TBB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8772 28.494 2 1614.8287 1614.8287 P R 62 77 PSM RAITIAGVPQSVTECV 1235 sp|Q15365|PCBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 15-UNIMOD:4 ms_run[2]:scan=8060 26.716 2 1699.8927 1699.8927 E K 144 160 PSM RAIVDALPPPCESACTVPTDVD 1236 sp|Q15181|IPYR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=7517 25.678 3 2382.1195 2382.1195 A K 260 282 PSM RALIVVPYAEGVIPDEA 1237 sp|Q05519-2|SRS11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9036 29.457 2 1810.9829 1810.9829 D K 103 120 PSM RALPPAQAGALLLALPPASPSAA 1238 sp|Q8WZA9|IRGQ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=9128 29.876 3 2152.2368 2152.2368 R R 448 471 PSM RDAATIMQPYFTSNGLVT 1239 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=8193 26.981 2 1999.9673 1999.9673 Q K 2417 2435 PSM RDAEDAMDAMDGAVLDG 1240 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=4971 21.01 2 1782.7036 1782.7036 K R 66 83 PSM RDAEDAMDAMDGAVLDG 1241 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 7-UNIMOD:35 ms_run[2]:scan=6842 24.525 2 1766.7087 1766.7087 K R 66 83 PSM RDASLMVTNDGATIL 1242 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 6-UNIMOD:35 ms_run[2]:scan=7562 25.756 2 1591.7876 1591.7876 G K 10 25 PSM RDQDGCLPEEVTGC 1243 sp|Q9BR61|ACBD6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 6-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=5944 23.084 2 1634.6665 1634.6665 L K 254 268 PSM RDYMDTLPPTVGDDVG 1244 sp|Q16630-3|CPSF6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 4-UNIMOD:35 ms_run[2]:scan=6529 24.012 2 1765.7829 1765.7829 D K 50 66 PSM REDDCEEPIEDMQLTS 1245 sp|Q9NR09|BIRC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 5-UNIMOD:4,12-UNIMOD:35 ms_run[2]:scan=5674 22.6 2 1981.7881 1981.7881 N K 870 886 PSM RETEVGDPAGNELAEPEA 1246 sp|Q96G46-2|DUS3L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5817 22.856 2 1882.8545 1882.8545 C K 55 73 PSM RETTDTDTADQVIASF 1247 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8549 27.863 2 1768.8115 1768.8115 S K 837 853 PSM REVAEAATGEDASSPPP 1248 sp|Q99536-3|VAT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=4361 19.089 2 1682.7748 1682.7748 E K 5 22 PSM RGTELDDGIQADSGPINDTDANP 1249 sp|P55210-4|CASP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6575 24.076 3 2370.0571 2370.0571 C R 162 185 PSM RLMDGEEPLPMLPSY 1250 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=8236 27.069 2 1778.8219 1778.8219 R K 878 893 PSM RLPNLSSPSAEGPPGPPSGPAP 1251 sp|O60784-3|TOM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6913 24.64 3 2081.0542 2081.0542 D R 411 433 PSM RPLPPAAIESPAVAAPAYS 1252 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=7077 24.91 2 1877.0047 1877.0047 V R 56 75 PSM RQLQPAPLEPLGSPDAGLGAAVG 1253 sp|O95219|SNX4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8445 27.586 3 2213.1804 2213.1804 E K 10 33 PSM RSESLDPDSSMDTTLIL 1254 sp|Q5SW79-2|CE170_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 11-UNIMOD:35 ms_run[2]:scan=8358 27.358 2 1894.883 1894.8830 E K 780 797 PSM RTDDYLDQPCLETVN 1255 sp|P31150|GDIA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:4 ms_run[2]:scan=7163 25.054 2 1837.8152 1837.8152 Y R 193 208 PSM RTDDYLDQPCYETIN 1256 sp|P50395-2|GDIB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:4 ms_run[2]:scan=6960 24.722 2 1901.8102 1901.8102 Y R 148 163 PSM RVTGAALIPPPGGTSLTSLGQAAQ 1257 sp|Q9BU61-2|NDUF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=8286 27.175 3 2262.2332 2262.2332 G - 104 128 PSM RVTLEGPSATAPASSPGLA 1258 sp|Q6P1N0-2|C2D1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=6269 23.595 2 1780.9319 1780.9319 P K 225 244 PSM RTLTIVDTGIGMT 1259 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 12-UNIMOD:35 ms_run[1]:scan=6856 24.548783498133332 2 1392.728235 1392.728266 D K 27 40 PSM RTLTIVDTGIGMT 1260 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 12-UNIMOD:35 ms_run[1]:scan=7119 24.975486657866668 2 1392.726933 1392.728266 D K 27 40 PSM RESTGAQVQVAGDMLPNSTE 1261 sp|Q15365|PCBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 14-UNIMOD:35 ms_run[1]:scan=5720 22.6853540392 2 2105.980947 2104.969512 I R 124 144 PSM KNDQDTWDYTNPNLSGQGDPGSNPN 1262 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=6775 24.415850813066665 3 2734.154902 2733.153895 F K 277 302 PSM KALQEGEGDLSISAD 1263 sp|P49589|SYCC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=5940 23.0770055952 2 1531.736487 1531.736582 Q R 295 310 PSM RSGPTDDGEEEMEEDTVTNGS 1264 sp|P09661|RU2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 12-UNIMOD:35 ms_run[1]:scan=4484 19.571314475199998 2 2270.884129 2269.876459 R - 235 256 PSM KQPLPSAPENNPEEELAS 1265 sp|O14965|AURKA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=6114 23.352307865333334 2 1948.927619 1948.937801 S K 99 117 PSM KEQVLEPMLNGTD 1266 sp|Q02880|TOP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=6929 24.662726423200002 2 1473.730357 1472.718095 Y K 957 970 PSM REAPATQASSTTQLTDTQVLAAEN 1267 sp|Q9UNF1|MAGD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=6420 23.831304701066664 3 2503.223030 2502.219789 A K 76 100 PSM KAISALVPQGGPVLC 1268 sp|Q13330|MTA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 15-UNIMOD:4 ms_run[1]:scan=7786 26.17665572 2 1508.836274 1508.838485 S R 267 282 PSM KLVDEDFPEDSSSQ 1269 sp|A6NDU8|CE051_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=6221 23.521181950133332 2 1594.699702 1594.699862 N K 81 95 PSM KSAEIDSDDTGGSAAQ 1270 sp|P33176|KINH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=3585 15.784187690133333 2 1550.670144 1550.669624 K K 813 829 PSM KILDQGEDFPASEMT 1271 sp|P30040|ERP29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=7189 25.10104620986667 2 1679.769237 1679.771253 G R 208 223 PSM KVVQNDAYTAPALPSSI 1272 sp|Q9BY77|PDIP3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=7623 25.869403637866665 2 1772.934678 1772.930865 T R 229 246 PSM KVDSEENTLNSQTNATSGMNPDGVLS 1273 sp|Q15398|DLGP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 19-UNIMOD:35 ms_run[1]:scan=5844 22.900767321066667 3 2725.226023 2723.219198 C K 263 289 PSM KAALSASEGEEVPQD 1274 sp|O95831-6|AIFM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4784 20.527 2 1529.7209 1529.7209 K K 25 40 PSM KADNFEYSDPVDGSIS 1275 sp|P36871|PGM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6840 24.522 2 1742.7635 1742.7635 E R 470 486 PSM KAIADTGANVVVTGG 1276 sp|P50990-3|TCPQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5294 21.812 2 1371.7358 1371.7358 V K 208 223 PSM KAIELFSVGQGPA 1277 sp|P30419-2|NMT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8144 26.867 2 1315.7136 1315.7136 Q K 14 27 PSM KAISEPNFSVAYANMC 1278 sp|Q04637-6|IF4G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 15-UNIMOD:35,16-UNIMOD:4 ms_run[2]:scan=7072 24.902 2 1816.8124 1816.8124 E R 608 624 PSM KALEEGLTPQEICD 1279 sp|P56192|SYMC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:4 ms_run[2]:scan=6435 23.855 2 1601.7607 1601.7607 T K 321 335 PSM KALELSGTAVPPDLE 1280 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7699 26.01 2 1538.8192 1538.8192 I K 736 751 PSM KALELSGTAVPPDLE 1281 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7718 26.048 2 1538.8192 1538.8192 I K 736 751 PSM KALSTDPAAPNL 1282 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5760 22.761 2 1196.6401 1196.6401 A K 1320 1332 PSM KAPTTCPVPPEQT 1283 sp|Q5VT25-3|MRCKA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:4 ms_run[2]:scan=4349 19.037 2 1424.697 1424.6970 N K 963 976 PSM KAQVPGPLTPEMEA 1284 sp|Q9H8Y5|ANKZ1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=5675 22.604 2 1482.7388 1482.7388 N R 599 613 PSM KASASAPAPASATEILLTPA 1285 sp|Q9NQX7-2|ITM2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8182 26.956 2 1866.0098 1866.0098 D R 20 40 PSM KASEVMGPVEAAPEY 1286 sp|Q8WWY3-2|PRP31_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6486 23.934 2 1576.7443 1576.7443 A R 76 91 PSM KASPVTSPAAAFPTASPAN 1287 sp|Q9UIF9-2|BAZ2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6289 23.632 2 1783.9105 1783.9105 P K 467 486 PSM KATQMPEGGQGAPPMYQLY 1288 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 5-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=6461 23.899 3 2097.95 2097.9500 G K 944 963 PSM KATSITVTGSGSC 1289 sp|Q14118|DAG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:4 ms_run[2]:scan=4311 18.893 2 1267.6078 1267.6078 F R 701 714 PSM KAVTDFTSEVTYDPAG 1290 sp|Q9UGM6|SYWM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7355 25.4 2 1699.7941 1699.7941 R R 253 269 PSM KAYVDDTPAEQM 1291 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=4313 18.9 2 1382.6024 1382.6024 G K 288 300 PSM KDAGTIAGLNVM 1292 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=6228 23.533 2 1204.6122 1204.6122 T R 185 197 PSM KDCEVVMMIGLPGAG 1293 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=7229 25.176 2 1607.7357 1607.7357 K K 476 491 PSM KDDPSAMDFVTSAANL 1294 sp|Q9UBT2-2|SAE2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 7-UNIMOD:35 ms_run[2]:scan=8204 27.006 2 1696.7614 1696.7614 D R 250 266 PSM KDETGELSSADE 1295 sp|Q92900-2|RENT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4202 18.454 2 1279.5416 1279.5416 L K 581 593 PSM KDILQSCQTSEECELA 1296 sp|Q9UNW1-4|MINP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 7-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=6367 23.75 2 1909.8397 1909.8397 Y R 262 278 PSM KDINTFLGTPVQ 1297 sp|P46013-2|KI67_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7683 25.982 2 1331.7085 1331.7085 E K 1433 1445 PSM KDIVVQETMEDID 1298 sp|O43852-10|CALU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 9-UNIMOD:35 ms_run[2]:scan=5799 22.827 2 1549.7182 1549.7182 M K 189 202 PSM KDLAFVDPDDCTPL 1299 sp|Q9H8M5-3|CNNM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 11-UNIMOD:4 ms_run[2]:scan=8380 27.407 2 1604.7392 1604.7392 V K 498 512 PSM KDLAPYLPSVTPGL 1300 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8871 28.831 2 1469.813 1469.8130 Q K 1649 1663 PSM KDMEPEMVCIDSCG 1301 sp|Q9NQT5|EXOS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=5182 21.516 2 1701.6354 1701.6354 N R 172 186 PSM KDMYLIPLGATD 1302 sp|Q92576-2|PHF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8664 28.164 2 1335.6744 1335.6744 V K 1221 1233 PSM KDNLPLQENVTIQ 1303 sp|Q99661-2|KIF2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6914 24.641 2 1510.7991 1510.7991 P K 23 36 PSM KDPAEGDGAQPEETP 1304 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4093 18.051 2 1539.6689 1539.6689 S R 191 206 PSM KDPSLSDSSTVGLQ 1305 sp|O43663|PRC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5601 22.469 2 1432.7046 1432.7046 A R 584 598 PSM KDSGPLSDPITG 1306 sp|Q7L2E3-2|DHX30_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6075 23.294 2 1185.5877 1185.5877 G K 416 428 PSM KDTLQTVSSSPVTEIS 1307 sp|Q5T3J3|LRIF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6621 24.156 2 1690.8625 1690.8625 R R 393 409 PSM KEDLPGFVFESN 1308 sp|Q9ULT8|HECD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8600 28.012 2 1380.6561 1380.6561 L R 782 794 PSM KEDNGIGILTLNNPS 1309 sp|Q9NTX5-5|ECHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8134 26.848 2 1583.8155 1583.8155 Q R 53 68 PSM KEDTSEQVVPVLV 1310 sp|P33527-8|MRP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7969 26.542 2 1441.7664 1441.7664 N K 246 259 PSM KEELCPGNLSLVDT 1311 sp|Q6PCB5-2|RSBNL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 5-UNIMOD:4 ms_run[2]:scan=7722 26.055 2 1573.7658 1573.7658 L R 544 558 PSM KEETLVIPSTGI 1312 sp|Q96GA3|LTV1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7905 26.412 2 1285.7129 1285.7129 E K 96 108 PSM KEGEEAGPGDPLLEAVP 1313 sp|Q16543|CDC37_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8490 27.709 2 1706.8363 1706.8363 A K 352 369 PSM KEGIPALDNFLD 1314 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8662 28.156 2 1330.6769 1330.6769 L K 845 857 PSM KEIEIGVPNAQD 1315 sp|Q8NB90-3|AFG2H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6043 23.241 2 1311.667 1311.6670 D R 517 529 PSM KEIPSATQSPIS 1316 sp|Q9BQG0|MBB1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4962 20.99 2 1256.6612 1256.6612 A K 1155 1167 PSM KEISDGDVIISGN 1317 sp|P00533-4|EGFR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5696 22.641 2 1345.6725 1345.6725 L K 454 467 PSM KELAAEDEQVFLM 1318 sp|O43237-2|DC1L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:35 ms_run[2]:scan=7456 25.561 2 1537.7334 1537.7334 D K 275 288 PSM KELSTTLNADEAVT 1319 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5734 22.71 2 1490.7464 1490.7464 G R 360 374 PSM KEPQPEQPQPSTSAN 1320 sp|Q9GZR7-2|DDX24_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=3714 16.419 2 1636.7693 1636.7693 P - 790 805 PSM KEQEFPVEPVGE 1321 sp|O75116|ROCK2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6383 23.774 2 1386.6667 1386.6667 K K 1240 1252 PSM KEVPLAQTAQPTSAIV 1322 sp|P15336-3|ATF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6625 24.162 2 1651.9145 1651.9145 E R 149 165 PSM KEVPTADPTGVD 1323 sp|Q96KN1|LRAT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4455 19.459 2 1227.5983 1227.5983 Y R 14 26 PSM KEVQSPEGMISL 1324 sp|Q9H6R4-2|NOL6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 9-UNIMOD:35 ms_run[2]:scan=6522 24.001 2 1332.6595 1332.6595 L R 807 819 PSM KFGDPVVQSDM 1325 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 11-UNIMOD:35 ms_run[2]:scan=5241 21.666 2 1237.5649 1237.5649 R K 77 88 PSM KFMETTDPSTASSLQA 1326 sp|Q03001-8|DYST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:35 ms_run[2]:scan=5377 21.981 2 1728.7876 1728.7876 K K 1811 1827 PSM KGAEEMETVIPVDVM 1327 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:35 ms_run[2]:scan=8266 27.135 2 1662.7845 1662.7845 A R 12 27 PSM KGIINDDEDDEDLMMASG 1328 sp|O75717|WDHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 15-UNIMOD:35 ms_run[2]:scan=6980 24.757 2 1982.8085 1982.8085 S R 351 369 PSM KGIVVTAYSPLGSPD 1329 sp|P15121|ALDR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7649 25.913 2 1502.7981 1502.7981 S R 203 218 PSM KGTTATSAQANSTPTSVASVVTSAESPAS 1330 sp|Q86YP4-2|P66A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7054 24.878 3 2707.3148 2707.3148 L R 315 344 PSM KGVLLYGPPGTG 1331 sp|P62195-2|PRS8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6496 23.949 2 1157.6445 1157.6445 P K 176 188 PSM KGVQVPVSPGTIPQPVA 1332 sp|Q6IE81-3|JADE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7314 25.322 2 1672.9512 1672.9512 E R 82 99 PSM KGVVDSDDLPLNVS 1333 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7383 25.442 2 1456.7409 1456.7409 V R 434 448 PSM KIEPSTVVPAQTPWD 1334 sp|Q5JRX3-3|PREP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7724 26.058 2 1666.8566 1666.8566 Q K 258 273 PSM KIETTVPPSGLNLN 1335 sp|P26358|DNMT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6539 24.026 2 1481.809 1481.8090 N R 530 544 PSM KITQQGTDPLVLAVQS 1336 sp|Q8N556|AFAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7881 26.368 2 1696.9359 1696.9359 L K 218 234 PSM KIVSLPECFNSPYGA 1337 sp|Q9NQR4|NIT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 8-UNIMOD:4 ms_run[2]:scan=8269 27.139 2 1680.8181 1680.8181 A K 37 52 PSM KLDPFESSDPFSSSSVSS 1338 sp|Q9UBC2-3|EP15R_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8436 27.561 2 1901.8531 1901.8531 S K 701 719 PSM KLDPGSEETQTLV 1339 sp|P26641|EF1G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6030 23.223 2 1415.7144 1415.7144 R R 401 414 PSM KLDQPVSAPPSP 1340 sp|Q16204|CCDC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5060 21.235 2 1234.6558 1234.6558 E R 234 246 PSM KLEENLPILQQPTE 1341 sp|O60664-4|PLIN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7995 26.589 2 1650.8829 1650.8829 D K 102 116 PSM KLFPDTPLALDAN 1342 sp|Q12906-5|ILF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8747 28.404 2 1413.7504 1413.7504 E K 587 600 PSM KLITVPLEIDED 1343 sp|Q13099-3|IFT88_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8575 27.933 2 1383.7497 1383.7497 Q K 320 332 PSM KLLMMAGIDDCYTSA 1344 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 4-UNIMOD:35,5-UNIMOD:35,11-UNIMOD:4 ms_run[2]:scan=6394 23.79 2 1719.7518 1719.7518 K R 212 227 PSM KLPGELEPVQATQN 1345 sp|O75821|EIF3G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6037 23.232 2 1522.7991 1522.7991 E K 195 209 PSM KLQAAVDGPMD 1346 sp|P51572|BAP31_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:35 ms_run[2]:scan=4292 18.825 2 1159.5543 1159.5543 A K 232 243 PSM KLQAAVDGPMD 1347 sp|P51572|BAP31_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:35 ms_run[2]:scan=4396 19.235 2 1159.5543 1159.5543 A K 232 243 PSM KLQPQITMIPPSAQPP 1348 sp|P78344-2|IF4G2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 8-UNIMOD:35 ms_run[2]:scan=6511 23.983 2 1760.9495 1760.9495 P R 451 467 PSM KLVQAPLDADGDNVLQE 1349 sp|Q02241-3|KIF23_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7442 25.538 2 1823.9265 1823.9265 I K 125 142 PSM KLYTLVLTDPDAPS 1350 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8278 27.159 2 1531.8134 1531.8134 G R 62 76 PSM KMADEAVCVGPAPTS 1351 sp|P05165-3|PCCA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 2-UNIMOD:35,8-UNIMOD:4 ms_run[2]:scan=4917 20.891 2 1547.696 1547.6960 V K 104 119 PSM KMLVLDEADEMLN 1352 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 2-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=6516 23.993 2 1551.716 1551.7160 I K 182 195 PSM KMVVPGLDGAQIP 1353 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 2-UNIMOD:35 ms_run[2]:scan=7680 25.977 2 1339.717 1339.7170 L R 1158 1171 PSM KPCAGTTYLESPLSSETTQLS 1354 sp|Q9Y2R5|RT17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:4 ms_run[2]:scan=7834 26.274 3 2269.0784 2269.0784 G K 98 119 PSM KPEDFLVPELQATEEE 1355 sp|Q9P2I0|CPSF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8884 28.875 2 1872.8993 1872.8993 I K 481 497 PSM KPEDTTIPSTELA 1356 sp|P48556|PSMD8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5865 22.93 2 1400.7035 1400.7035 Q K 324 337 PSM KPEDVLDDDDAGSAPL 1357 sp|P35613-3|BASI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7120 24.978 2 1655.7526 1655.7526 R K 141 157 PSM KPEPPAMPQPVPTA 1358 sp|P23396|RS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 7-UNIMOD:35 ms_run[2]:scan=4816 20.608 2 1474.749 1474.7490 G - 230 244 PSM KPGDDIVLMAEALE 1359 sp|O60885|BRD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 9-UNIMOD:35 ms_run[2]:scan=8509 27.76 2 1515.7491 1515.7491 N K 141 155 PSM KPLEEEEMEVPVLP 1360 sp|P49790-2|NU153_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 8-UNIMOD:35 ms_run[2]:scan=7782 26.168 2 1653.8171 1653.8171 S K 460 474 PSM KPLEEEEMEVPVLP 1361 sp|P49790-2|NU153_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 8-UNIMOD:35 ms_run[2]:scan=7806 26.219 2 1653.8171 1653.8171 S K 460 474 PSM KPLSVSYDQATSL 1362 sp|P00918|CAH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6633 24.172 2 1407.7246 1407.7246 L R 45 58 PSM KPLVEMDETPQVE 1363 sp|Q9NVM9-2|INT13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:35 ms_run[2]:scan=5335 21.894 2 1529.7283 1529.7283 K K 532 545 PSM KPLVLCGPPGSG 1364 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:4 ms_run[2]:scan=5892 22.982 2 1180.6274 1180.6274 H K 2589 2601 PSM KPMCVESFSDYPPLG 1365 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:35,4-UNIMOD:4 ms_run[2]:scan=7608 25.842 2 1741.7691 1741.7691 G R 408 423 PSM KPMCVESFSDYPPLG 1366 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 4-UNIMOD:4 ms_run[2]:scan=8272 27.148 2 1725.7742 1725.7742 G R 408 423 PSM KPMDTSVLSEEGGEPFQ 1367 sp|Q12888|TP53B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7543 25.72 2 1849.8404 1849.8404 D K 390 407 PSM KPNYIVPDYMPVVYD 1368 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:35 ms_run[2]:scan=8113 26.808 2 1827.8753 1827.8753 E K 3117 3132 PSM KPTLMAAVPEIMD 1369 sp|O60488-2|ACSL4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 5-UNIMOD:35 ms_run[2]:scan=7703 26.018 2 1430.7149 1430.7149 L R 326 339 PSM KPTPIQTQAIPAIMSG 1370 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7901 26.405 2 1651.8967 1651.8967 E R 394 410 PSM KPVETIGFDSIM 1371 sp|Q15813|TBCE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=7526 25.689 2 1351.6694 1351.6694 N K 109 121 PSM KPVIGTWDCDTCLVQN 1372 sp|P49790-2|NU153_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 9-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=7794 26.194 2 1904.8761 1904.8761 F K 678 694 PSM KPVSPLLLASGMA 1373 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=7738 26.083 2 1298.7268 1298.7268 D R 196 209 PSM KPVSPLLTAAGMA 1374 sp|P12532|KCRU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=6749 24.364 2 1270.6955 1270.6955 D R 229 242 PSM KPVVYDVCDDQEIQ 1375 sp|Q8WXH0|SYNE2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 8-UNIMOD:4 ms_run[2]:scan=6189 23.469 2 1706.7822 1706.7822 S K 6047 6061 PSM KQDLPNAMNAAEITD 1376 sp|P61204-2|ARF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6647 24.192 2 1629.7668 1629.7668 N K 90 105 PSM KQPAIISQLDPVNE 1377 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7878 26.36 2 1550.8304 1550.8304 T R 1116 1130 PSM KQQVTILATPLPEESM 1378 sp|Q12846-2|STX4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8453 27.606 2 1783.939 1783.9390 E K 62 78 PSM KQTVIQDPMPMEPQGQ 1379 sp|Q92538-3|GBF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 9-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4876 20.775 2 1857.8601 1857.8601 F K 1714 1730 PSM KQVVEEPSPQLPAD 1380 sp|P52564-2|MP2K6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5645 22.552 2 1535.7831 1535.7831 L K 212 226 PSM KSDAPTGDVLLDEAL 1381 sp|Q9H4A6|GOLP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8700 28.269 2 1542.7777 1542.7777 C K 123 138 PSM KSDIGEVILVGGMT 1382 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8616 28.052 2 1417.7487 1417.7487 S R 377 391 PSM KSDPTLGLLEDPAE 1383 sp|Q9Y6B7|AP4B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8106 26.798 2 1483.7406 1483.7406 P R 537 551 PSM KSEISSTVPQGGME 1384 sp|Q2NL82|TSR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:35 ms_run[2]:scan=4453 19.455 2 1464.6766 1464.6766 L - 791 805 PSM KSPDTNYLFMGDYVD 1385 sp|P67775-2|PP2AA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:35 ms_run[2]:scan=8162 26.906 2 1779.7662 1779.7662 G R 74 89 PSM KSPEADPVEPACGVS 1386 sp|Q8TC76|F110B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:4 ms_run[2]:scan=4825 20.635 2 1541.7032 1541.7032 M R 237 252 PSM KSPFTVGVAAPLDLS 1387 sp|O75369-5|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8803 28.594 2 1500.8188 1500.8188 P K 931 946 PSM KSQLLAPPPPSAPPGN 1388 sp|P49750-3|YLPM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5877 22.955 2 1569.8515 1569.8515 S K 241 257 PSM KSSGPTSLFAVTVAPPGA 1389 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8761 28.452 2 1685.8988 1685.8988 G R 186 204 PSM KTALLPSDSVFAEE 1390 sp|Q14966-5|ZN638_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8068 26.731 2 1505.7613 1505.7613 P R 317 331 PSM KTAVDGPDLEMLTGQE 1391 sp|Q14318|FKBP8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8384 27.416 2 1702.8084 1702.8084 L R 201 217 PSM KTEEMPNDSVLEN 1392 sp|P49321-4|NASP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5540 22.339 2 1504.6715 1504.6715 D K 425 438 PSM KTEMVTISDASQ 1393 sp|O43491-3|E41L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 4-UNIMOD:35 ms_run[2]:scan=4521 19.702 2 1324.618 1324.6180 V R 616 628 PSM KTFDECVAEGGSDCAPE 1394 sp|Q7LGA3-3|HS2ST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=5376 21.979 2 1870.7349 1870.7349 K K 196 213 PSM KTFEISEPVITPSQ 1395 sp|Q9NXX6|NSE4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7443 25.539 2 1574.8192 1574.8192 V R 365 379 PSM KTIIPLISQCTP 1396 sp|P40926-2|MDHM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:4 ms_run[2]:scan=8224 27.046 2 1369.7639 1369.7639 G K 161 173 PSM KTILPAAAQDVYY 1397 sp|P04843|RPN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7793 26.192 2 1451.766 1451.7660 F R 281 294 PSM KTLTDEVNSPDSD 1398 sp|Q8TAQ2-2|SMRC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4777 20.511 2 1419.6365 1419.6365 A R 275 288 PSM KTMQFEPSTMVYDAC 1399 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 15-UNIMOD:4 ms_run[2]:scan=7850 26.307 2 1806.7627 1806.7627 V R 15 30 PSM KTPADCPVIAIDSF 1400 sp|Q9BS26|ERP44_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:4 ms_run[2]:scan=8703 28.279 2 1532.7545 1532.7545 Q R 313 327 PSM KTVTNAVVTVPAYFNDSQ 1401 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7868 26.342 2 1952.9844 1952.9844 G R 137 155 PSM KTVTNAVVTVPAYFNDSQ 1402 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=9772 32.145 2 1952.9844 1952.9844 G R 137 155 PSM KVAALTGLPFVTAPN 1403 sp|P07954-2|FUMH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8907 28.961 2 1497.8555 1497.8555 A K 253 268 PSM KVAEVEGEQVDN 1404 sp|O95202|LETM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4198 18.44 2 1315.6256 1315.6256 V K 451 463 PSM KVEEAEPEEFVVE 1405 sp|Q13185|CBX3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7075 24.906 2 1532.7246 1532.7246 K K 21 34 PSM KVLEITELPDGIT 1406 sp|Q15032-2|R3HD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8554 27.874 2 1426.7919 1426.7919 G R 857 870 PSM KVLGMDPLPQMSQ 1407 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 5-UNIMOD:35 ms_run[2]:scan=6803 24.461 2 1458.7211 1458.7211 H R 1028 1041 PSM KVPASPLPGLE 1408 sp|Q7KZI7-10|MARK2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7098 24.944 2 1106.6336 1106.6336 A R 419 430 PSM KVSFTGSVPTGM 1409 sp|P49189-2|AL9A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 12-UNIMOD:35 ms_run[2]:scan=5658 22.573 2 1225.6013 1225.6013 A K 157 169 PSM KVVSQYSSLLSPMSVNAVM 1410 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=7792 26.192 3 2071.033 2071.0330 S K 174 193 PSM KYDDYPENGVVQMNS 1411 sp|Q96T88|UHRF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:35 ms_run[2]:scan=5302 21.828 2 1773.7516 1773.7516 V R 187 202 PSM KYGVNPGPIVGTT 1412 sp|P42167-3|LAP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5900 22.996 2 1301.698 1301.6980 V R 126 139 PSM KYLLGDAPVSPSSQ 1413 sp|Q9NYB0|TE2IP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6446 23.874 2 1460.7511 1460.7511 H K 194 208 PSM PGSAAKGSELSE 1414 sp|P49770|EI2BB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=3805 16.859 2 1131.5408 1131.5408 M R 2 14 PSM PSKGPLQSVQVFG 1415 sp|P62249|RS16_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7702 26.015 2 1342.7245 1342.7245 M R 2 15 PSM RDAEDAMDAMDGAVLDG 1416 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:35 ms_run[2]:scan=6313 23.667 2 1766.7087 1766.7087 K R 66 83 PSM RDAEDAMDAMDGAVLDG 1417 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8387 27.422 2 1750.7138 1750.7138 K R 66 83 PSM RDLGEGEEGELAPPEDLLG 1418 sp|Q8NC44|RETR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8668 28.18 2 1994.9433 1994.9433 S R 355 374 PSM RDPAEALQLPMDYVQ 1419 sp|Q9Y285-2|SYFA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8918 29.001 2 1744.8454 1744.8454 L R 249 264 PSM RDPIVMGVTVEAGQV 1420 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:35 ms_run[2]:scan=7027 24.831 2 1585.8134 1585.8134 S K 1105 1120 PSM RDPSQIDNNEPYM 1421 sp|Q13347|EIF3I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 13-UNIMOD:35 ms_run[2]:scan=4776 20.509 2 1593.6729 1593.6729 L K 128 141 PSM REEPAPEEEEPLLLQ 1422 sp|Q9BVJ6-2|UT14A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7859 26.326 2 1777.8734 1777.8734 Q R 321 336 PSM REGDPGPAQVPQPAV 1423 sp|Q9BY89|K1671_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5686 22.623 2 1516.7634 1516.7634 A R 918 933 PSM RELDALDANDELTPLG 1424 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8381 27.41 2 1740.853 1740.8530 L R 837 853 PSM RGAAAAATGQPGTAPAGTPGAPPLAGMAIV 1425 sp|Q13263|TIF1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 27-UNIMOD:35 ms_run[2]:scan=7392 25.459 3 2615.349 2615.3490 E K 524 554 PSM RGDQESPDACLPPTVPEAPAPPQ 1426 sp|Q14676-3|MDC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:4 ms_run[2]:scan=6743 24.355 3 2428.1329 2428.1329 S K 1028 1051 PSM RIEDVTPIPSDST 1427 sp|P62263|RS14_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5843 22.898 2 1428.7096 1428.7096 G R 128 141 PSM RIEEVPELPLVVED 1428 sp|P36578|RL4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=9001 29.312 2 1635.872 1635.8720 H K 143 157 PSM RMGGEAPELALDPVPQDAST 1429 sp|Q07812-5|BAX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 2-UNIMOD:35 ms_run[2]:scan=7556 25.747 3 2068.9735 2068.9735 G K 37 57 PSM RPGLDAEPELSPEEQ 1430 sp|Q9BRJ6|CG050_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6048 23.248 2 1665.7846 1665.7846 L R 49 64 PSM RTLTTMAPYLSTEDVPLA 1431 sp|Q8TEX9|IPO4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 6-UNIMOD:35 ms_run[2]:scan=8309 27.246 2 1994.003 1994.0030 L R 182 200 PSM RTTTPNMNPAINYQPQSSSSVPCQ 1432 sp|Q8WXI9|P66B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 7-UNIMOD:35,23-UNIMOD:4 ms_run[2]:scan=5566 22.39 3 2693.2174 2693.2174 V R 286 310 PSM RTVITPDPNLSIDQVGVP 1433 sp|P24928-2|RPB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=8533 27.821 2 1920.0316 1920.0316 A R 364 382 PSM RVLVTQQFPCQNPLPVNSGQAQ 1434 sp|O14965|AURKA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:4 ms_run[2]:scan=7464 25.578 3 2480.2594 2480.2594 K R 24 46 PSM RVLVTQQFPCQNPLPVNSGQAQ 1435 sp|O14965|AURKA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 10-UNIMOD:4 ms_run[2]:scan=7480 25.611 3 2480.2594 2480.2594 K R 24 46 PSM RYDGQVAVFGSDLQE 1436 sp|P22314-2|UBA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=7906 26.414 2 1682.79 1682.7900 N K 410 425 PSM KAVAEQIPLLVQGV 1437 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=8914 28.9863206608 2 1463.873059 1463.871165 C R 957 971 PSM KPVTTPEEIAQVATISANGD 1438 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=8390 27.42784330186667 2 2041.025153 2040.037515 S K 160 180 PSM KPIAEAPSAFTLGSEM 1439 sp|P49792|RBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=8419 27.512793169066665 2 1649.820655 1647.817809 H K 1812 1828 PSM KDATNVGDEGGFAPNILEN 1440 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=9620 31.609221528 2 1961.922677 1959.917400 G K 202 221 PSM KTCLPGFPGAPCAI 1441 sp|P51610|HCFC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 3-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=8470 27.652191873333333 2 1487.739164 1487.726492 F K 1884 1898 PSM KMGLVDQLVEPLGPGL 1442 sp|P40939|ECHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 2-UNIMOD:35 ms_run[1]:scan=9085 29.66906368293333 2 1680.910959 1680.912044 K K 214 230 PSM KGVNLPGAAVDLPAVSE 1443 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=9216 30.2917324448 2 1636.885260 1635.883186 K K 207 224 PSM KTAENATSGETLEENEAGD 1444 sp|Q9UQ80|PA2G4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=4709 20.319146873866668 2 1965.829476 1964.844688 S - 376 395 PSM KVEDVSAVEIVGGAT 1445 sp|Q92598|HS105_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=7101 24.949095173866667 2 1472.771549 1472.772239 L R 331 346 PSM KAVASLPPEQMFELM 1446 sp|P33240|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 11-UNIMOD:35 ms_run[1]:scan=8563 27.8952005752 2 1706.841089 1705.841916 S K 130 145 PSM KLPQPPEGQTYNN 1447 sp|Q15819|UB2V2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=5070 21.263890780266667 2 1485.730498 1484.725957 M - 133 146 PSM KTIVTDVFQGSM 1448 sp|Q53GS9|SNUT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 12-UNIMOD:35 ms_run[1]:scan=7351 25.394719465866668 2 1341.666487 1340.664603 K R 342 354 PSM KLLASANLEEVTM 1449 sp|P35659|DEK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 13-UNIMOD:35 ms_run[1]:scan=6988 24.769731981066666 2 1433.739221 1433.743582 K K 331 344 PSM KIIAEGANGPTTPEAD 1450 sp|P00367|DHE3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=5010 21.115158288 2 1583.768387 1582.783866 A K 399 415 PSM KLPGGELNPGEDEVEGL 1451 sp|O43809|CPSF5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=7730 26.0710022472 2 1751.859612 1751.857760 F K 105 122 PSM KQLEVLVSPTCSC 1452 sp|Q9NTI5|PDS5B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 11-UNIMOD:4,13-UNIMOD:4 ms_run[1]:scan=6525 24.00597854053333 2 1519.728316 1519.737451 R K 561 574 PSM KILDQGEDFPASEMT 1453 sp|P30040|ERP29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=7400 25.470781286666668 2 1679.769237 1679.771253 G R 208 223 PSM KTPAPPAGPGGTL 1454 sp|Q9NX70|MED29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=5313 21.853184562133332 2 1162.634616 1162.634623 G - 188 201 PSM KEPIEEEPTGAGLN 1455 sp|Q6IQ49|SDE2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=5220 21.6066279488 2 1482.719984 1482.720203 S K 327 341 PSM KVVDLLAQDADIVC 1456 sp|P30520|PURA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 14-UNIMOD:4 ms_run[1]:scan=8604 28.0219915184 2 1557.815648 1557.807244 G R 45 59 PSM KPDVMYADIGGMDIQ 1457 sp|P43686|PRS6B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 5-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=6325 23.681687253333333 2 1683.743313 1683.748409 Q K 159 174 PSM KAQAAAPASVPAQAP 1458 sp|P47914|RL29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=4664 20.195139586133333 2 1376.738983 1376.741213 T K 134 149 PSM KDTDVEEGSEVEDE 1459 sp|Q9H2J7|S6A15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=4303 18.8661088184 2 1580.658075 1579.637321 E R 47 61 PSM KLAQMEEAPLFPGESI 1460 sp|Q13613|MTMR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 5-UNIMOD:35 ms_run[1]:scan=8374 27.39666863893333 2 1774.890878 1774.881138 N K 91 107 PSM KAMSTLVPQGGPVLC 1461 sp|O94776|MTA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 3-UNIMOD:35,15-UNIMOD:4 ms_run[1]:scan=6712 24.302478608 2 1572.799165 1572.800385 A R 247 262 PSM KEQGVTFPAIGSQAAEQA 1462 sp|Q92783|STAM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 30 ms_run[1]:scan=7407 25.484458784266668 2 1830.913899 1830.911192 L K 136 154 PSM KAAAPAPVSEAVC 1463 sp|P20810-4|ICAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 13-UNIMOD:4 ms_run[2]:scan=4796 20.561 2 1269.6387 1269.6387 S R 355 368 PSM KAAAVLPVLDLAQ 1464 sp|P19404|NDUV2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8969 29.184 2 1307.7813 1307.7813 H R 75 88 PSM KAAGSGELGVTM 1465 sp|O75369-5|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=4413 19.293 2 1135.5543 1135.5543 T K 480 492 PSM KAALDGTPGMIGYGMA 1466 sp|P09417-2|DHPR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=5997 23.167 2 1583.7324 1583.7324 A K 107 123 PSM KAALDGTPGMIGYGMA 1467 sp|P09417-2|DHPR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 15-UNIMOD:35 ms_run[2]:scan=6881 24.586 2 1567.7374 1567.7375 A K 107 123 PSM KAALQTAPESADDSPSQLS 1468 sp|O43524-2|FOXO3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5247 21.689 2 1914.9171 1914.9171 K K 51 70 PSM KAAVAVVPLVSED 1469 sp|O75152|ZC11A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7179 25.082 2 1296.7289 1296.7289 K K 699 712 PSM KAEIGIAMGSGTAVA 1470 sp|P16615-5|AT2A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 8-UNIMOD:35 ms_run[2]:scan=5443 22.127 2 1390.7126 1390.7126 K K 712 727 PSM KAEPPQAMNALM 1471 sp|Q12906-5|ILF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=5460 22.164 2 1315.6264 1315.6264 E R 396 408 PSM KAFDSGIIPMEFVN 1472 sp|P53396-2|ACLY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=8641 28.101 2 1582.7701 1582.7701 S K 938 952 PSM KAGAYDFPSPEWDTVTPEA 1473 sp|Q13554-7|KCC2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8745 28.401 2 2079.9426 2079.9426 I K 227 246 PSM KALDIAENEMPGLM 1474 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 14-UNIMOD:35 ms_run[2]:scan=7757 26.115 2 1546.7371 1546.7371 R R 20 34 PSM KALELSGTAVPPDLE 1475 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8151 26.879 2 1538.8192 1538.8192 I K 736 751 PSM KALGLDTGQQQDAQEFS 1476 sp|Q86UV5-4|UBP48_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6224 23.524 2 1834.8697 1834.8697 V K 170 187 PSM KAPGGPMLLPQTYGA 1477 sp|Q15020-4|SART3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=6991 24.774 2 1515.7755 1515.7756 R R 855 870 PSM KAQEACGPLEMDSALSVVQNLE 1478 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 6-UNIMOD:4,11-UNIMOD:35 ms_run[2]:scan=8986 29.251 3 2404.125 2404.1250 Q K 1040 1062 PSM KAQFAQPEILIGTIPGAGGTQ 1479 sp|P30084|ECHM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8882 28.869 3 2096.1266 2096.1266 E R 157 178 PSM KAVYMMPTEGDDSS 1480 sp|Q93009-3|UBP7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 5-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=4138 18.231 2 1561.6276 1561.6276 R K 224 238 PSM KAVYMMPTEGDDSS 1481 sp|Q93009-3|UBP7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 5-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=4165 18.343 2 1561.6276 1561.6276 R K 224 238 PSM KCLQEGAEISSPAVE 1482 sp|Q9BQ52-3|RNZ2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:4 ms_run[2]:scan=5466 22.175 2 1616.7716 1616.7716 A R 236 251 PSM KCVLPEEDSGELA 1483 sp|Q9Y3F4|STRAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:4 ms_run[2]:scan=6080 23.302 2 1445.6708 1445.6708 W K 304 317 PSM KCVVTGEDGSESEATVNV 1484 sp|P13591-6|NCAM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:4 ms_run[2]:scan=5478 22.197 2 1879.8469 1879.8469 Y K 95 113 PSM KDAQVPIILAVN 1485 sp|P46199|IF2M_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8253 27.108 2 1279.75 1279.7500 A K 277 289 PSM KDCEECIQLEPTFI 1486 sp|P31948-3|STIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 3-UNIMOD:4,6-UNIMOD:4 ms_run[2]:scan=8858 28.782 2 1780.8012 1780.8012 L K 391 405 PSM KDCEVVMMIGLPGAG 1487 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 3-UNIMOD:4,8-UNIMOD:35 ms_run[2]:scan=8378 27.403 2 1591.7408 1591.7408 K K 476 491 PSM KDDSGATTMNIGSD 1488 sp|Q96MW1|CCD43_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 9-UNIMOD:35 ms_run[2]:scan=3793 16.792 2 1426.5882 1426.5882 E K 148 162 PSM KDIELVMSQANVS 1489 sp|E9PAV3|NACAM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=5547 22.351 2 1448.7181 1448.7181 V R 2042 2055 PSM KDIQYPFLGPVPT 1490 sp|Q14CX7-2|NAA25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8861 28.795 2 1473.7868 1473.7868 E R 747 760 PSM KDNTTLLTQVQTTM 1491 sp|Q13561|DCTN2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8012 26.617 2 1592.808 1592.8080 L R 365 379 PSM KDPASGICTLLYDSAPSG 1492 sp|P46020-3|KPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 8-UNIMOD:4 ms_run[2]:scan=8819 28.636 2 1850.872 1850.8720 A R 1106 1124 PSM KDPGMGAMGGMGGGMGGGMF 1493 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=7263 25.233 2 1833.6977 1833.6977 E - 554 574 PSM KDSLPSSDTLDLNAEE 1494 sp|Q7RTP6-2|MICA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6906 24.628 2 1732.8003 1732.8003 F K 624 640 PSM KDTGEIYTTSVTLD 1495 sp|Q14126|DSG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6823 24.497 2 1541.7461 1541.7461 N R 215 229 PSM KDVEMEPVQQAE 1496 sp|Q13464|ROCK1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 5-UNIMOD:35 ms_run[2]:scan=4059 17.91 2 1417.6395 1417.6395 R K 1208 1220 PSM KDVEMEPVQQAE 1497 sp|Q13464|ROCK1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4923 20.903 2 1401.6446 1401.6446 R K 1208 1220 PSM KDVSGVLFQYPDTEG 1498 sp|P23378|GCSP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8198 26.994 2 1653.7886 1653.7886 G K 257 272 PSM KEAELLEPLMPAI 1499 sp|P53618|COPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=8671 28.189 2 1468.7847 1468.7847 L R 128 141 PSM KEDVSTLIGDDLASC 1500 sp|Q9BV44|THUM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 15-UNIMOD:4 ms_run[2]:scan=8314 27.255 2 1621.7505 1621.7505 I K 194 209 PSM KEEIFGPVQPLF 1501 sp|P30837|AL1B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=9214 30.281 2 1402.7497 1402.7497 A K 414 426 PSM KEFAGEDTSDLFLEE 1502 sp|O14980|XPO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8485 27.697 2 1728.773 1728.7730 I R 1023 1038 PSM KEGAFSNFPISEETI 1503 sp|Q9NR30-2|DDX21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8753 28.422 2 1667.8043 1667.8043 Q K 116 131 PSM KEGIESGDPGTDDG 1504 sp|Q12797-10|ASPH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=3938 17.449 2 1375.5739 1375.5739 L R 483 497 PSM KEIAEAYDVLSDP 1505 sp|P25685|DNJB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7687 25.988 2 1448.7035 1448.7035 F R 46 59 PSM KEIMAEDDQVFLM 1506 sp|Q9Y6G9|DC1L1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 13-UNIMOD:35 ms_run[2]:scan=7788 26.184 2 1583.7211 1583.7211 E K 365 378 PSM KEIQSSNLETAMSVIGD 1507 sp|Q9NX55|HYPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=6609 24.129 2 1836.8775 1836.8775 E R 53 70 PSM KEITALAPSTM 1508 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=5293 21.81 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 1509 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=8842 28.718 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 1510 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=8961 29.15 2 1176.606 1176.6060 Q K 315 326 PSM KEIYPYVIQEL 1511 sp|P20674|COX5A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8903 28.948 2 1393.7493 1393.7493 H R 120 131 PSM KELALPGELTQS 1512 sp|O75436-2|VP26A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7047 24.867 2 1284.6925 1284.6925 V R 93 105 PSM KELGSLPLPLSTSEQ 1513 sp|Q86Y82|STX12_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8256 27.113 2 1597.8563 1597.8563 L R 82 97 PSM KELLSPLSEPDD 1514 sp|Q9UHB7-2|AFF4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6978 24.755 2 1341.6664 1341.6664 E R 699 711 PSM KELLSPLSEPDD 1515 sp|Q9UHB7-2|AFF4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6990 24.772 2 1341.6664 1341.6664 E R 699 711 PSM KELMDEEDVLQEC 1516 sp|Q5H9R7-3|PP6R3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 13-UNIMOD:4 ms_run[2]:scan=7196 25.117 2 1636.696 1636.6960 L K 25 38 PSM KEPLYVGVDDD 1517 sp|Q9NVP1|DDX18_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6098 23.33 2 1248.5874 1248.5874 K K 381 392 PSM KEPVETAVDNNS 1518 sp|Q6FI81-3|CPIN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4229 18.563 2 1301.6099 1301.6099 L K 83 95 PSM KESGVDIAAGNMLV 1519 sp|P22102|PUR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=6785 24.43 2 1418.7075 1418.7075 Y K 438 452 PSM KETSALEASSPLLTGQILE 1520 sp|Q14746-2|COG2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8931 29.045 2 1986.0521 1986.0521 S R 153 172 PSM KETSEELLPPPVQTQI 1521 sp|Q8N183|NDUF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8072 26.737 2 1807.9567 1807.9567 S K 114 130 PSM KEYTDVYPEIIE 1522 sp|Q9UNF1-2|MAGD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7872 26.349 2 1497.7239 1497.7239 I R 293 305 PSM KFLIPNASQAES 1523 sp|P63104|1433Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6587 24.092 2 1303.6772 1303.6772 E K 103 115 PSM KFMQTFVLAPEGSVPN 1524 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8642 28.103 2 1763.8916 1763.8916 R K 107 123 PSM KGDNITLLQSVSN 1525 sp|P62304|RUXE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7432 25.525 2 1387.7307 1387.7307 L - 80 93 PSM KGINTLVTYDMVPEP 1526 sp|P20674|COX5A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=7929 26.468 2 1691.844 1691.8440 R K 72 87 PSM KGLAITFVSDENDA 1527 sp|O00148|DX39A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7941 26.494 2 1478.7253 1478.7253 T K 383 397 PSM KGLVVDMDGFEEE 1528 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=6811 24.477 2 1482.6548 1482.6548 E R 432 445 PSM KGQILMPNIGYGSN 1529 sp|P62910|RL32_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7709 26.031 2 1490.7551 1490.7551 F K 50 64 PSM KGSLLIDSSTIDPAVS 1530 sp|P31937|3HIDH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7949 26.507 2 1601.8512 1601.8512 K K 125 141 PSM KGVDIVMDPLGGSDTA 1531 sp|Q99536-3|VAT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8362 27.368 2 1573.7658 1573.7658 P K 187 203 PSM KGVNLPGAAVDLPAVSE 1532 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=9406 30.882 2 1635.8832 1635.8832 K K 207 224 PSM KIEPEPFENCLL 1533 sp|P48637-2|GSHB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:4 ms_run[2]:scan=8695 28.254 2 1487.733 1487.7330 E R 289 301 PSM KIIEGTEVVQEIQN 1534 sp|Q99570|PI3R4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6696 24.274 2 1598.8516 1598.8516 R K 1293 1307 PSM KIIMPPSALDQLS 1535 sp|Q92890-3|UFD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 4-UNIMOD:35 ms_run[2]:scan=7617 25.859 2 1427.7694 1427.7694 G R 45 58 PSM KIIPLYSTLPPQQQQ 1536 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8135 26.849 2 1752.9774 1752.9774 I R 384 399 PSM KILDDTEDTVVSQ 1537 sp|P42696-2|RBM34_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5650 22.559 2 1461.7199 1461.7199 R R 156 169 PSM KINDFVLSPGPQPY 1538 sp|Q9BY44-3|EIF2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8316 27.259 2 1573.814 1573.8140 Q K 144 158 PSM KIPGSPPESMG 1539 sp|P50395-2|GDIB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=4196 18.434 2 1114.5329 1114.5329 F R 57 68 PSM KISDDTPLEMMTSP 1540 sp|Q9H6U6-6|BCAS3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=5517 22.289 2 1595.7059 1595.7059 P R 393 407 PSM KIVTGFNGIPFTIQ 1541 sp|Q9NY27-3|PP4R2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=9102 29.741 2 1533.8555 1533.8555 L R 33 47 PSM KIVYPPQLPGEP 1542 sp|Q9NWU5|RM22_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7915 26.433 2 1336.7391 1336.7391 N R 50 62 PSM KLASGVEGSDIPDDG 1543 sp|O95747|OXSR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5306 21.835 2 1458.6838 1458.6838 F K 502 517 PSM KLDEDEDEDDADLS 1544 sp|O95218-2|ZRAB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4841 20.678 2 1607.6322 1607.6322 Y K 168 182 PSM KLEAPPPTPGQL 1545 sp|Q6PI78|TMM65_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6061 23.266 2 1246.6921 1246.6921 E R 103 115 PSM KLEENLPILQQPTE 1546 sp|O60664-4|PLIN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8035 26.659 2 1650.8829 1650.8829 D K 102 116 PSM KLGADAVGMSTVPEVIVA 1547 sp|P00491|PNPH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 9-UNIMOD:35 ms_run[2]:scan=7840 26.285 2 1771.939 1771.9390 Q R 211 229 PSM KLIGVPADAEALSE 1548 sp|Q96EA4-2|SPDLY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7449 25.547 2 1411.7559 1411.7559 V R 435 449 PSM KLIVDPALDPAL 1549 sp|O15047|SET1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8646 28.112 2 1263.7438 1263.7438 Y R 21 33 PSM KLLAVAATAPPDAPN 1550 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6168 23.438 2 1447.8035 1447.8035 I R 607 622 PSM KLLPAAGPAGGEPY 1551 sp|O60934|NBN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6566 24.064 2 1339.7136 1339.7136 W R 3 17 PSM KLMCPQEIVDYIAD 1552 sp|O14561|ACPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 3-UNIMOD:35,4-UNIMOD:4 ms_run[2]:scan=8652 28.124 2 1709.8004 1709.8004 E K 137 151 PSM KLQAAVDGPMD 1553 sp|P51572|BAP31_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=4285 18.797 2 1159.5543 1159.5543 A K 232 243 PSM KLQPAYQVTLPGQEPIV 1554 sp|P41214|EIF2D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8448 27.596 2 1880.0407 1880.0407 E K 467 484 PSM KLTFDSSFSPNTG 1555 sp|P21796|VDAC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7303 25.301 2 1399.662 1399.6620 L K 96 109 PSM KLVEVIPEGAML 1556 sp|Q5VV42-2|CDKAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35 ms_run[2]:scan=8087 26.762 2 1313.7265 1313.7265 W R 207 219 PSM KLVVECVMNNVTCT 1557 sp|Q01469|FABP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 6-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:4 ms_run[2]:scan=5898 22.992 2 1681.7837 1681.7837 G R 115 129 PSM KMENQSENNDIDEVIIPTAPLY 1558 sp|Q99816|TS101_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:35 ms_run[2]:scan=9014 29.358 3 2548.2003 2548.2003 E K 304 326 PSM KMGQPSDPTAVVDPQT 1559 sp|Q8NE62|CHDH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:35 ms_run[2]:scan=5108 21.343 2 1685.7931 1685.7931 C R 517 533 PSM KMINLSVPDTIDE 1560 sp|P13797-3|PLST_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8088 26.764 2 1473.7385 1473.7385 C R 123 136 PSM KMVVPGLDGAQIP 1561 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 2-UNIMOD:35 ms_run[2]:scan=7473 25.6 2 1339.717 1339.7170 L R 1158 1171 PSM KNDPEITINVPQSS 1562 sp|Q13416|ORC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6352 23.726 2 1540.7733 1540.7733 L K 126 140 PSM KNLPPEEQMISALPDI 1563 sp|O15355|PPM1G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 9-UNIMOD:35 ms_run[2]:scan=8299 27.213 2 1809.9183 1809.9183 N K 409 425 PSM KNPDEIDETTELSS 1564 sp|P17301|ITA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5422 22.089 2 1576.7104 1576.7104 T - 1168 1182 PSM KNPDVDAICEMPSLS 1565 sp|Q2NKX8|ERC6L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 9-UNIMOD:4,11-UNIMOD:35 ms_run[2]:scan=6149 23.405 2 1690.7542 1690.7542 E R 348 363 PSM KPDVTYSDVGGC 1566 sp|P35998-2|PRS7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:4 ms_run[2]:scan=4883 20.798 2 1296.5656 1296.5656 E K 32 44 PSM KPEEEITVGPVQ 1567 sp|P53618|COPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5766 22.77 2 1324.6874 1324.6874 L K 501 513 PSM KPEVIGEALNQLVPQ 1568 sp|O43847|NRDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8794 28.563 2 1633.9039 1633.9039 Y K 591 606 PSM KPFLLPVEAVYSVPG 1569 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=9221 30.31 2 1614.9021 1614.9021 E R 256 271 PSM KPGVAAPPEVAPAP 1570 sp|Q9Y520-3|PRC2C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5346 21.916 2 1299.7187 1299.7187 P K 105 119 PSM KPLPQLEPQAEVFT 1571 sp|Q13439-3|GOGA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7846 26.297 2 1595.8559 1595.8559 L K 246 260 PSM KPQPLQQPSQPQQPPPTQQAVA 1572 sp|Q8WWM7-6|ATX2L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5179 21.511 3 2392.2499 2392.2499 L R 3 25 PSM KPSDAGEDGAPEDAAEVGA 1573 sp|Q12872|SFSWA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4950 20.969 2 1784.7701 1784.7701 E R 532 551 PSM KPTIVEEDDPELF 1574 sp|O75937|DNJC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8099 26.784 2 1530.7454 1530.7454 G K 146 159 PSM KPTPIQTQAIPAIMSG 1575 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 14-UNIMOD:35 ms_run[2]:scan=6452 23.885 2 1667.8916 1667.8916 E R 394 410 PSM KPVETIGFDSIM 1576 sp|Q15813|TBCE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=7439 25.534 2 1351.6694 1351.6694 N K 109 121 PSM KPVVSFIAGLTAPPG 1577 sp|P53597|SUCA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8979 29.218 2 1452.8341 1452.8341 S R 280 295 PSM KQVGETSAPGDTLDGTP 1578 sp|Q9NZN5-2|ARHGC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5152 21.444 2 1671.7952 1671.7952 S R 669 686 PSM KSDDYLPSIEQQPQQ 1579 sp|Q9P2D1-2|CHD7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6703 24.286 2 1774.8374 1774.8374 V K 582 597 PSM KSFPPPGPAEGLL 1580 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8293 27.198 2 1308.7078 1308.7078 L R 5 18 PSM KSGSLDDSFSDFQELPASS 1581 sp|Q9UMZ2-6|SYNRG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8407 27.47 2 2015.896 2015.8960 S K 305 324 PSM KSIPLECPLSSP 1582 sp|Q92667-2|AKAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:4 ms_run[2]:scan=6771 24.41 2 1326.6853 1326.6853 A K 141 153 PSM KSISVIDSPGILSGE 1583 sp|Q9H223|EHD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7972 26.546 2 1500.8035 1500.8035 L K 150 165 PSM KSIVTAEVSSMPAC 1584 sp|Q86SZ2-2|TPC6B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 11-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=5148 21.438 2 1494.7058 1494.7058 I K 108 122 PSM KSLLQMVPLDEGASE 1585 sp|Q01968-2|OCRL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8924 29.021 2 1615.8127 1615.8127 E R 707 722 PSM KSSSLEMTPYNTPQLSPATTPAN 1586 sp|Q14C86-3|GAPD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=6368 23.754 3 2450.1635 2450.1635 G K 451 474 PSM KSVEVQGETETIIAT 1587 sp|O60763|USO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6142 23.395 2 1603.8305 1603.8305 A K 827 842 PSM KSVTDYAQQNPAAQIPA 1588 sp|Q9UM54-6|MYO6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6340 23.708 2 1800.9006 1800.9006 P R 1141 1158 PSM KTDAEATDTEATET 1589 sp|Q9Y3D3|RT16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=3549 15.612 2 1481.6369 1481.6369 Q - 124 138 PSM KTGTLTTNQMSVC 1590 sp|P16615-5|AT2A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35,13-UNIMOD:4 ms_run[2]:scan=4181 18.386 2 1455.6698 1455.6698 D R 352 365 PSM KTIIQNPTDQQ 1591 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4745 20.427 2 1284.6674 1284.6674 E K 199 210 PSM KTILEEEITPTIQ 1592 sp|O95347-2|SMC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8082 26.754 2 1513.8239 1513.8239 I K 196 209 PSM KTPTPEPAEVET 1593 sp|Q9UHY1|NRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4627 20.068 2 1297.6402 1297.6402 V R 430 442 PSM KTSDIFGSPVTATS 1594 sp|Q9H910-2|JUPI2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6760 24.387 2 1409.7038 1409.7038 G R 74 88 PSM KTSDVNETQPPQSE 1595 sp|P35580|MYH10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=3691 16.304 2 1558.7111 1558.7111 S - 1963 1977 PSM KTTTLSGTAPAAGVVPS 1596 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5602 22.471 2 1556.841 1556.8410 K R 871 888 PSM KTYLDGEGCIVTE 1597 sp|Q15054-3|DPOD3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 9-UNIMOD:4 ms_run[2]:scan=6377 23.766 2 1483.6865 1483.6865 S K 284 297 PSM KVATPLPDPMAS 1598 sp|Q14126|DSG2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=5315 21.856 2 1241.6326 1241.6326 Q R 919 931 PSM KVAYIPDEMAAQQNPLQQP 1599 sp|O00425|IF2B3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7864 26.332 3 2140.0623 2140.0623 L R 150 169 PSM KVDELSLYSVPEGQS 1600 sp|Q9BUR5-2|MIC26_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7573 25.776 2 1649.8148 1649.8148 V K 36 51 PSM KVDLLPQDAPGY 1601 sp|Q8NC60|NOA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7424 25.515 2 1314.682 1314.6820 N R 249 261 PSM KVDQIQEIVTGNPTVI 1602 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8543 27.846 2 1752.9622 1752.9622 S K 1037 1053 PSM KVDVTEQPGLSG 1603 sp|Q9H3N1|TMX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4977 21.029 2 1228.6299 1228.6299 A R 82 94 PSM KVEIIANDQGN 1604 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=4706 20.313 2 1199.6146 1199.6146 G R 25 36 PSM KVFDPVPVGVT 1605 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=7441 25.537 2 1156.6492 1156.6492 R K 697 708 PSM KVGAEDADGIDMAY 1606 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=5417 22.077 2 1469.6344 1469.6344 G R 282 296 PSM KVLLISDPTTD 1607 sp|P14735|IDE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6576 24.077 2 1200.6602 1200.6602 I K 74 85 PSM KVLLSPDYLPAM 1608 sp|Q7Z6Z7-2|HUWE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=7812 26.233 2 1361.7265 1361.7265 F R 632 644 PSM KVLQDMGLPTGAEG 1609 sp|Q12906-5|ILF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 6-UNIMOD:35 ms_run[2]:scan=5480 22.2 2 1430.7075 1430.7075 V R 460 474 PSM KVLSSAASLPGSELPSS 1610 sp|O15027-3|SC16A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6597 24.109 2 1628.8621 1628.8621 P R 2264 2281 PSM KVSLEETAQLPSAPQGS 1611 sp|Q9BRP8-2|PYM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6333 23.693 2 1740.8894 1740.8894 D R 114 131 PSM KVTPDIEESLLEPENE 1612 sp|Q14151|SAFB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8287 27.177 2 1840.8942 1840.8942 F K 199 215 PSM KVTVDTGVIPASEE 1613 sp|O60841|IF2P_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5948 23.091 2 1443.7457 1443.7457 S K 284 298 PSM KYEQGFITDPVVLSP 1614 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8738 28.378 2 1691.877 1691.8770 K K 109 124 PSM KYLIPNATQPES 1615 sp|P31946-2|1433B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5899 22.994 2 1359.7034 1359.7034 D K 103 115 PSM RAGDMICPECGLVVGD 1616 sp|Q00403|TF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 5-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:4 ms_run[2]:scan=6996 24.779 2 1763.7641 1763.7641 Y R 28 44 PSM RAVLVDLEPGTMDSV 1617 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=7770 26.146 2 1616.808 1616.8080 P R 62 77 PSM RDAEDAMDAMDGAVLDG 1618 sp|Q01130-2|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=5203 21.555 2 1782.7036 1782.7036 K R 66 83 PSM RDMTLPPETNVILT 1619 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8183 26.959 2 1598.8338 1598.8338 A K 448 462 PSM RDPAQPMSPGEATQSGA 1620 sp|Q9BQG0|MBB1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=4003 17.692 2 1714.7581 1714.7581 S R 4 21 PSM RDPTDALSYMTIQQ 1621 sp|Q96SI9-2|STRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 10-UNIMOD:35 ms_run[2]:scan=6571 24.071 2 1653.7668 1653.7668 E K 275 289 PSM RDQDLEPGAPSMGA 1622 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=4508 19.654 2 1458.6409 1458.6409 A K 1463 1477 PSM RDTAYPETNDAIPMIS 1623 sp|Q9UQE7|SMC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 14-UNIMOD:35 ms_run[2]:scan=6895 24.61 2 1808.8251 1808.8251 V K 596 612 PSM RDVSELTGFPEMLGG 1624 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 12-UNIMOD:35 ms_run[2]:scan=8343 27.316 2 1622.761 1622.7610 V R 48 63 PSM REAGVEMGDEDDLSTPNE 1625 sp|P14868-2|SYDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:35 ms_run[2]:scan=5037 21.179 2 1978.8062 1978.8062 L K 256 274 PSM REDDMLDMAPLLQENS 1626 sp|Q6P4F2|FDX2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 5-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=7201 25.126 2 1907.8241 1907.8241 E R 135 151 PSM REGGDGEEQDVGDAG 1627 sp|Q8N1G4|LRC47_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=3703 16.365 2 1489.5917 1489.5917 R R 291 306 PSM RGESAPTLSTSPSPSSPSPTSPSPTLG 1628 sp|Q9H330-4|TM245_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=6199 23.487 3 2581.2508 2581.2508 D R 310 337 PSM RIFPGDTILETGEVIPPM 1629 sp|O95139|NDUB6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 18-UNIMOD:35 ms_run[2]:scan=8963 29.161 2 2000.0289 2000.0289 S K 103 121 PSM RIITGPAPVLPPAAL 1630 sp|Q96PU8-5|QKI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8467 27.642 2 1484.9079 1484.9079 P R 219 234 PSM RLFPPDDSPLPVSS 1631 sp|Q05519-2|SRS11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8788 28.545 2 1525.7777 1525.7777 L R 63 77 PSM RLMTDTINEPILLC 1632 sp|O43776|SYNC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 3-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=8354 27.344 2 1703.8586 1703.8586 E R 425 439 PSM RPLMVLGSQALLTPTSAD 1633 sp|A1L0T0|HACL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 4-UNIMOD:35 ms_run[2]:scan=8323 27.274 2 1884.9979 1884.9979 K K 285 303 PSM RPSAAAPQAENGPAAAPAVAAPAATEAP 1634 sp|Q15020-4|SART3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=5796 22.823 3 2524.267 2524.2670 Q K 886 914 PSM RQDGTLCLQEPGVFPQEVAD 1635 sp|Q9C0D3|ZY11B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 7-UNIMOD:4 ms_run[2]:scan=8431 27.546 3 2258.0637 2258.0637 A R 37 57 PSM RTTTGLDSAVDPVQM 1636 sp|Q96TA2-3|YMEL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 15-UNIMOD:35 ms_run[2]:scan=5775 22.786 2 1605.7668 1605.7668 F K 229 244 PSM RVDPSQPIDLTQLVNG 1637 sp|Q9P015|RM15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 ms_run[2]:scan=8902 28.944 2 1750.9214 1750.9214 G R 109 125 PSM RTLTIVDTGIGMT 1638 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 12-UNIMOD:35 ms_run[1]:scan=7319 25.332336715466667 2 1392.726945 1392.728266 D K 27 40 PSM KSFYPEEVSSMVLT 1639 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 11-UNIMOD:35 ms_run[1]:scan=7523 25.684506949066666 2 1631.774252 1631.775276 T K 112 126 PSM KPSQVNGAPGSPTEPAGQ 1640 sp|Q9BQG0|MBB1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=4195 18.429445126666668 2 1721.823495 1720.838027 Q K 1257 1275 PSM KQQQMPPPPPPPPPPPPAGGTGG 1641 sp|O14654|IRS4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:35 ms_run[1]:scan=5148 21.437658389333333 3 2243.124258 2242.120474 S K 623 646 PSM KTTTPGPSLSQGVSVDE 1642 sp|O60934|NBN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=5751 22.747849492 2 1701.841330 1701.842109 L K 334 351 PSM KGMDADPYNPVLPTN 1643 sp|Q9H6T3|RPAP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:35 ms_run[1]:scan=6327 23.683522356799998 2 1646.759746 1646.761023 T R 158 173 PSM KLGIYDADGDGDFDVDDA 1644 sp|Q12797|ASPH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=8157 26.892523920533332 2 1899.800980 1899.801033 G K 86 104 PSM KAFLASPEYVNLPINGNG 1645 sp|P09211|GSTP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=8752 28.4168803496 2 1903.971815 1902.983963 L K 191 209 PSM KSMFGSLDPPNMPQALP 1646 sp|Q99570|PI3R4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=7601 25.83063723173333 2 1860.866989 1860.875007 W K 860 877 PSM KPVNPVFCMPEEVLQ 1647 sp|P53611|PGTB2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 8-UNIMOD:4 ms_run[1]:scan=8972 29.1935605224 2 1785.883527 1785.879364 I R 307 322 PSM RLEGTDLDCQVGGLIC 1648 sp|Q92620|PRP16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 9-UNIMOD:4,16-UNIMOD:4 ms_run[1]:scan=8169 26.9235465376 2 1804.868355 1804.844769 H K 12 28 PSM KAILILDNDGD 1649 sp|P61923|COPZ1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=7205 25.133079334133335 2 1185.624162 1185.624118 V R 14 25 PSM RDPGPDPGPGPDPAA 1650 sp|Q6PJ69|TRI65_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=4582 19.91770796986667 2 1414.646324 1414.647707 A R 79 94 PSM KAMDQEITVNPQFVQ 1651 sp|Q9UNS2|CSN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 3-UNIMOD:35 ms_run[1]:scan=6836 24.51609390906667 3 1762.855437 1762.855986 L K 391 406 PSM KLDEMEFNPVQQPQLNE 1652 sp|Q9Y2W2|WBP11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 5-UNIMOD:35 ms_run[1]:scan=7247 25.206064297333334 3 2073.966652 2073.967721 E K 59 76 PSM KPALIPQPTFTE 1653 sp|P57740|NU107_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 29 ms_run[1]:scan=7516 25.676715516266665 2 1341.7322 1340.7332 Q K 773 785 PSM KAAFGEEVDAVDTGIS 1654 sp|O00273-2|DFFA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7185 25.093 2 1607.7679 1607.7679 S R 213 229 PSM KAAGALLNGPPQFSTAPEI 1655 sp|O75175|CNOT3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8553 27.873 3 1880.9996 1880.9996 A K 516 535 PSM KAALPLTTSDT 1656 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5504 22.257 2 1116.6027 1116.6027 I K 1497 1508 PSM KAEPPQAMNALM 1657 sp|Q12906-5|ILF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 8-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=4306 18.877 2 1331.6214 1331.6214 E R 396 408 PSM KAFYPEEISSMVLT 1658 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=9020 29.386 2 1613.8011 1613.8011 T K 112 126 PSM KALELDPDNETY 1659 sp|O43765|SGTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6543 24.03 2 1406.6565 1406.6565 K K 184 196 PSM KALYDNVAESPDELSF 1660 sp|P56945-4|BCAR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8536 27.83 2 1796.8469 1796.8469 A R 9 25 PSM KAPTADTQTQNVNQA 1661 sp|Q9Y5V3|MAGD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=3669 16.198 2 1585.7696 1585.7696 T K 189 204 PSM KAQQATPGGAAPTIFS 1662 sp|Q9BX68|HINT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6536 24.021 2 1543.7995 1543.7995 A R 42 58 PSM KATNESEDEIPQLVPIG 1663 sp|O76021-2|RL1D1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8532 27.819 2 1838.9262 1838.9262 V K 136 153 PSM KCFNEIQGESVSLGDDPSQPQTTIN 1664 sp|Q09472|EP300_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 2-UNIMOD:4 ms_run[2]:scan=7156 25.045 3 2763.2658 2763.2658 E K 1203 1228 PSM KDADECLLFGQEIC 1665 sp|Q14766-3|LTBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 6-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=8694 28.252 2 1696.7437 1696.7437 Y K 1044 1058 PSM KDAEECPETAEA 1666 sp|Q5H9R7-3|PP6R3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 6-UNIMOD:4 ms_run[2]:scan=3853 17.103 2 1348.5453 1348.5453 C K 751 763 PSM KDDAAPAPPVADA 1667 sp|Q92667-2|AKAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=4668 20.208 2 1236.5986 1236.5986 A K 281 294 PSM KDFLPVDPATSNG 1668 sp|P10586-2|PTPRF_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7083 24.92 2 1359.667 1359.6670 F R 170 183 PSM KDGNGYISAAEL 1669 sp|P0DP25|CALM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7164 25.057 2 1236.5986 1236.5986 D R 95 107 PSM KDINSVAIAPND 1670 sp|Q12788|TBL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5180 21.513 2 1255.6408 1255.6408 D K 480 492 PSM KDIVVQETMEDID 1671 sp|O43852-10|CALU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7301 25.298 2 1533.7232 1533.7232 M K 189 202 PSM KDMAQLPETEIAPA 1672 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35 ms_run[2]:scan=6042 23.239 2 1528.7443 1528.7443 V K 476 490 PSM KDMDGVEMDETD 1673 sp|Q96PV7-2|F193B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=3560 15.661 2 1415.5068 1415.5068 P R 398 410 PSM KDPTVSQTFMLD 1674 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:35 ms_run[2]:scan=7112 24.965 2 1396.6544 1396.6544 S R 137 149 PSM KDVSGPLPPAYSP 1675 sp|Q5ST30|SYVM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6212 23.508 2 1326.682 1326.6820 K R 94 107 PSM KDYEEIGPSIC 1676 sp|P61158|ARP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:4 ms_run[2]:scan=6223 23.523 2 1309.586 1309.5860 K R 398 409 PSM KEAELPLLDLM 1677 sp|Q96L91-4|EP400_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=9068 29.594 2 1286.6792 1286.6792 A K 941 952 PSM KEALGIPAAASF 1678 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8016 26.623 2 1173.6394 1173.6394 L K 253 265 PSM KEAMEDGEIDGN 1679 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 4-UNIMOD:35 ms_run[2]:scan=3602 15.868 2 1322.5296 1322.5296 A K 627 639 PSM KEAMEDGEIDGN 1680 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 4-UNIMOD:35 ms_run[2]:scan=3692 16.31 2 1322.5296 1322.5296 A K 627 639 PSM KEAQSSQATPVQTSQPDSSNIV 1681 sp|Q8IZH2-2|XRN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5359 21.944 3 2301.1084 2301.1084 N K 1609 1631 PSM KEDDYESDAATIVQ 1682 sp|Q5T4S7-3|UBR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6169 23.439 2 1582.6999 1582.6999 S K 366 380 PSM KEDGLAQQQTQLNL 1683 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6704 24.287 2 1584.8107 1584.8107 P R 2206 2220 PSM KEEASGSSVTAEEA 1684 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=3848 17.075 2 1393.6209 1393.6209 T K 688 702 PSM KEEIDILSDACS 1685 sp|O95202|LETM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:4 ms_run[2]:scan=7307 25.309 2 1378.6286 1378.6286 T K 542 554 PSM KEEIFGPVMQIL 1686 sp|P05091-2|ALDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 9-UNIMOD:35 ms_run[2]:scan=8974 29.2 2 1418.7479 1418.7479 A K 367 379 PSM KEEPADFPVEQPEEN 1687 sp|Q5BKZ1-3|ZN326_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6058 23.262 2 1756.7792 1756.7792 A - 362 377 PSM KEGIPALDNFLD 1688 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=9126 29.86 2 1330.6769 1330.6769 L K 845 857 PSM KEITALAPSTM 1689 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=5147 21.436 2 1176.606 1176.6060 Q K 315 326 PSM KELEASEELDTICP 1690 sp|O76003|GLRX3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 13-UNIMOD:4 ms_run[2]:scan=7310 25.315 2 1632.7553 1632.7553 I K 217 231 PSM KELSTTLNADEAVT 1691 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5503 22.254 2 1490.7464 1490.7464 G R 360 374 PSM KELTASVTEAIPVS 1692 sp|P48634-2|PRC2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7067 24.895 2 1443.7821 1443.7821 E R 1770 1784 PSM KELVYPPDYNPEG 1693 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6297 23.649 2 1519.7195 1519.7195 F K 485 498 PSM KEPAFEDITLESE 1694 sp|O75400-2|PR40A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7936 26.485 2 1506.709 1506.7090 V R 749 762 PSM KEPEQEPVPAQFQ 1695 sp|Q96ME7-2|ZN512_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5825 22.871 2 1525.7413 1525.7413 C K 464 477 PSM KEPESFPFVILGN 1696 sp|P51151|RAB9A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=9249 30.387 2 1475.766 1475.7660 V K 112 125 PSM KESELTDEDITTILE 1697 sp|P28370-2|SMCA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8760 28.451 2 1734.8411 1734.8411 S R 668 683 PSM KETGDPGGQLVLAGDP 1698 sp|Q9HCE1-2|MOV10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6572 24.072 2 1552.7733 1552.7733 V R 666 682 PSM KETPPPLVPPAA 1699 sp|Q9BQA1-2|MEP50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6226 23.53 2 1215.6863 1215.6863 R R 3 15 PSM KEVFPTAALMPGAE 1700 sp|Q08623-3|HDHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:35 ms_run[2]:scan=7291 25.28 2 1475.733 1475.7330 L K 83 97 PSM KEVIPISDPEL 1701 sp|Q6IN85-5|P4R3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7750 26.102 2 1238.6758 1238.6758 F K 247 258 PSM KEVTPEGLQMV 1702 sp|P22234|PUR6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:35 ms_run[2]:scan=5723 22.691 2 1245.6275 1245.6275 L K 235 246 PSM KFDFDACNEVPPAP 1703 sp|Q15424-2|SAFB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 7-UNIMOD:4 ms_run[2]:scan=7653 25.919 2 1605.7133 1605.7133 R K 287 301 PSM KFPLTTESAM 1704 sp|P62750|RL23A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:35 ms_run[2]:scan=5756 22.756 2 1139.5533 1139.5533 I K 78 88 PSM KGDVTITNDGATIL 1705 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7244 25.202 2 1416.746 1416.7460 G K 65 79 PSM KGILAADESTGSIA 1706 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6211 23.508 2 1331.6933 1331.6933 G K 28 42 PSM KGIPELEQYDPPELADSSG 1707 sp|Q96KG9-5|SCYL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8366 27.376 3 2043.9637 2043.9637 R R 176 195 PSM KGVELEPTDQDFYQ 1708 sp|P43250-3|GRK6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7165 25.059 2 1667.7679 1667.7679 V K 487 501 PSM KIDEPLEGSED 1709 sp|P61978-3|HNRPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5092 21.311 2 1230.5616 1230.5616 I R 398 409 PSM KIFEGMPVTFTC 1710 sp|Q8WX93-7|PALLD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 6-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=7454 25.558 2 1444.6731 1444.6731 Y R 13 25 PSM KIGQQPQQPGAPPQQDYT 1711 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5131 21.394 3 1979.9701 1979.9701 K K 628 646 PSM KILDDSDSNLSVV 1712 sp|Q7Z3J3|RGPD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6800 24.456 2 1403.7144 1403.7144 I K 721 734 PSM KITLPVDFVTAD 1713 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8947 29.096 2 1317.718 1317.7180 V K 251 263 PSM KLAAVDATVNQVLAS 1714 sp|Q15084-3|PDIA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8155 26.886 2 1498.8355 1498.8355 V R 213 228 PSM KLATQLTGPVMPV 1715 sp|P26373-2|RL13_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=6580 24.083 2 1369.7639 1369.7639 L R 98 111 PSM KLAVEALSSLDGDLAG 1716 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8891 28.903 2 1557.825 1557.8250 E R 156 172 PSM KLDYDEDASAML 1717 sp|P50502|F10A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=6176 23.449 2 1385.6021 1385.6021 C K 210 222 PSM KLEGTEDLSDVLV 1718 sp|Q15003-2|CND2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8440 27.572 2 1416.7348 1416.7348 L R 589 602 PSM KLMDGAPSESE 1719 sp|Q9H7B4-3|SMYD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35 ms_run[2]:scan=3755 16.61 2 1178.5125 1178.5125 F K 52 63 PSM KLMIEMDGTEN 1720 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=4575 19.902 2 1311.5687 1311.5687 D K 92 103 PSM KLMIEMDGTEN 1721 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 6-UNIMOD:35 ms_run[2]:scan=5190 21.533 2 1295.5737 1295.5737 D K 92 103 PSM KLTQPIEFVPEDEIQ 1722 sp|Q96IZ5-2|RBM41_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8409 27.477 2 1784.9196 1784.9196 K R 270 285 PSM KLVSDEMVVELIE 1723 sp|P54819-4|KAD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 7-UNIMOD:35 ms_run[2]:scan=8595 27.995 2 1518.7851 1518.7851 G K 24 37 PSM KMDATANDVPSPYEV 1724 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6747 24.362 2 1635.745 1635.7450 A R 433 448 PSM KMFVLDEADEMLS 1725 sp|P60842-2|IF4A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 2-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=6966 24.734 2 1558.6895 1558.6895 I R 177 190 PSM KNPSTSLGPTLEPEEVVN 1726 sp|Q8NBQ5|DHB11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7080 24.912 3 1909.9633 1909.9633 I R 227 245 PSM KNVPQEEEIMPPNSLPSNNS 1727 sp|Q06787-11|FMR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:35 ms_run[2]:scan=5880 22.959 3 2239.0427 2239.0427 E R 324 344 PSM KNVVLPTETEVAPA 1728 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6217 23.514 2 1466.7981 1466.7981 A K 332 346 PSM KPAGPTVEQQGEMA 1729 sp|P54886-2|P5CS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 13-UNIMOD:35 ms_run[2]:scan=4021 17.772 2 1457.682 1457.6820 V R 355 369 PSM KPDSEDLSSQSSAS 1730 sp|Q5VTR2|BRE1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=3712 16.409 2 1436.6267 1436.6267 L K 537 551 PSM KPEDLPETVPYL 1731 sp|O75319-2|DUS11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8458 27.619 2 1399.7235 1399.7235 Y K 148 160 PSM KPEPPAMPQPVPTA 1732 sp|P23396|RS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5954 23.102 2 1458.7541 1458.7541 G - 230 244 PSM KPFLPQLQTTFT 1733 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8787 28.541 2 1419.7762 1419.7762 L K 2342 2354 PSM KPGLTPSPSATTPLT 1734 sp|Q9P2B4|CT2NL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5769 22.775 2 1466.7981 1466.7981 K K 586 601 PSM KPGNPPAEIGQNISSNSSASILES 1735 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7318 25.328 3 2396.1819 2396.1819 Y K 800 824 PSM KPIAEAPSAFTLGSEM 1736 sp|P49792|RBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8443 27.577 2 1647.8178 1647.8178 H K 1812 1828 PSM KPLLGGDVSAPEGT 1737 sp|Q8IY22|CMIP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6034 23.228 2 1339.6983 1339.6983 T K 20 34 PSM KPLLPGQTPEAA 1738 sp|Q9UN36-4|NDRG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5471 22.184 2 1220.6765 1220.6765 E K 13 25 PSM KPLLVEPEGLE 1739 sp|P01023|A2MG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7339 25.371 2 1222.6809 1222.6809 I K 901 912 PSM KPLPTVPGGLSPVQ 1740 sp|Q9NUJ3|T11L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7038 24.853 2 1388.8028 1388.8028 Q R 460 474 PSM KPNYIVPDYMPVVYD 1741 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8938 29.065 2 1811.8804 1811.8804 E K 3117 3132 PSM KPSSPSPDLPFTTPAP 1742 sp|Q9Y4U1|MMAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7845 26.295 2 1637.8301 1637.8301 E K 242 258 PSM KPSTFAYPAPLEVP 1743 sp|Q99460|PSMD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8550 27.866 2 1515.7973 1515.7973 C K 807 821 PSM KPVEYTAVSVLAGP 1744 sp|Q9BW91-2|NUDT9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7967 26.54 2 1429.7817 1429.7817 Y R 45 59 PSM KQDLPNAMAISEMTD 1745 sp|P18085|ARF4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 13-UNIMOD:35 ms_run[2]:scan=6600 24.113 2 1678.7542 1678.7542 N K 127 142 PSM KQGGLGPMNIPLVSDP 1746 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8810 28.609 2 1621.8498 1621.8498 K K 93 109 PSM KQIIVDPLSFSEE 1747 sp|P35221|CTNA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8791 28.556 2 1503.7821 1503.7821 D R 287 300 PSM KQLEPLVAPLADG 1748 sp|Q96JC1-2|VPS39_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7725 26.06 2 1349.7555 1349.7555 G K 193 206 PSM KQQVPSGESAILD 1749 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5592 22.454 2 1370.7042 1370.7042 N R 269 282 PSM KSMVPVQVQLDVPVV 1750 sp|P18754|RCC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35 ms_run[2]:scan=8639 28.098 2 1652.9171 1652.9171 K K 161 176 PSM KSPSPPDGSPAATPEI 1751 sp|O00499-9|BIN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5671 22.595 2 1549.7624 1549.7624 N R 264 280 PSM KSPVESTTEPPAV 1752 sp|P53992-2|SC24C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5044 21.196 2 1340.6824 1340.6824 T R 204 217 PSM KTDPSILGGMIV 1753 sp|P48047|ATPO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8892 28.906 2 1229.669 1229.6690 A R 176 188 PSM KTDPTTLTDEEIN 1754 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5447 22.133 2 1475.6991 1475.6991 E R 504 517 PSM KTDTGIVTVEQSPSSS 1755 sp|Q8NFC6|BD1L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5063 21.241 2 1634.7999 1634.7999 S K 2894 2910 PSM KTEDSLMPEEEFL 1756 sp|Q15459|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8876 28.849 2 1566.7123 1566.7123 L R 686 699 PSM KTEIMSPLYQDEAP 1757 sp|Q8IY81|SPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7431 25.524 2 1620.7705 1620.7705 L K 579 593 PSM KTEVIPPLIEN 1758 sp|P04114|APOB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7436 25.53 2 1251.7075 1251.7075 T R 949 960 PSM KTFAPEEISAMVLT 1759 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=8100 26.785 2 1551.7854 1551.7854 T K 138 152 PSM KTLDTGETPSET 1760 sp|Q9UKZ1|CNO11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=4047 17.864 2 1277.5987 1277.5987 L K 495 507 PSM KTLISLPPQEATNSS 1761 sp|Q13596|SNX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6534 24.019 2 1584.8359 1584.8359 A K 111 126 PSM KTPLPPELADVQA 1762 sp|Q9Y5V0|ZN706_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7611 25.847 2 1377.7504 1377.7504 P - 64 77 PSM KTPMENIGLQDSLLS 1763 sp|P25205|MCM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 4-UNIMOD:35 ms_run[2]:scan=7815 26.238 2 1660.8342 1660.8342 Y R 463 478 PSM KTPSSDVLVFDYT 1764 sp|Q16576|RBBP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8505 27.749 2 1470.7242 1470.7242 T K 142 155 PSM KTPTPPAPTLL 1765 sp|Q14686|NCOA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7021 24.82 2 1134.6649 1134.6649 S K 1877 1888 PSM KTPTSSPASSPLVA 1766 sp|Q14684-2|RRP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5206 21.567 2 1341.714 1341.7140 L K 709 723 PSM KTSLLPIDETNPDLEE 1767 sp|Q6VMQ6-2|MCAF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8051 26.701 2 1812.8993 1812.8993 S K 454 470 PSM KTTDDTTTDNYIAQG 1768 sp|Q7Z2T5|TRM1L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=4860 20.726 2 1642.7322 1642.7322 I K 594 609 PSM KTVTAMDVVYAL 1769 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 6-UNIMOD:35 ms_run[2]:scan=8245 27.088 2 1325.6901 1325.6901 R K 80 92 PSM KVAGMDVELTVEE 1770 sp|P62258-2|1433E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 5-UNIMOD:35 ms_run[2]:scan=6056 23.259 2 1434.6912 1434.6912 K R 7 20 PSM KVALVYGQMNEPPGA 1771 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 9-UNIMOD:35 ms_run[2]:scan=6229 23.535 2 1588.7919 1588.7919 S R 264 279 PSM KVASVDSAVAATTPTSMATVQ 1772 sp|Q96C57|CSTOS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 17-UNIMOD:35 ms_run[2]:scan=5560 22.378 3 2050.0252 2050.0252 K K 199 220 PSM KVDFPQDQLTALTG 1773 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8373 27.394 2 1531.7882 1531.7882 P R 173 187 PSM KVDFPQDQLTALTG 1774 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8516 27.782 2 1531.7882 1531.7882 P R 173 187 PSM KVEPLDFGGTQ 1775 sp|P07686|HEXB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6698 24.278 2 1189.5979 1189.5979 Y K 465 476 PSM KVIDPATATSVDL 1776 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7018 24.814 2 1328.7187 1328.7187 M R 193 206 PSM KVIEEQLEPAVE 1777 sp|P42704|LPPRC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6046 23.245 2 1382.7293 1382.7293 R K 1224 1236 PSM KVIGGDDLSTLTG 1778 sp|P00492|HPRT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6812 24.479 2 1274.6718 1274.6718 I K 115 128 PSM KVLAGETLSVNDPPDVLD 1779 sp|Q12906-5|ILF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7983 26.568 2 1880.9731 1880.9731 E R 182 200 PSM KVLGMDPLPQMSQ 1780 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8140 26.86 2 1442.7262 1442.7262 H R 1028 1041 PSM KVLQDMGLPTGAEG 1781 sp|Q12906-5|ILF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=6901 24.621 2 1414.7126 1414.7126 V R 460 474 PSM KVPDSTYEMIGGLD 1782 sp|P62195-2|PRS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8078 26.749 2 1523.7178 1523.7178 E K 134 148 PSM KVPEVPTAPATDAAP 1783 sp|Q9UHD8-3|SEPT9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5823 22.869 2 1462.7668 1462.7668 S K 7 22 PSM KVPPAINQFTQALD 1784 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8465 27.636 2 1540.8249 1540.8249 L R 75 89 PSM KVQIPIMLVGN 1785 sp|Q15382|RHEB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 7-UNIMOD:35 ms_run[2]:scan=8102 26.789 2 1226.7057 1226.7057 G K 109 120 PSM KVTVEDPALQIPPF 1786 sp|O60306|AQR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=9038 29.468 2 1552.8501 1552.8501 V R 734 748 PSM KYVNMQDPEMDM 1787 sp|O00217|NDUS8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 5-UNIMOD:35,10-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=4040 17.84 2 1547.5942 1547.5942 Y K 37 49 PSM MKPLVVFVLGGPGAG 1788 sp|P30085-2|KCY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 1-UNIMOD:35 ms_run[2]:scan=9073 29.62 2 1456.8112 1456.8112 - K 1 16 PSM PGHLQEGFGCVVTN 1789 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:4 ms_run[2]:scan=6401 23.804 2 1513.6984 1513.6984 M R 2 16 PSM PSKGPLQSVQVFG 1790 sp|P62249|RS16_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7890 26.387 2 1342.7245 1342.7245 M R 2 15 PSM RAPPEPAPPAEATGAPAPS 1791 sp|P84157-2|MXRA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5053 21.215 2 1782.8901 1782.8901 A R 39 58 PSM RDNSDFDLLTVSETANEPPQDEGNSFNSP 1792 sp|O15371-2|EIF3D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8942 29.079 3 3194.3912 3194.3912 K R 232 261 PSM RDPAEALQLPMDYVQ 1793 sp|Q9Y285-2|SYFA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 11-UNIMOD:35 ms_run[2]:scan=8142 26.863 2 1760.8403 1760.8403 L R 249 264 PSM REGNVPNIIIAGPPGTG 1794 sp|P35250-2|RFC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7689 25.993 2 1660.8897 1660.8897 A K 65 82 PSM RETTDTDTADQVIASF 1795 sp|O43707|ACTN4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8403 27.46 2 1768.8115 1768.8115 S K 837 853 PSM RLDVTTQTPLTPEQL 1796 sp|Q5JTZ9|SYAM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7968 26.541 2 1710.9152 1710.9152 L R 663 678 PSM RLLDPEDVDVPQPDE 1797 sp|Q15149-7|PLEC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=7555 25.745 2 1735.8265 1735.8265 T K 202 217 PSM RLVLDPGEAPLVPVYSG 1798 sp|Q8NCF5|NF2IP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8926 29.028 2 1780.9723 1780.9723 R K 112 129 PSM RPADAEDLPAAPGQSID 1799 sp|Q8N6R0-1|EFNMT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5989 23.155 2 1721.822 1721.8220 Q K 293 310 PSM RPSTSQTVSTPAPVPVIESTEAIEA 1800 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=8246 27.09 3 2566.3126 2566.3126 K K 644 669 PSM RSQDPTPPSAPQEATEGS 1801 sp|Q9UPN7|PP6R1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=4448 19.433 2 1853.8391 1853.8391 L K 769 787 PSM RVLGDVPGACTPVVPT 1802 sp|Q9UHR6|ZNHI2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 10-UNIMOD:4 ms_run[2]:scan=7066 24.894 2 1636.8607 1636.8607 E R 179 195 PSM KYGIVDYMIEQSGPPS 1803 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 8-UNIMOD:35 ms_run[1]:scan=7358 25.404223361866666 2 1799.833764 1798.844752 E K 272 288 PSM RTLTIVDTGIGMT 1804 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 12-UNIMOD:35 ms_run[1]:scan=6888 24.596745381599998 2 1392.728235 1392.728266 D K 27 40 PSM KSFYPEEVSSMVLT 1805 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 11-UNIMOD:35 ms_run[1]:scan=7713 26.038385826133332 2 1631.774252 1631.775276 T K 112 126 PSM KNAVITVPAYFNDSQ 1806 sp|P38646|GRP75_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=8200 26.997366924266665 2 1666.818214 1665.836236 A R 187 202 PSM KDLYANTVLSGGTTMYPGIAD 1807 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 15-UNIMOD:35 ms_run[1]:scan=9583 31.4803766152 2 2203.055014 2202.051451 R R 291 312 PSM KEITALAPSTM 1808 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 11-UNIMOD:35 ms_run[1]:scan=9310 30.525580843733334 2 1176.605453 1176.606025 Q K 317 328 PSM KLPETNLFETEET 1809 sp|Q15046|SYK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=7704 26.01996318826667 2 1549.750141 1549.751169 M R 407 420 PSM RSSTGPEPPAPTPLLAE 1810 sp|Q9UQ35|SRRM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=7035 24.8486333512 2 1718.906388 1718.883915 E R 356 373 PSM KEQGPYETYEGSPVS 1811 sp|P23921|RIR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=5450 22.138507850666667 2 1669.746990 1669.747146 A K 548 563 PSM KGVDIVMDPLGGSDTA 1812 sp|Q99536|VAT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=8316 27.259226143466666 2 1573.764819 1573.765773 P K 255 271 PSM KQEPLGSDSEGVNCLAYDEAIMAQQD 1813 sp|Q96FW1|OTUB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 14-UNIMOD:4 ms_run[1]:scan=8710 28.298783181066664 3 2868.261801 2867.258954 Q R 10 36 PSM KLDYDEDASAML 1814 sp|P50502|F10A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 11-UNIMOD:35 ms_run[1]:scan=6166 23.4359219192 2 1385.602017 1385.602062 C K 210 222 PSM RLMTDTINEPILLC 1815 sp|O43776|SYNC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 3-UNIMOD:35,14-UNIMOD:4 ms_run[1]:scan=8384 27.41646439493333 2 1703.860732 1703.858629 E R 425 439 PSM KGLTPTGMLPSGVLSGG 1816 sp|Q08209|PP2BA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 8-UNIMOD:35 ms_run[1]:scan=7429 25.522754105066667 2 1587.840581 1586.833794 L K 424 441 PSM KVNATVPSNMMSVNGQA 1817 sp|Q9H3P7|GCP60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 10-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=4378 19.163046828266665 2 1778.816669 1778.829119 S K 322 339 PSM KEPSATPPISNLT 1818 sp|P30622|CLIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=6025 23.213450563200002 2 1353.712707 1353.713996 A K 177 190 PSM KAPEDAGPQPGSYEI 1819 sp|Q9Y5Z4|HEBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=6316 23.669909995733335 2 1557.730092 1557.731102 W R 26 41 PSM KILDQGEDFPASEMT 1820 sp|P30040|ERP29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 14-UNIMOD:35 ms_run[1]:scan=6038 23.233285769866665 2 1695.765489 1695.766168 G R 208 223 PSM KPLLGGDVSAPEGT 1821 sp|Q8IY22|CMIP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=6009 23.190067384 2 1339.697204 1339.698346 T K 20 34 PSM RSEPSGEINIDSSGETVGSGE 1822 sp|P42695|CNDD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 28 ms_run[1]:scan=5720 22.6853540392 2 2107.9602 2105.9342 N R 519 540 PSM KDQISVLPNEQDLV 1823 sp|O60271|JIP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 ms_run[1]:scan=8256 27.113322385066667 2 1597.854319 1596.835902 Y R 945 959 PSM KSPFEVQVGPEAGMQ 1824 sp|O75369|FLNB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 28 14-UNIMOD:35 ms_run[1]:scan=6743 24.355465760266668 2 1618.766048 1618.766108 P K 536 551 PSM APKFPDSVEEL 1825 sp|Q15785|TOM34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7860 26.327 2 1230.6132 1230.6132 M R 2 13 PSM KAAVPLGGFLCNVAD 1826 sp|Q7L8L6|FAKD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:4 ms_run[2]:scan=8869 28.825 2 1530.7864 1530.7864 N K 660 675 PSM KADAASSLTVDVTPPTA 1827 sp|Q9H8Y8-2|GORS2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6864 24.559 2 1642.8414 1642.8414 A K 335 352 PSM KAGEVINQPMMMAA 1828 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5230 21.632 2 1521.699 1521.6990 Q R 889 903 PSM KAPAGPSLEETSVSSP 1829 sp|Q6AI08|HEAT6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5541 22.34 2 1555.773 1555.7730 K K 629 645 PSM KAQAELVGTADEAT 1830 sp|P30049|ATPD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4923 20.903 2 1402.694 1402.6940 E R 136 150 PSM KASPDPDLDPDLS 1831 sp|Q9BQC3-3|DPH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5956 23.104 2 1368.6409 1368.6409 S R 88 101 PSM KATAVMPDGQF 1832 sp|Q06830|PRDX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:35 ms_run[2]:scan=5051 21.211 2 1179.5594 1179.5594 F K 16 27 PSM KATTADGSSILD 1833 sp|Q9BT78-2|CSN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4981 21.043 2 1177.5826 1177.5826 Q R 290 302 PSM KAVASLPPEQMFELM 1834 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 15-UNIMOD:35 ms_run[2]:scan=8774 28.5 2 1705.8419 1705.8419 S K 130 145 PSM KAVEDMLETLQITQS 1835 sp|Q15006|EMC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:35 ms_run[2]:scan=7397 25.467 2 1720.8553 1720.8553 L - 283 298 PSM KCSVLPLSQNQEFMPFV 1836 sp|P41250|GARS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 2-UNIMOD:4,14-UNIMOD:35 ms_run[2]:scan=9047 29.506 3 2038.9856 2038.9856 F K 615 632 PSM KDDVSTFPLIAA 1837 sp|Q7Z7C8|TAF8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8696 28.257 2 1275.6711 1275.6711 F R 205 217 PSM KDEPDTNLVALM 1838 sp|O95433-2|AHSA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8617 28.054 2 1344.6595 1344.6595 A K 125 137 PSM KDGAGNSFDLSSLS 1839 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7884 26.375 2 1396.647 1396.6470 F R 1372 1386 PSM KDIISDTSGDF 1840 sp|P07355|ANXA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6924 24.655 2 1196.5561 1196.5561 E R 157 168 PSM KDISTTLNADEAVA 1841 sp|O95757|HS74L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5975 23.135 2 1446.7202 1446.7202 L R 360 374 PSM KDITNVSLYPVV 1842 sp|Q5FBB7-5|SGO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8370 27.387 2 1346.7446 1346.7446 L K 173 185 PSM KDLTIPESSTV 1843 sp|Q49A26-4|GLYR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6012 23.194 2 1188.6238 1188.6238 E K 110 121 PSM KDLYANTVLSGGTTMYPGIAD 1844 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 15-UNIMOD:35 ms_run[2]:scan=9356 30.706 2 2202.0514 2202.0515 R R 291 312 PSM KDMGEDLECLCQIM 1845 sp|P78344-2|IF4G2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35,9-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:35 ms_run[2]:scan=7306 25.307 2 1772.7089 1772.7089 L R 245 259 PSM KDPYALDVPNTAFG 1846 sp|Q96PC5-6|MIA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8331 27.296 2 1506.7355 1506.7355 E R 462 476 PSM KDTSSSTVVSTQ 1847 sp|P31483-3|TIA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=3584 15.779 2 1238.599 1238.5990 K R 89 101 PSM KDVDGLTSINAG 1848 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5591 22.452 2 1188.5986 1188.5986 E R 122 134 PSM KDVIAINQDPLG 1849 sp|P06280|AGAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7264 25.236 2 1281.6929 1281.6929 D K 314 326 PSM KDVIELTDDSFD 1850 sp|Q15084-3|PDIA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8004 26.604 2 1395.6406 1395.6406 K K 157 169 PSM KDVSGPMPDSYSP 1851 sp|P26640|SYVC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 7-UNIMOD:35 ms_run[2]:scan=4792 20.553 2 1394.6024 1394.6024 K R 290 303 PSM KEAPETDTSPSLWDVEFA 1852 sp|Q92665|RT31_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9111 29.784 2 2020.9266 2020.9266 T K 266 284 PSM KEASGETTGVDIT 1853 sp|O75152|ZC11A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4720 20.367 2 1306.6252 1306.6252 A K 540 553 PSM KEEIDPDEEESA 1854 sp|Q14692|BMS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4458 19.473 2 1389.5783 1389.5783 V K 810 822 PSM KEEIFGPVQEIL 1855 sp|O94788-4|AL1A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9160 30.029 2 1400.7551 1400.7551 A R 319 331 PSM KEIMAEDDQVFLM 1856 sp|Q9Y6G9|DC1L1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=6999 24.784 2 1599.716 1599.7160 E K 365 378 PSM KEIPVTVVQETQ 1857 sp|Q9P0U3-2|SENP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5724 22.693 2 1369.7453 1369.7453 E K 396 408 PSM KEITALAPSTM 1858 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=5750 22.746 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 1859 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=9159 30.023 2 1176.606 1176.6060 Q K 315 326 PSM KELFPIAAQVD 1860 sp|P16219|ACADS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8148 26.874 2 1229.6656 1229.6656 E K 51 62 PSM KELLALDSVDPEG 1861 sp|O95817|BAG3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7938 26.488 2 1384.7086 1384.7086 T R 460 473 PSM KELLPVIGQNL 1862 sp|P54198-2|HIRA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8722 28.333 2 1222.7285 1222.7285 L R 781 792 PSM KELMDEEDVLQEC 1863 sp|Q5H9R7-3|PP6R3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35,13-UNIMOD:4 ms_run[2]:scan=6130 23.375 2 1652.691 1652.6910 L K 25 38 PSM KELTPLPPQEE 1864 sp|O75420|GGYF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5389 22.007 2 1279.666 1279.6660 G K 354 365 PSM KENIEGAQDATENSASSLAPGFI 1865 sp|P42684-4|ABL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8347 27.325 3 2348.1132 2348.1132 N R 553 576 PSM KEPFEDGFANGEESTPT 1866 sp|P55011-3|S12A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6687 24.26 2 1853.7956 1853.7956 E R 252 269 PSM KEPIPEEQEMDF 1867 sp|Q6Y7W6-4|GGYF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:35 ms_run[2]:scan=6055 23.258 2 1506.6548 1506.6548 Q R 308 320 PSM KEPSATPPISNLT 1868 sp|P30622-2|CLIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6081 23.303 2 1353.714 1353.7140 A K 177 190 PSM KEPSATPPISNLT 1869 sp|P30622-2|CLIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6113 23.351 2 1353.714 1353.7140 A K 177 190 PSM KETFLTSPEELY 1870 sp|O95433-2|AHSA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8367 27.378 2 1455.7133 1455.7133 L R 212 224 PSM KEVFPTAALMPGAE 1871 sp|Q08623-3|HDHD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:35 ms_run[2]:scan=7248 25.207 2 1475.733 1475.7330 L K 83 97 PSM KEVPMVVVPPVGA 1872 sp|Q9P2E9|RRBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=6732 24.337 2 1336.7425 1336.7425 P K 175 188 PSM KEVTTLTADPPDGI 1873 sp|Q16763|UBE2S_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6782 24.427 2 1455.7457 1455.7457 Y K 18 32 PSM KFPIDYPYSPPTF 1874 sp|Q712K3|UB2R2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9048 29.508 2 1570.7708 1570.7708 I R 63 76 PSM KFVVDGDTPLIENG 1875 sp|O94832|MYO1D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7716 26.045 2 1502.7617 1502.7617 L K 281 295 PSM KGEATVSFDDPPSA 1876 sp|P35637-2|FUS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5920 23.029 2 1419.6518 1419.6518 L K 333 347 PSM KGILLVGPPGTG 1877 sp|Q96TA2-3|YMEL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7501 25.648 2 1107.6652 1107.6652 P K 283 295 PSM KGSESPEMGPEVTPAP 1878 sp|P48382-2|RFX5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:35 ms_run[2]:scan=4823 20.628 2 1627.74 1627.7400 L R 141 157 PSM KGVNLPGAAVDLPAVSE 1879 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9313 30.54 2 1635.8832 1635.8832 K K 207 224 PSM KIANPVEGSTD 1880 sp|Q15366-7|PCBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4426 19.346 2 1129.5615 1129.5615 I R 275 286 PSM KIDDMTAAPMDV 1881 sp|P15927|RFA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=4772 20.499 2 1337.5843 1337.5843 Y R 93 105 PSM KIDDMTAAPMDV 1882 sp|P15927|RFA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7013 24.807 2 1305.5945 1305.5945 Y R 93 105 PSM KIELLGSYDPQ 1883 sp|P24666-3|PPAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7733 26.075 2 1261.6554 1261.6554 A K 79 90 PSM KIFDPQNPDENE 1884 sp|P46109|CRKL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5444 22.129 2 1444.647 1444.6470 V - 292 304 PSM KIGQQPQQPGAPPQQDYT 1885 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5084 21.295 3 1979.9701 1979.9701 K K 628 646 PSM KIGQQPQQPGAPPQQDYT 1886 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5038 21.181 2 1979.9701 1979.9701 K K 628 646 PSM KIIASSPEMNLPTVSAL 1887 sp|Q96C36|P5CR2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8796 28.568 2 1769.9597 1769.9597 H R 29 46 PSM KIIPQGADSTMLAT 1888 sp|P35658-2|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=5494 22.235 2 1460.7545 1460.7545 S K 1048 1062 PSM KILPTLEAVAALGN 1889 sp|Q12905|ILF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8987 29.255 2 1408.829 1408.8290 L K 127 141 PSM KILQDGGLQVVE 1890 sp|O43175|SERA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6801 24.458 2 1297.7242 1297.7242 R K 21 33 PSM KIPDVAPIVSDQ 1891 sp|P30414|NKTR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6961 24.724 2 1280.6976 1280.6976 P K 311 323 PSM KIPTEAPQLEL 1892 sp|Q5VW32-2|BROX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7791 26.19 2 1237.6918 1237.6918 Q K 302 313 PSM KIYAPQGLLLTDPIE 1893 sp|Q7Z5G4-3|GOGA7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9003 29.318 2 1669.9291 1669.9291 E R 103 118 PSM KLAEIGAPIQGN 1894 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5857 22.919 2 1209.6717 1209.6717 A R 35 47 PSM KLAEIGAPIQGN 1895 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5866 22.933 2 1209.6717 1209.6717 A R 35 47 PSM KLFEEPEDPSN 1896 sp|Q9Y2T4-3|2ABG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5695 22.639 2 1303.5932 1303.5932 S R 246 257 PSM KLGNNCVFAPADVTSE 1897 sp|Q99714-2|HCD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:4 ms_run[2]:scan=6992 24.775 2 1720.809 1720.8090 K K 53 69 PSM KLIEEVMIGED 1898 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 7-UNIMOD:35 ms_run[2]:scan=6791 24.439 2 1290.6377 1290.6377 C K 300 311 PSM KLIMAMQTLIPIDEA 1899 sp|Q8TEX9|IPO4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=8250 27.102 2 1717.8994 1717.8994 P K 205 220 PSM KLLFEGAGSNPGD 1900 sp|P61421|VA0D1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6682 24.255 2 1303.6408 1303.6408 Y K 275 288 PSM KLLMMAGIDDCYTSA 1901 sp|P15880|RS2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35,11-UNIMOD:4 ms_run[2]:scan=7870 26.346 2 1703.7569 1703.7569 K R 212 227 PSM KLLNDEDPVVVT 1902 sp|P14923|PLAK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6679 24.25 2 1340.7187 1340.7187 T K 149 161 PSM KLMIEMDGTEN 1903 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35 ms_run[2]:scan=5850 22.908 2 1295.5737 1295.5737 D K 92 103 PSM KLMIEMDGTEN 1904 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6681 24.254 2 1279.5788 1279.5788 D K 92 103 PSM KLPDYSSIEIM 1905 sp|Q14669-4|TRIPC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=7521 25.682 2 1310.6428 1310.6428 L R 1694 1705 PSM KLPQPPEGQCYSN 1906 sp|Q13404-8|UB2V1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:4 ms_run[2]:scan=5118 21.364 2 1516.698 1516.6980 M - 93 106 PSM KLPSGFDLIPPAE 1907 sp|Q5VWN6-2|TASO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8808 28.604 2 1382.7446 1382.7446 G K 238 251 PSM KLTPITYPQGLAMA 1908 sp|P63000|RAC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8341 27.313 2 1502.8167 1502.8167 K K 133 147 PSM KMFVLDEADEMLS 1909 sp|P60842-2|IF4A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 2-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=7241 25.197 2 1558.6895 1558.6895 I R 177 190 PSM KMINLSVPDTIDE 1910 sp|P13797-3|PLST_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 2-UNIMOD:35 ms_run[2]:scan=7277 25.259 2 1489.7334 1489.7334 C R 123 136 PSM KMINLSVPDTIDE 1911 sp|P13797-3|PLST_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 2-UNIMOD:35 ms_run[2]:scan=7284 25.267 2 1489.7334 1489.7334 C R 123 136 PSM KNAEPLINLDVNNPDF 1912 sp|Q9Y224|RTRAF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8859 28.785 2 1811.9054 1811.9054 T K 115 131 PSM KPDEEDEISEEL 1913 sp|P55209-2|NP1L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6835 24.515 2 1431.6253 1431.6253 W K 135 147 PSM KPEPMEEDLPEN 1914 sp|P31948-3|STIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=4495 19.612 2 1442.6235 1442.6235 T K 186 198 PSM KPIGLCCIAPVLAA 1915 sp|P0DPI2|GAL3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:4,7-UNIMOD:4 ms_run[2]:scan=8870 28.828 2 1481.8098 1481.8098 G K 171 185 PSM KPLSDDPTVSAS 1916 sp|Q969U7-2|PSMG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4387 19.203 2 1215.5983 1215.5983 L R 201 213 PSM KPLTPDQDEPPF 1917 sp|Q9Y2I7-2|FYV1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6726 24.328 2 1382.6718 1382.6718 F K 31 43 PSM KPMCVESFSDYPPLG 1918 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35,4-UNIMOD:4 ms_run[2]:scan=7802 26.211 2 1741.7691 1741.7691 G R 408 423 PSM KPMCVESFSDYPPLG 1919 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:4 ms_run[2]:scan=8455 27.611 2 1725.7742 1725.7742 G R 408 423 PSM KPMEINPEMLN 1920 sp|P09936|UCHL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=5287 21.793 2 1346.621 1346.6210 L K 4 15 PSM KPMQFLGDEETV 1921 sp|P15259|PGAM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35 ms_run[2]:scan=6389 23.781 2 1408.6544 1408.6544 T R 228 240 PSM KPQLQGIPVLVLGN 1922 sp|Q9NVJ2|ARL8B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9023 29.398 2 1474.8871 1474.8871 D K 117 131 PSM KPQVVVAPVLMS 1923 sp|Q9H074|PAIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=6538 24.025 2 1282.7319 1282.7319 A K 115 127 PSM KPQVVVAPVLMS 1924 sp|Q9H074|PAIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7674 25.963 2 1266.737 1266.7370 A K 115 127 PSM KPSLTNPFPAVEPAVV 1925 sp|Q8TEM1-2|PO210_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8762 28.458 2 1664.9138 1664.9138 N K 727 743 PSM KPVDVGGDEPEE 1926 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4297 18.846 2 1269.5725 1269.5725 V K 241 253 PSM KPVLMALAEGPGAEGP 1927 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=9545 31.348 2 1551.7967 1551.7967 T R 575 591 PSM KPVPPDTAPCEIL 1928 sp|P50748|KNTC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:4 ms_run[2]:scan=6916 24.643 2 1435.7381 1435.7381 G K 2189 2202 PSM KPVVTISDEPDILY 1929 sp|P82664|RT10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8429 27.54 2 1587.8396 1587.8396 T K 60 74 PSM KQDMPNAMPVSELTD 1930 sp|P84085|ARF5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:35 ms_run[2]:scan=5971 23.128 2 1690.7542 1690.7542 N K 127 142 PSM KQGGLGPMNIPLVSDP 1931 sp|Q06830|PRDX1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:35 ms_run[2]:scan=7752 26.106 2 1637.8447 1637.8447 K K 93 109 PSM KQLPPPPPPIPPP 1932 sp|Q7Z6E9-4|RBBP6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6358 23.737 2 1373.8071 1373.8071 R R 334 347 PSM KSEGGEDYTGATVIEPL 1933 sp|P28340|DPOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7658 25.928 2 1764.8418 1764.8418 V K 574 591 PSM KSLAMLGSSEDNTALS 1934 sp|Q13596|SNX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=5860 22.923 2 1638.7771 1638.7771 A R 349 365 PSM KSVPLSEPVTMD 1935 sp|O60306|AQR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 11-UNIMOD:35 ms_run[2]:scan=5103 21.33 2 1317.6486 1317.6486 L K 234 246 PSM KSVSGTDVQEEC 1936 sp|P49321-4|NASP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 12-UNIMOD:4 ms_run[2]:scan=3826 16.959 2 1337.5769 1337.5769 E R 179 191 PSM KTALEMVQAAGTD 1937 sp|P0DPB6|RPAC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:35 ms_run[2]:scan=5477 22.195 2 1349.6497 1349.6497 R R 24 37 PSM KTDTLEDLFPTT 1938 sp|P13010|XRCC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8837 28.7 2 1379.682 1379.6820 E K 469 481 PSM KTEEMPNDSVLEN 1939 sp|P49321-4|NASP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=4687 20.253 2 1520.6665 1520.6665 D K 425 438 PSM KTFAPEEISAMVLT 1940 sp|P11021|BIP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8995 29.287 2 1535.7905 1535.7905 T K 138 152 PSM KTGEEIFGTIGM 1941 sp|Q99873-2|ANM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 12-UNIMOD:35 ms_run[2]:scan=7476 25.604 2 1297.6224 1297.6224 V R 302 314 PSM KTGQEVVFVAEPDN 1942 sp|P04844-2|RPN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6309 23.663 2 1531.7518 1531.7518 Q K 410 424 PSM KTIGDLSTLTASEI 1943 sp|Q5UIP0-2|RIF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8399 27.449 2 1447.777 1447.7770 I K 2302 2316 PSM KTMLESAGGLIQTA 1944 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35 ms_run[2]:scan=6528 24.011 2 1434.7388 1434.7388 A R 1604 1618 PSM KTNCNVAVINVGAPAAGMNAAV 1945 sp|Q01813-2|PFKAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:4,18-UNIMOD:35 ms_run[2]:scan=6806 24.466 3 2157.0671 2157.0671 P R 400 422 PSM KTPEGCTEIQLPAEV 1946 sp|Q7Z6J8|UBE3D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 6-UNIMOD:4 ms_run[2]:scan=7684 25.983 2 1670.8185 1670.8185 M R 47 62 PSM KTPQQEETTYYQTALPGND 1947 sp|Q9UHP3|UBP25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6442 23.866 3 2183.0019 2183.0019 A R 60 79 PSM KTPVEEVPAAIAPFQG 1948 sp|Q15393|SF3B3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8268 27.138 2 1652.8774 1652.8774 H R 942 958 PSM KTVALDGTLFQ 1949 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7765 26.136 2 1191.6499 1191.6499 H K 637 648 PSM KTVEQTATTTN 1950 sp|P08579|RU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=3540 15.569 2 1192.5935 1192.5935 A K 111 122 PSM KTVPQSSLTMGQLYE 1951 sp|P60520|GBRL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 10-UNIMOD:35 ms_run[2]:scan=6038 23.233 2 1696.8342 1696.8342 D K 82 97 PSM KTVTNAVVTVPAYFNDSQ 1952 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=9888 32.568 2 1952.9844 1952.9844 G R 137 155 PSM KVAGQDGSVVQF 1953 sp|P61956-2|SUMO2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6382 23.772 2 1233.6354 1233.6354 L K 21 33 PSM KVATPLPDPMAS 1954 sp|Q14126|DSG2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6769 24.407 2 1225.6377 1225.6377 Q R 919 931 PSM KVELTPVAIQAG 1955 sp|Q16881-7|TRXR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6813 24.481 2 1224.7078 1224.7078 D R 301 313 PSM KVELVPPTPAEIP 1956 sp|O75964|ATP5L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8115 26.811 2 1388.7915 1388.7915 A R 35 48 PSM KVGEATETALTCLVE 1957 sp|P16615-5|AT2A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 12-UNIMOD:4 ms_run[2]:scan=8105 26.796 2 1619.8076 1619.8076 E K 436 451 PSM KVIILGDSGVG 1958 sp|P51149|RAB7A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6716 24.309 2 1056.6179 1056.6179 L K 10 21 PSM KVLGMDPLPQMSQ 1959 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 5-UNIMOD:35 ms_run[2]:scan=6828 24.503 2 1458.7211 1458.7211 H R 1028 1041 PSM KVLIEDTDDEANT 1960 sp|Q9UBH6-2|XPR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5110 21.347 2 1461.6835 1461.6835 T - 619 632 PSM KVLQATVVAVGSGS 1961 sp|P61604|CH10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5777 22.789 2 1314.7507 1314.7507 G K 40 54 PSM KVLQPTVFPVVP 1962 sp|P33121-2|ACSL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8706 28.288 2 1322.7962 1322.7962 L R 356 368 PSM KVPDSTYEMIGGLD 1963 sp|P62195-2|PRS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 9-UNIMOD:35 ms_run[2]:scan=6956 24.715 2 1539.7127 1539.7127 E K 134 148 PSM KVPGVTDCVAEIQ 1964 sp|Q12830-4|BPTF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:4 ms_run[2]:scan=6320 23.676 2 1414.7126 1414.7126 H K 438 451 PSM KVSAPGVLTAQD 1965 sp|Q9C0C2|TB182_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5395 22.018 2 1184.6401 1184.6401 S R 811 823 PSM KVSLPPIPAVSNI 1966 sp|Q9NZ09-2|UBAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8828 28.67 2 1333.7969 1333.7969 S K 251 264 PSM PEPAKSAPAP 1967 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=3727 16.475 2 963.50255 963.5025 M K 2 12 PSM PEPTKSAPAP 1968 sp|P58876|H2B1D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=3760 16.632 2 993.51311 993.5131 M K 2 12 PSM RALEEPGPAADPTAFQGPWA 1969 sp|Q86Y56-2|DAAF5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8666 28.172 3 2080.0014 2080.0014 R R 55 75 PSM RAPEEELPPLDPEEI 1970 sp|Q8IY67-3|RAVR1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8577 27.941 2 1732.8519 1732.8519 R R 30 45 PSM RDLEDPGIDPSVV 1971 sp|Q03001-8|DYST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7252 25.212 2 1410.6991 1410.6991 I K 3770 3783 PSM RDLPDGPDAPAD 1972 sp|O95721|SNP29_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4757 20.459 2 1237.5575 1237.5575 A R 29 41 PSM RDPEEADYCIQTLDG 1973 sp|O43719|HTSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 9-UNIMOD:4 ms_run[2]:scan=6948 24.7 2 1780.7574 1780.7574 F R 320 335 PSM RDPTDALSYMTIQQ 1974 sp|Q96SI9-2|STRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8357 27.356 2 1637.7719 1637.7719 E K 275 289 PSM RDYMDTLPPTVGDDVG 1975 sp|Q16630-3|CPSF6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35 ms_run[2]:scan=7567 25.765 2 1765.7829 1765.7829 D K 50 66 PSM REDLVVAPAGITL 1976 sp|P12268|IMDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=8806 28.601 2 1352.7664 1352.7664 K K 182 195 PSM RELPAAVAPAGPASLA 1977 sp|O95336|6PGL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6934 24.677 2 1489.8253 1489.8253 A R 56 72 PSM RGLIPSSPQNEPTASVPPESDVY 1978 sp|Q53GG5-2|PDLI3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7542 25.718 3 2439.1918 2439.1918 L R 164 187 PSM RLMTDTINEPILLC 1979 sp|O43776|SYNC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 14-UNIMOD:4 ms_run[2]:scan=8804 28.597 2 1687.8637 1687.8637 E R 425 439 PSM RMDTPEDQDLPPCPEDIA 1980 sp|Q9ULV3-5|CIZ1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 2-UNIMOD:35,13-UNIMOD:4 ms_run[2]:scan=6797 24.45 2 2113.8932 2113.8932 P K 121 139 PSM RPAMEPGNGSLDLGGDSAG 1981 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=6340 23.708 2 1799.8108 1799.8108 G R 50 69 PSM RPGFTSLPGSTMTPPPSGPNPYA 1982 sp|Q92734-2|TFG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 12-UNIMOD:35 ms_run[2]:scan=7243 25.201 3 2344.1158 2344.1158 P R 356 379 PSM RPNQTEEGTTPPIEADTLDSSDAQGGLEP 1983 sp|Q8WXH0|SYNE2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=7552 25.74 3 3024.3796 3024.3796 L R 4197 4226 PSM RPPEAVAAAPAGTTSS 1984 sp|Q96JP5-2|ZFP91_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4357 19.071 2 1481.7474 1481.7474 Q R 32 48 PSM RSAMDSPVPASMFAPEPSSPGAA 1985 sp|O00178|GTPB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 4-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=6424 23.836 3 2291.0198 2291.0198 S R 7 30 PSM RSLLVNPEGPTLM 1986 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 13-UNIMOD:35 ms_run[2]:scan=7204 25.132 2 1441.7599 1441.7599 L R 2220 2233 PSM RSPLGEAPPGTPPC 1987 sp|Q96B54|ZN428_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 14-UNIMOD:4 ms_run[2]:scan=5431 22.106 2 1434.6925 1434.6925 G R 98 112 PSM RSVATGPMTPQAAAPPAFPEV 1988 sp|Q7Z2K8|GRIN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 8-UNIMOD:35 ms_run[2]:scan=7797 26.201 3 2110.0517 2110.0517 T R 869 890 PSM RTVFVGNLPVTCN 1989 sp|P42696-2|RBM34_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 12-UNIMOD:4 ms_run[2]:scan=7457 25.564 2 1475.7555 1475.7555 E K 185 198 PSM RVPTANVSVVDLTC 1990 sp|P04406-2|G3P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 14-UNIMOD:4 ms_run[2]:scan=7352 25.396 2 1529.7872 1529.7872 F R 192 206 PSM KIGQQPQQPGAPPQQDYT 1991 sp|Q92945|FUBP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=5037 21.179483166933334 2 1979.970257 1979.970104 K K 628 646 PSM KPGNPPAEIGQNISSNSSASILES 1992 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=7218 25.1572791384 3 2396.182859 2396.181947 Y K 800 824 PSM KTVTNAVVTVPAYFNDSQ 1993 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=9972 32.876242208 2 1953.988631 1952.984357 G R 137 155 PSM KVALVYGQMNEPPGA 1994 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=6712 24.302478608 2 1572.7987 1572.7965 S R 264 279 PSM KDMYNDTLNGSTE 1995 sp|Q96PU8|QKI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:35 ms_run[1]:scan=4589 19.936841184266665 2 1503.603969 1502.619503 R K 54 67 PSM KAEPPQAMNALM 1996 sp|Q12906|ILF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 8-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=4454 19.45686541706667 2 1332.618461 1331.621358 E R 396 408 PSM KEITALAPSTM 1997 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:35 ms_run[1]:scan=9501 31.206615877866668 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 1998 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:35 ms_run[1]:scan=9601 31.546813587466666 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 1999 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:35 ms_run[1]:scan=9697 31.885492842933335 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 2000 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:35 ms_run[1]:scan=6050 23.250485613333336 2 1176.606017 1176.606025 Q K 317 328 PSM KDAGVIAGLNVL 2001 sp|P0DMV8|HS71A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=8748 28.406468096799998 2 1168.681667 1168.681573 T R 159 171 PSM KVIVVGNPANTNCLTAS 2002 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 13-UNIMOD:4 ms_run[1]:scan=6058 23.261540075733333 2 1756.914434 1756.914169 V K 125 142 PSM KMVGVPAALDMMLTG 2003 sp|P40939|ECHA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 2-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=8347 27.324508503466667 2 1564.777891 1564.766308 P R 190 205 PSM KAENNSEVGASGYGVPGPTWD 2004 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=7565 25.760577424799997 2 2134.945037 2133.960327 L R 120 141 PSM KSVTEQGAELSNEE 2005 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=4501 19.626728806666666 2 1520.684574 1519.700196 M R 27 41 PSM KAVTEQGAELSNEE 2006 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=4432 19.36864714693333 2 1504.688777 1503.705282 M R 27 41 PSM KPAAVVAPITTGYTV 2007 sp|Q9HB71|CYBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=7427 25.519076809333335 2 1486.838568 1486.839531 E K 59 74 PSM KIDGATQSSPAEP 2008 sp|Q32MZ4|LRRF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=4128 18.1946673824 2 1300.627112 1299.630660 A K 706 719 PSM KLSLPQNETVADTTLT 2009 sp|Q9HC35|EMAL4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=7124 24.9823845792 2 1729.901013 1729.909795 E K 867 883 PSM RVGLIGSCTNSSYEDMG 2010 sp|Q99798|ACON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 8-UNIMOD:4,16-UNIMOD:35 ms_run[1]:scan=6153 23.413368222933332 2 1861.784224 1860.798213 I R 378 395 PSM KAMQGTEVGQTDQTDSTGGPAFLS 2011 sp|Q5JRA6|TGO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 3-UNIMOD:35 ms_run[1]:scan=6515 23.991664235466665 3 2441.101380 2441.101649 H K 695 719 PSM KQTAEETGLTPLETS 2012 sp|Q13042|CDC16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 27 ms_run[1]:scan=5964 23.116461546933333 2 1603.7642 1603.7932 E R 572 587 PSM RPGMVVTFAPVNITTEV 2013 sp|Q05639|EF1A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 4-UNIMOD:35 ms_run[1]:scan=8821 28.643322694666665 2 1845.971530 1845.965871 L K 273 290 PSM KLVDEDFPEDSSSQ 2014 sp|A6NDU8|CE051_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=6208 23.504309941866666 2 1594.699702 1594.699862 N K 81 95 PSM KPVVEMDGDEMT 2015 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 6-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=3807 16.86664920853333 2 1381.573579 1381.574133 A R 48 60 PSM RTPPVPDSGSANGSFFAPS 2016 sp|Q9NPA3|M1IP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=7166 25.060065244 2 1889.882761 1889.890791 E R 66 85 PSM KEAELPLLDLM 2017 sp|Q96L91|EP400_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 11-UNIMOD:35 ms_run[1]:scan=9037 29.462794346666666 2 1286.680838 1286.679190 A K 977 988 PSM KSLDIQVPNFPADET 2018 sp|P47897|SYQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=8353 27.34208349733333 2 1672.848386 1672.830816 A K 586 601 PSM KPAPPPAPPQAT 2019 sp|Q86VM9|ZCH18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=4162 18.331718512800002 2 1170.639517 1170.639708 K K 639 651 PSM KVEQNSEPCAGSSSESDLQTVF 2020 sp|Q8N806|UBR7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 9-UNIMOD:4 ms_run[1]:scan=7467 25.587360036266666 3 2398.059375 2398.059449 V K 252 274 PSM KINMNGINNSSGMVDA 2021 sp|Q15819|UB2V2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 4-UNIMOD:35,13-UNIMOD:35 ms_run[1]:scan=4526 19.720467613333334 2 1696.739276 1695.755620 T R 85 101 PSM KSDDSVIQLLNPN 2022 sp|Q9BY67|CADM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 ms_run[1]:scan=8567 27.90798588426667 2 1443.720352 1441.741273 N R 68 81 PSM AADKGPAAGP 2023 sp|Q8TDD1|DDX54_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3506 15.435 2 853.42938 853.4294 M R 2 12 PSM GCLGNSKTEDQ 2024 sp|P63092-3|GNAS2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 2-UNIMOD:4 ms_run[2]:scan=3481 15.334 2 1207.5139 1207.5139 M R 2 13 PSM KADEASELACPTP 2025 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4 ms_run[2]:scan=5245 21.685 2 1387.6289 1387.6289 S K 2193 2206 PSM KADLINNLGTIA 2026 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8562 27.893 2 1241.698 1241.6980 T K 95 107 PSM KAELPPGPGAVG 2027 sp|Q9UI10-3|EI2BD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5151 21.443 2 1091.5975 1091.5975 M R 17 29 PSM KAEPLLGAPGELL 2028 sp|P17482|HXB9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8830 28.676 2 1306.7497 1306.7497 V K 117 130 PSM KAFDDVPVVQIYSS 2029 sp|Q7Z460-2|CLAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8456 27.614 2 1566.793 1566.7930 I R 304 318 PSM KALDVSASDDEIA 2030 sp|P13798|ACPH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5660 22.575 2 1332.6409 1332.6409 T R 180 193 PSM KALVTLSSGDM 2031 sp|P40937-2|RFC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:35 ms_run[2]:scan=5449 22.137 2 1136.5747 1136.5747 M R 182 193 PSM KAPVPTGEVYFADSFD 2032 sp|P27824|CALX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8572 27.924 2 1741.8199 1741.8199 Y R 61 77 PSM KAVAGNISDPGLQ 2033 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5202 21.554 2 1268.6725 1268.6725 A K 802 815 PSM KAVEYFQDNSPDSPELN 2034 sp|Q9UPT5-4|EXOC7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6628 24.165 3 1951.88 1951.8800 Q K 121 138 PSM KDAGTIAGLNVL 2035 sp|P11142-2|HSP7C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8345 27.32 2 1170.6608 1170.6608 T R 159 171 PSM KDATNVGDEGGFAPNILEN 2036 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9898 32.604 2 1959.9174 1959.9174 G K 202 221 PSM KDATNVGDEGGFAPNILEN 2037 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9806 32.269 2 1959.9174 1959.9174 G K 202 221 PSM KDDGDPPLLYDE 2038 sp|O14730-2|RIOK3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7034 24.848 2 1375.6143 1375.6143 L - 505 517 PSM KDEEMIGPIID 2039 sp|Q9NTK5-3|OLA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 5-UNIMOD:35 ms_run[2]:scan=6635 24.174 2 1274.6064 1274.6064 L K 155 166 PSM KDEPDTNLVALM 2040 sp|O95433-2|AHSA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:35 ms_run[2]:scan=6558 24.051 2 1360.6544 1360.6544 A K 125 137 PSM KDFAPVIVEAF 2041 sp|Q96P16-3|RPR1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9057 29.545 2 1234.6598 1234.6598 T K 43 54 PSM KDFLAGGVAAAIS 2042 sp|P05141|ADT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8202 27 2 1218.6608 1218.6608 A K 10 23 PSM KDIAGSGDGTQEVS 2043 sp|Q9NWH9|SLTM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3893 17.264 2 1362.6263 1362.6263 E K 196 210 PSM KDIPGLTDTTVP 2044 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7053 24.876 2 1255.666 1255.6660 E R 119 131 PSM KDIPGLTDTTVP 2045 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7296 25.289 2 1255.666 1255.6660 E R 119 131 PSM KDLEPGPSGTS 2046 sp|Q92797-2|SYMPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3898 17.282 2 1086.5193 1086.5193 D K 373 384 PSM KDLLEVADVLE 2047 sp|Q9HAV7|GRPE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9077 29.637 2 1242.6707 1242.6707 C K 109 120 PSM KDLPDVQELITQV 2048 sp|Q9UHB9-3|SRP68_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9202 30.225 2 1496.8086 1496.8086 L R 169 182 PSM KDLYANTVLSGGTTMYPGIAD 2049 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 15-UNIMOD:35 ms_run[2]:scan=9466 31.085 2 2202.0514 2202.0515 R R 291 312 PSM KDMFQETMEAM 2050 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4294 18.834 2 1407.5356 1407.5356 D R 316 327 PSM KDMQPSMESDMALV 2051 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=6104 23.339 2 1612.6783 1612.6783 A K 290 304 PSM KDPDDVVPVGQ 2052 sp|Q9Y287-2|ITM2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5162 21.465 2 1167.5772 1167.5772 C R 39 50 PSM KDPQGPGPGLEAFVSAA 2053 sp|O60287|NPA1P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8750 28.41 2 1639.8206 1639.8206 L K 40 57 PSM KDQLLLGPTYATP 2054 sp|P55084-2|ECHB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7847 26.3 2 1415.766 1415.7660 P K 326 339 PSM KDSYVGDEAQS 2055 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3849 17.083 2 1197.515 1197.5150 Q K 50 61 PSM KDTTEVPSSTVE 2056 sp|O15164-2|TIF1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4310 18.891 2 1291.6143 1291.6143 V K 146 158 PSM KDVNSSSPVMLAF 2057 sp|Q99598|TSNAX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8755 28.431 2 1393.6912 1393.6912 G K 27 40 PSM KEAPEPGMEVV 2058 sp|O15067|PUR4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 8-UNIMOD:35 ms_run[2]:scan=4728 20.392 2 1200.5696 1200.5696 S K 440 451 PSM KEDPDMASAVAAI 2059 sp|Q14232-2|EI2BA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 6-UNIMOD:35 ms_run[2]:scan=5733 22.708 2 1332.6231 1332.6231 M R 15 28 PSM KEDPDMASAVAAI 2060 sp|Q14232-2|EI2BA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7518 25.679 2 1316.6282 1316.6282 M R 15 28 PSM KEEEELFPESE 2061 sp|Q9UHX1-4|PUF60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6537 24.023 2 1364.5984 1364.5984 E R 359 370 PSM KEEPVSSGPEEAVG 2062 sp|O00567|NOP56_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4466 19.503 2 1413.6624 1413.6624 S K 564 578 PSM KEGIPALDNFLD 2063 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9132 29.894 2 1330.6769 1330.6769 L K 845 857 PSM KEGLELPEDEEE 2064 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6074 23.291 2 1415.6304 1415.6304 T K 538 550 PSM KEIEIDIEPTD 2065 sp|Q15843|NEDD8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6954 24.711 2 1300.6398 1300.6398 G K 11 22 PSM KEIISSASVVGL 2066 sp|Q86VP6-2|CAND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7775 26.154 2 1201.6918 1201.6918 L K 746 758 PSM KEITALAPSTM 2067 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:35 ms_run[2]:scan=5558 22.374 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 2068 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:35 ms_run[2]:scan=6299 23.652 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 2069 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:35 ms_run[2]:scan=6322 23.679 2 1176.606 1176.6060 Q K 315 326 PSM KEITALAPSTM 2070 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6305 23.659 2 1160.6111 1160.6111 Q K 315 326 PSM KELEDLEVDGQ 2071 sp|Q08J23|NSUN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5847 22.905 2 1273.6038 1273.6038 F K 100 111 PSM KELIPTEEAL 2072 sp|Q15149-7|PLEC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7178 25.081 2 1141.6231 1141.6231 K R 3756 3766 PSM KELLITDLLPDN 2073 sp|Q03701|CEBPZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9211 30.267 2 1382.7657 1382.7657 F R 290 302 PSM KEPVSLPGIM 2074 sp|Q8WWI1-3|LMO7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:35 ms_run[2]:scan=6873 24.571 2 1085.5791 1085.5791 N R 1162 1172 PSM KETIDAVPNAIPG 2075 sp|O43670-2|ZN207_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6379 23.768 2 1323.7034 1323.7034 H R 59 72 PSM KEVDEQMLNVQN 2076 sp|P68371|TBB4B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 7-UNIMOD:35 ms_run[2]:scan=4552 19.824 2 1461.677 1461.6770 M K 324 336 PSM KEVDEQMLSVQS 2077 sp|P04350|TBB4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 7-UNIMOD:35 ms_run[2]:scan=4809 20.592 2 1407.6552 1407.6552 M K 324 336 PSM KEVEPEPTED 2078 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3827 16.962 2 1171.5245 1171.5245 T K 42 52 PSM KEVTPEGLQMV 2079 sp|P22234|PUR6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7000 24.786 2 1229.6326 1229.6326 L K 235 246 PSM KEYQEPEVPESNQ 2080 sp|P33981-2|TTK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4789 20.542 2 1575.7053 1575.7053 T K 372 385 PSM KEYTSDDMNVAPED 2081 sp|Q9Y6D6|BIG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 8-UNIMOD:35 ms_run[2]:scan=4272 18.743 2 1628.6512 1628.6512 F R 1362 1376 PSM KFIQPNIGELPTAL 2082 sp|Q14008-2|CKAP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8954 29.121 2 1539.8661 1539.8661 A K 892 906 PSM KGPIVPLNVADQ 2083 sp|P55011-3|S12A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6802 24.46 2 1249.703 1249.7030 S K 979 991 PSM KIAPAEGPDVSE 2084 sp|Q9Y6M1-5|IF2B2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4624 20.058 2 1211.6034 1211.6034 I R 356 368 PSM KIDDMTAAPMDV 2085 sp|P15927|RFA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:35 ms_run[2]:scan=5716 22.676 2 1321.5894 1321.5894 Y R 93 105 PSM KIIMPPSALDQLS 2086 sp|Q92890-3|UFD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8281 27.164 2 1411.7745 1411.7745 G R 45 58 PSM KILDILGETC 2087 sp|Q15424-2|SAFB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4 ms_run[2]:scan=8439 27.57 2 1160.6111 1160.6111 E K 147 157 PSM KILITTVPPNL 2088 sp|Q12905|ILF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8101 26.788 2 1207.754 1207.7540 V R 174 185 PSM KILITTVPPNL 2089 sp|Q12905|ILF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8667 28.175 2 1207.754 1207.7540 V R 174 185 PSM KILLTEPPMNPT 2090 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 9-UNIMOD:35 ms_run[2]:scan=6086 23.311 2 1368.7323 1368.7323 C K 106 118 PSM KILTPLVSLDTPG 2091 sp|Q9HC38-2|GLOD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8561 27.891 2 1352.7915 1352.7915 Q K 224 237 PSM KLGDEDEEIDGDTN 2092 sp|P09884|DPOLA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4893 20.83 2 1548.6427 1548.6427 Q K 815 829 PSM KLGPQASSQVVMPPLV 2093 sp|Q86YP4-2|P66A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8419 27.513 2 1649.9175 1649.9175 S R 233 249 PSM KLIPGPLSPVA 2094 sp|P48634-2|PRC2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7682 25.981 2 1090.675 1090.6750 E R 1199 1210 PSM KLLSSEDIEGM 2095 sp|P53582|MAP11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:35 ms_run[2]:scan=5651 22.56 2 1236.5908 1236.5908 I R 129 140 PSM KLMIEMDGTEN 2096 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=4695 20.278 2 1311.5687 1311.5687 D K 92 103 PSM KLQLDSPEDAEFIVA 2097 sp|O43242-2|PSMD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8732 28.355 2 1673.8512 1673.8512 Q K 287 302 PSM KLTLDTIFVPNTG 2098 sp|Q9Y277|VDAC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8927 29.031 2 1417.7817 1417.7817 L K 96 109 PSM KLVLVGDGGTG 2099 sp|P62826|RAN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5788 22.808 2 1014.571 1014.5710 F K 12 23 PSM KMDSTEPPYSQ 2100 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 2-UNIMOD:35 ms_run[2]:scan=4074 17.969 2 1297.5496 1297.5496 N K 154 165 PSM KMVPFQVPEIL 2101 sp|Q7L2E3-2|DHX30_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 2-UNIMOD:35 ms_run[2]:scan=9050 29.517 2 1315.721 1315.7210 E R 830 841 PSM KNEPLSLPELT 2102 sp|Q8TEQ6|GEMI5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8195 26.988 2 1239.6711 1239.6711 E K 1425 1436 PSM KNIDINDVTPNC 2103 sp|P62195-2|PRS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:4 ms_run[2]:scan=5702 22.652 2 1401.6558 1401.6558 D R 93 105 PSM KNLDDGIDDE 2104 sp|P11940-2|PABP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4354 19.058 2 1132.4884 1132.4884 V R 299 309 PSM KNLVPGESVYGE 2105 sp|P22087|FBRL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5965 23.119 2 1290.6456 1290.6456 T K 109 121 PSM KNPEQEPIPIVL 2106 sp|Q07960|RHG01_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8607 28.028 2 1375.7711 1375.7711 E R 252 264 PSM KNPLPPSVGVVD 2107 sp|Q8NC51-4|PAIRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6110 23.348 2 1220.6765 1220.6765 R K 79 91 PSM KPATSGPSSAVVPNTSS 2108 sp|O43314-2|VIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4493 19.602 2 1585.7948 1585.7948 S R 1184 1201 PSM KPDMLSEYPIVDG 2109 sp|Q01581|HMCS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:35 ms_run[2]:scan=6969 24.738 2 1478.6963 1478.6963 Y K 206 219 PSM KPDTTAPPSSP 2110 sp|P27824|CALX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3787 16.763 2 1096.5401 1096.5401 S K 46 57 PSM KPFCVILPEIQ 2111 sp|P61619|S61A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:4 ms_run[2]:scan=8948 29.1 2 1342.7319 1342.7319 I K 10 21 PSM KPGDLGVDLTS 2112 sp|P38117|ETFB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6371 23.758 2 1100.5714 1100.5714 I K 210 221 PSM KPLEEPAPTYCPE 2113 sp|Q8IY37|DHX37_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:4 ms_run[2]:scan=5425 22.095 2 1529.7072 1529.7072 D R 1016 1029 PSM KPLIQEESDTIVSSS 2114 sp|Q12830-4|BPTF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6604 24.122 2 1631.8254 1631.8254 K K 1361 1376 PSM KPLLPIPITQ 2115 sp|Q14119|VEZF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8498 27.728 2 1118.7063 1118.7063 Q K 41 51 PSM KPLMLSQPPDNGIIL 2116 sp|Q9H082|RB33B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:35 ms_run[2]:scan=8514 27.778 2 1650.9015 1650.9015 H K 203 218 PSM KPLVTIPAPTST 2117 sp|Q70E73|RAPH1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6740 24.35 2 1223.7125 1223.7125 P K 780 792 PSM KPMEINPEMLN 2118 sp|P09936|UCHL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 9-UNIMOD:35 ms_run[2]:scan=6181 23.456 2 1330.6261 1330.6261 L K 4 15 PSM KPMSLASGLVPAAPP 2119 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35 ms_run[2]:scan=7302 25.3 2 1450.7854 1450.7854 K K 739 754 PSM KPQDSGSSANEQAVQ 2120 sp|Q15370|ELOB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3444 15.228 2 1544.7067 1544.7067 M - 104 119 PSM KPVGSLAGIGEVLG 2121 sp|O75531|BAF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8472 27.656 2 1295.7449 1295.7449 E K 18 32 PSM KPVPPDTAPCEIL 2122 sp|P50748|KNTC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4 ms_run[2]:scan=6883 24.588 2 1435.7381 1435.7381 G K 2189 2202 PSM KPVVGIIYPPPEV 2123 sp|Q15459|SF3A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8282 27.166 2 1406.8173 1406.8173 S R 37 50 PSM KQQPPEPEWIGDGESTSPSD 2124 sp|Q8NE71-2|ABCF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6782 24.427 3 2182.9655 2182.9655 P K 6 26 PSM KSAPWNSFLPPPPPMPGP 2125 sp|Q16637-4|SMN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 15-UNIMOD:35 ms_run[2]:scan=9037 29.463 3 1931.9604 1931.9604 P R 186 204 PSM KSDDSVIQLLNPN 2126 sp|Q9BY67-2|CADM1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8579 27.947 2 1441.7413 1441.7413 N R 68 81 PSM KSEPPYPQEMSALA 2127 sp|O75582-2|KS6A5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:35 ms_run[2]:scan=5434 22.111 2 1562.7287 1562.7287 L K 273 287 PSM KSIAVAEAACPGITD 2128 sp|Q9P289-2|STK26_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4 ms_run[2]:scan=5822 22.867 2 1501.7446 1501.7446 E K 306 321 PSM KSILFVPTSAP 2129 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8022 26.634 2 1158.6649 1158.6649 F R 384 395 PSM KSIMGLEGEDEGAISMLSDNTA 2130 sp|Q8WVM8-2|SCFD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:35,16-UNIMOD:35 ms_run[2]:scan=7587 25.797 3 2299.0196 2299.0196 L K 267 289 PSM KSSDQPLTVPVSP 2131 sp|Q9ULW0|TPX2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6328 23.686 2 1353.714 1353.7140 I K 727 740 PSM KSSIDSEPALVLGPL 2132 sp|Q5JPE7-3|NOMO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8982 29.231 2 1524.8399 1524.8399 I K 518 533 PSM KSTCPSAAPSASAPAMTTVEN 2133 sp|Q69YQ0-2|CYTSA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:4,16-UNIMOD:35 ms_run[2]:scan=4333 18.977 3 2092.9405 2092.9405 K K 76 97 PSM KSTNGDTFLGGEDFDQALL 2134 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9187 30.151 2 2026.9484 2026.9484 V R 265 284 PSM KSTSTPTSPGP 2135 sp|Q8WWM7-6|ATX2L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3613 15.92 2 1058.5244 1058.5244 N R 677 688 PSM KTAGPQSQVLCGVVMD 2136 sp|P35611-2|ADDA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 11-UNIMOD:4,15-UNIMOD:35 ms_run[2]:scan=6331 23.69 2 1704.8175 1704.8175 I R 515 531 PSM KTDFFIGGEEGMAE 2137 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:35 ms_run[2]:scan=7276 25.258 2 1545.6657 1545.6657 R K 39 53 PSM KTDLVPAFQNLM 2138 sp|P30153|2AAA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:35 ms_run[2]:scan=8216 27.03 2 1391.7119 1391.7119 T K 280 292 PSM KTDPSTLTEEEVS 2139 sp|Q6UB35|C1TM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5085 21.296 2 1434.6726 1434.6726 N K 547 560 PSM KTEIMSPLYQDEAP 2140 sp|Q8IY81|SPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 5-UNIMOD:35 ms_run[2]:scan=6550 24.04 2 1636.7654 1636.7654 L K 579 593 PSM KTETEFPDEDEET 2141 sp|Q96EV2|RBM33_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5153 21.448 2 1568.6366 1568.6366 A R 775 788 PSM KTGDLGDINAEQLPG 2142 sp|Q9Y263|PLAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6870 24.567 2 1526.7577 1526.7577 S R 325 340 PSM KTGMILLAGEITS 2143 sp|P31153|METK2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 4-UNIMOD:35 ms_run[2]:scan=7341 25.38 2 1348.7272 1348.7272 A R 61 74 PSM KTGSPGSPGAGGVQSTA 2144 sp|O43237-2|DC1L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3821 16.937 2 1457.711 1457.7110 K K 363 380 PSM KTIPIDGDFFSYT 2145 sp|P05091-2|ALDH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8864 28.809 2 1502.7293 1502.7293 G R 112 125 PSM KTISTSDPAEVLV 2146 sp|Q86UE4|LYRIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7198 25.122 2 1358.7293 1358.7293 L K 491 504 PSM KTLPGGNQCIVPIC 2147 sp|P35555|FBN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 9-UNIMOD:4,14-UNIMOD:4 ms_run[2]:scan=6872 24.569 2 1555.7851 1555.7851 W R 72 86 PSM KTMDLPFLEASTL 2148 sp|P19174|PLCG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35 ms_run[2]:scan=9072 29.614 2 1480.7483 1480.7483 Q R 226 239 PSM KTMYPAPVTSSVYLS 2149 sp|O95163|ELP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 3-UNIMOD:35 ms_run[2]:scan=6972 24.743 2 1658.8226 1658.8226 T R 794 809 PSM KTPVAPAQNGIQPPISNS 2150 sp|Q8NG68|TTL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5620 22.5 3 1817.9636 1817.9636 L R 106 124 PSM KTQVLSPDSLFTA 2151 sp|P55196-1|AFAD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8621 28.061 2 1405.7453 1405.7453 L K 1699 1712 PSM KTVDIDDAQILP 2152 sp|Q6GYQ0-4|RGPA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7883 26.372 2 1326.7031 1326.7031 Q R 753 765 PSM KTVFSPTLPAA 2153 sp|Q7Z2W4-3|ZCCHV_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7117 24.972 2 1130.6336 1130.6336 R R 374 385 PSM KTVGVEPAADG 2154 sp|P46779-4|RL28_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=3991 17.643 2 1042.5295 1042.5295 R K 47 58 PSM KTVTNAVVTVPAYFNDSQ 2155 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=9910 32.648 2 1952.9844 1952.9844 G R 137 155 PSM KTVVLPPIVAS 2156 sp|O75152|ZC11A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7493 25.63 2 1122.7012 1122.7012 K R 442 453 PSM KVASPDAVTTITSS 2157 sp|Q9NUL7|DDX28_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5482 22.204 2 1375.7195 1375.7195 N K 343 357 PSM KVDNSSLTGESEPQT 2158 sp|P05023-3|AT1A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4579 19.91 2 1590.7373 1590.7373 C R 181 196 PSM KVDSPTVTTTL 2159 sp|Q07866-8|KLC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5778 22.792 2 1160.6289 1160.6289 C K 457 468 PSM KVGDDVEFEVSSD 2160 sp|O75534-2|CSDE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6373 23.762 2 1424.6307 1424.6307 L R 64 77 PSM KVGINYQPPTVVPGGDLA 2161 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7889 26.385 2 1823.9781 1823.9781 F K 352 370 PSM KVGTSFSIPVVSDV 2162 sp|Q92979|NEP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8797 28.572 2 1433.7766 1433.7766 M R 173 187 PSM KVLEMDPLPSS 2163 sp|Q96SI9-2|STRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 5-UNIMOD:35 ms_run[2]:scan=5605 22.475 2 1230.6166 1230.6166 Y K 310 321 PSM KVLETEAVDQPDVVQ 2164 sp|Q5TH69|BIG3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5814 22.851 2 1668.857 1668.8570 S R 550 565 PSM KVLLSPDYLPAM 2165 sp|Q7Z6Z7-2|HUWE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8887 28.89 2 1345.7316 1345.7316 F R 632 644 PSM KVLPGVDALSNI 2166 sp|P00558-2|PGK1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8430 27.543 2 1224.7078 1224.7078 G - 378 390 PSM KVLTLSDDLE 2167 sp|P55010|IF5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6695 24.272 2 1131.6023 1131.6023 A R 224 234 PSM KVPEESVLPLVQ 2168 sp|Q9UKV3-5|ACINU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8076 26.744 2 1336.7602 1336.7602 E K 494 506 PSM KVVLIGDSGVG 2169 sp|P62491-2|RB11A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6284 23.621 2 1042.6023 1042.6023 F K 13 24 PSM KVVPNPFSESGGDM 2170 sp|P49916-4|DNLI3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 14-UNIMOD:35 ms_run[2]:scan=6427 23.84 2 1478.6711 1478.6711 G K 34 48 PSM KYPDLYPQEDEDEEEE 2171 sp|Q8N4Q1|MIA40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=6476 23.921 2 2026.8167 2026.8167 Q R 100 116 PSM RAAAPQAWAGPMEEPPQAQAPP 2172 sp|Q16643|DREB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:35 ms_run[2]:scan=6266 23.59 3 2286.0851 2286.0852 T R 390 412 PSM RDPSASPGDAGEQAI 2173 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4852 20.702 2 1469.6746 1469.6746 L R 285 300 PSM REEFGAEPELAVSAPG 2174 sp|P51570|GALK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7279 25.261 2 1657.7948 1657.7948 F R 21 37 PSM REPTPVLGSGAAAAG 2175 sp|P42167-3|LAP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5171 21.486 2 1352.7048 1352.7048 E R 71 86 PSM REVDDLGPEVGDI 2176 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7621 25.864 2 1412.6783 1412.6783 K K 371 384 PSM RLPLCSLPGEPGNGPDQQLQ 2177 sp|Q96GX2|A7L3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 5-UNIMOD:4 ms_run[2]:scan=7975 26.553 3 2175.0743 2175.0743 C R 71 91 PSM RPALYEVPDGEWQCPACQPATA 2178 sp|Q9UIG0-2|BAZ1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 14-UNIMOD:4,17-UNIMOD:4 ms_run[2]:scan=8037 26.665 3 2515.126 2515.1260 L R 1211 1233 PSM RPGFTSLPGSTMTPPPSGPNPYA 2179 sp|Q92734-2|TFG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 12-UNIMOD:35 ms_run[2]:scan=7233 25.184 3 2344.1158 2344.1158 P R 356 379 PSM RSPPTVLVICGPGNNGGDGLVCA 2180 sp|Q8NCW5-2|NNRE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 10-UNIMOD:4,22-UNIMOD:4 ms_run[2]:scan=8382 27.413 3 2309.1256 2309.1256 S R 3 26 PSM RSPSDSSTASTPVAEQIE 2181 sp|Q16643|DREB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5298 21.818 2 1860.8701 1860.8701 T R 336 354 PSM RTDTAADGETTATEELE 2182 sp|Q9Y2J2-3|E41L3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5166 21.476 2 1808.7912 1808.7912 E K 525 542 PSM RVDDDSLGEFPVTNS 2183 sp|Q92785|REQU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=7274 25.254 2 1649.7533 1649.7533 P R 137 152 PSM RVGPDVVTDPAFLVT 2184 sp|Q9NV31|IMP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=8793 28.561 2 1584.8512 1584.8512 V R 137 152 PSM RVLLDAPCSGTGVIS 2185 sp|P46087-2|NOP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 8-UNIMOD:4 ms_run[2]:scan=7014 24.808 2 1543.8028 1543.8028 D K 452 467 PSM KEIGNIISDAM 2186 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=6164 23.433886806666667 2 1205.601833 1205.596189 D K 180 191 PSM KDPGMGAMGGMGGGMGGGMF 2187 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 15-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=4498 19.619118393333334 2 1833.676751 1833.697653 E - 554 574 PSM KDPGMGAMGGMGGGMGGGMF 2188 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=4556 19.8386584408 2 1866.664944 1865.687483 E - 554 574 PSM KMDATANDVPSD 2189 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 2-UNIMOD:35 ms_run[1]:scan=3751 16.589732294133334 2 1279.537783 1278.539796 A R 582 594 PSM RMDTDLETMDLDQGGEALAP 2190 sp|O75643|U520_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 2-UNIMOD:35,9-UNIMOD:35 ms_run[1]:scan=7197 25.11887537733333 3 2208.950015 2208.951479 S R 386 406 PSM KEAVGDLLDAF 2191 sp|Q04637|IF4G1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=9067 29.590231106666668 2 1176.604808 1176.602654 K K 524 535 PSM KEITALAPSTM 2192 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=9000 29.3093723024 2 1176.604808 1176.606025 Q K 317 328 PSM KEITALAPSTM 2193 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=9980 32.906694175733335 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 2194 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=5943 23.082270371733333 2 1176.603321 1176.606025 Q K 317 328 PSM KEITALAPSTM 2195 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=9402 30.867772342133332 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 2196 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=10064 33.242729223733335 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 2197 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=9792 32.2204320168 2 1176.605453 1176.606025 Q K 317 328 PSM KEITALAPSTM 2198 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=9885 32.5564026664 2 1176.605453 1176.606025 Q K 317 328 PSM KAFYPEEISSMVLT 2199 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 11-UNIMOD:35 ms_run[1]:scan=8252 27.105720362133333 2 1629.806562 1629.796011 T K 112 126 PSM KDPFDTLATMTDQQ 2200 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 10-UNIMOD:35 ms_run[1]:scan=7155 25.043927913866664 2 1626.756029 1625.724303 E R 993 1007 PSM KGTMDDISQEEGSSQGEDSVSGSQ 2201 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 4-UNIMOD:35 ms_run[1]:scan=4286 18.8019863112 3 2473.005482 2473.003451 S R 944 968 PSM KIIPLYSTLPPQQQQ 2202 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=8171 26.929073618133334 2 1752.979485 1752.977421 I R 384 399 PSM KASLNGADIYSGCCTL 2203 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 13-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=7256 25.220328894399998 2 1729.765804 1728.781106 A K 248 264 PSM KINMNGVNSSNGVVDP 2204 sp|Q13404|UB2V1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 4-UNIMOD:35 ms_run[1]:scan=4967 20.999811175999998 2 1660.772681 1659.788634 T R 87 103 PSM KAMGIMNSFVNDIFE 2205 sp|P33778|H2B1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 3-UNIMOD:35,6-UNIMOD:35 ms_run[1]:scan=8670 28.186315313066665 2 1747.778597 1746.795694 S R 58 73 PSM KLGLPPLTPEQQEALQ 2206 sp|Q9UHX1|PUF60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=8142 26.863380318133334 2 1760.967729 1760.967250 A K 53 69 PSM KSLDLFNCEVTNLNDY 2207 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 8-UNIMOD:4 ms_run[1]:scan=9029 29.427925841599997 2 1944.882554 1943.893493 L R 116 132 PSM KTCGFDFTGAVEDIS 2208 sp|P00505|AATM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 3-UNIMOD:4 ms_run[1]:scan=8679 28.2138463608 2 1645.731612 1645.729388 P K 185 200 PSM KGFALVGVGSEASS 2209 sp|Q16630|CPSF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=7215 25.1527669312 2 1307.665059 1307.672131 S K 124 138 PSM KDEPDTNLVALM 2210 sp|O95433|AHSA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=8608 28.030647753333334 2 1344.659110 1344.659517 A K 125 137 PSM KTYDTINPTDGSTIC 2211 sp|Q3SY69|AL1L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 15-UNIMOD:4 ms_run[1]:scan=5796 22.822703098133335 2 1684.762378 1684.761417 G K 458 473 PSM KGEATVSFDDPPSA 2212 sp|P35637|FUS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=5905 23.001166493333336 2 1419.651328 1419.651789 L K 334 348 PSM KCELLSDDSLAVSSP 2213 sp|P13798|ACPH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 2-UNIMOD:4 ms_run[1]:scan=7535 25.703790173866665 2 1620.773714 1619.771253 G R 291 306 PSM KQLPPPPPPIPPP 2214 sp|Q7Z6E9|RBBP6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=6346 23.717515847466665 2 1373.806662 1373.807108 R R 334 347 PSM KQIVGTPVNSEDSDT 2215 sp|Q5QJE6|TDIF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=4855 20.7090589088 2 1589.744375 1588.758045 E R 227 242 PSM KSFPPPGPAEGLL 2216 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=8081 26.751970754400002 2 1308.707715 1308.707788 L R 5 18 PSM KTTEMETIYDLGT 2217 sp|Q9Y230|RUVB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:35 ms_run[1]:scan=6899 24.6164182296 2 1516.673654 1516.696691 L K 164 177 PSM KFVAPFNEVIEQM 2218 sp|Q7Z569|BRAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 13-UNIMOD:35 ms_run[1]:scan=8433 27.5524425552 2 1566.788753 1566.775216 M K 179 192 PSM KVAPLSLGPIDIE 2219 sp|P35670|ATP7B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=8980 29.2219252312 2 1351.772248 1350.775868 S R 213 226 PSM KDFTVNTVAGAM 2220 sp|Q9NRY4|RHG35_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 12-UNIMOD:35 ms_run[1]:scan=5572 22.405705870400002 2 1269.630325 1268.607088 E K 1310 1322 PSM KEMETPLSALGIQDGC 2221 sp|Q99933|BAG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 3-UNIMOD:35,16-UNIMOD:4 ms_run[1]:scan=8642 28.102746996266667 2 1764.809503 1763.806987 L R 198 214 PSM KAINGPTSASGDDIS 2222 sp|P51114|FXR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=4456 19.461859328 2 1432.670861 1431.684152 E K 578 593 PSM KDPGMGAMGGMGGGMGGGMF 2223 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 5-UNIMOD:35,8-UNIMOD:35,15-UNIMOD:35 ms_run[1]:scan=6407 23.8144966328 2 1849.691731 1849.692568 E - 554 574 PSM KYPDLYPQEDEDEEEE 2224 sp|Q8N4Q1|MIA40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=6432 23.8474399904 2 2026.818009 2026.816742 Q R 100 116 PSM KAALEAVGGTVVLE 2225 sp|P52815|RM12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7520 25.681 2 1355.766 1355.7660 I - 185 199 PSM KADAPEGLAPED 2226 sp|Q96T58|MINT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4813 20.602 2 1211.567 1211.5670 Y R 2191 2203 PSM KAFDLVPPEAVPEQ 2227 sp|Q96G03-2|PGM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8014 26.62 2 1538.7981 1538.7981 F K 129 143 PSM KALAGCDFLTISP 2228 sp|P37837|TALDO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 6-UNIMOD:4 ms_run[2]:scan=8590 27.982 2 1391.7119 1391.7119 I K 245 258 PSM KALELPLAASSIP 2229 sp|Q66K74-2|MAP1S_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8721 28.33 2 1308.7653 1308.7653 E R 596 609 PSM KATQMPEGGQGAPPMYQLY 2230 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 15-UNIMOD:35 ms_run[2]:scan=6913 24.64 3 2081.955 2081.9550 G K 944 963 PSM KAVEDDVFIPLYP 2231 sp|P16383-2|GCFC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=9198 30.204 2 1504.7813 1504.7813 K K 578 591 PSM KAVYTQDCPLAAA 2232 sp|P49588|SYAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:4 ms_run[2]:scan=5901 22.997 2 1406.6864 1406.6864 A K 664 677 PSM KDIELSPEAQA 2233 sp|Q6UB35|C1TM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5343 21.91 2 1199.6034 1199.6034 A K 880 891 PSM KDIMTPLVALL 2234 sp|Q7Z4Q2-3|HEAT3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 4-UNIMOD:35 ms_run[2]:scan=9228 30.337 2 1228.7101 1228.7101 T K 35 46 PSM KDIVVPSLNVA 2235 sp|O60645|EXOC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7654 25.921 2 1153.6707 1153.6707 F K 731 742 PSM KDLIVTPATIL 2236 sp|P54687-2|BCAT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8825 28.656 2 1182.7224 1182.7224 A K 4 15 PSM KDLPELALDTP 2237 sp|Q53EL6-2|PDCD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7980 26.561 2 1210.6445 1210.6445 L R 234 245 PSM KDMSPLSETEMALG 2238 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=7753 26.108 2 1523.6847 1523.6847 L K 504 518 PSM KDMTSEQLDDIL 2239 sp|P05023-3|AT1A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 3-UNIMOD:35 ms_run[2]:scan=8066 26.728 2 1422.6548 1422.6548 L K 640 652 PSM KDPDPEFPTV 2240 sp|Q96G03-2|PGM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6967 24.735 2 1143.5448 1143.5448 Q K 143 153 PSM KDQLPADECN 2241 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 9-UNIMOD:4 ms_run[2]:scan=3996 17.662 2 1188.5081 1188.5081 F K 600 610 PSM KDSYVGDEAQS 2242 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3982 17.612 2 1197.515 1197.5150 Q K 50 61 PSM KDVELLLPTSS 2243 sp|Q9P2B4|CT2NL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7643 25.903 2 1200.6602 1200.6602 G - 629 640 PSM KDVTGAEALLE 2244 sp|Q13813-3|SPTN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6847 24.533 2 1144.5976 1144.5976 A R 1349 1360 PSM KEDPTVSALLTSE 2245 sp|P78417-2|GSTO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7737 26.082 2 1388.7035 1388.7035 M K 174 187 PSM KEEFPDFDEETGILP 2246 sp|Q14562|DHX8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=9119 29.827 2 1764.8094 1764.8094 S K 413 428 PSM KEELDDVIALD 2247 sp|Q9UBT2-2|SAE2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8173 26.936 2 1258.6293 1258.6293 Q - 534 545 PSM KEFDYLPPVDS 2248 sp|Q9UPU5|UBP24_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7642 25.901 2 1308.6238 1308.6238 T R 1672 1683 PSM KEGITGPPADSS 2249 sp|P20810-4|ICAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4071 17.955 2 1157.5564 1157.5564 K K 171 183 PSM KEIFEQPESVFNTM 2250 sp|O94808|GFPT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 14-UNIMOD:35 ms_run[2]:scan=8128 26.836 2 1713.792 1713.7920 Q R 328 342 PSM KEISEGDEVEVYS 2251 sp|P51114-2|FXR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5588 22.447 2 1482.6726 1482.6726 K R 57 70 PSM KEITALAPSTM 2252 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=4555 19.835 2 1176.606 1176.6060 Q K 315 326 PSM KEIVPVLVST 2253 sp|Q9BWD1|THIC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7343 25.382 2 1083.654 1083.6540 D R 200 210 PSM KELLLQPVTIS 2254 sp|P59998|ARPC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8067 26.73 2 1239.7438 1239.7438 S R 44 55 PSM KELPQFATGENLP 2255 sp|Q9BZZ5-1|API5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7510 25.665 2 1442.7405 1442.7405 I R 12 25 PSM KENVPSQPVGEALP 2256 sp|Q9H4I2|ZHX3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6070 23.285 2 1463.762 1463.7620 L K 203 217 PSM KEPAEADITELC 2257 sp|Q6QNY1|BL1S2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 12-UNIMOD:4 ms_run[2]:scan=6264 23.589 2 1374.6337 1374.6337 A R 30 42 PSM KEPIQPETPQP 2258 sp|P49643|PRI2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4846 20.689 2 1262.6507 1262.6507 K K 463 474 PSM KEPISVSSEQVL 2259 sp|P00918|CAH2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6526 24.008 2 1314.7031 1314.7031 L K 212 224 PSM KESEVLIGNLGD 2260 sp|Q96A65|EXOC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7227 25.173 2 1272.6561 1272.6561 G K 681 693 PSM KETQTPVMAQP 2261 sp|Q13409-6|DC1I2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:35 ms_run[2]:scan=3984 17.618 2 1244.6071 1244.6071 T K 132 143 PSM KEVAGPTEMCDQ 2262 sp|P46939-3|UTRO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 9-UNIMOD:35,10-UNIMOD:4 ms_run[2]:scan=3576 15.739 2 1379.5697 1379.5697 F R 168 180 PSM KEVPAVPETL 2263 sp|P18124|RL7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6294 23.645 2 1081.6019 1081.6019 K K 9 19 PSM KEVPIVQTET 2264 sp|O43491-3|E41L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5017 21.131 2 1142.6183 1142.6183 T K 634 644 PSM KEVQSPEGMISL 2265 sp|Q9H6R4-2|NOL6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7766 26.138 2 1316.6646 1316.6646 L R 807 819 PSM KFDSEPSAVALELPT 2266 sp|P18583-2|SON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8417 27.509 2 1602.8141 1602.8141 L R 157 172 PSM KFVEGLPINDFS 2267 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8649 28.118 2 1364.6976 1364.6976 W R 298 310 PSM KGAVYSFDPVGSYQ 2268 sp|P20618|PSB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7731 26.072 2 1516.7198 1516.7198 G R 146 160 PSM KGCDVVVIPAGVP 2269 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 3-UNIMOD:4 ms_run[2]:scan=7801 26.209 2 1309.7064 1309.7064 L R 91 104 PSM KGDVTAQIALQPAL 2270 sp|P04179-3|SODM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7808 26.224 2 1423.8035 1423.8035 A K 75 89 PSM KGELVGGLDIV 2271 sp|O76003|GLRX3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8428 27.537 2 1098.6285 1098.6285 V K 308 319 PSM KGLVVDMDGFEEE 2272 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8344 27.318 2 1466.6599 1466.6599 E R 432 445 PSM KGVNLPGAAVDLPAVSE 2273 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=9509 31.236 2 1635.8832 1635.8832 K K 207 224 PSM KIDIIPNPQE 2274 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6560 24.055 2 1165.6343 1165.6343 L R 72 82 PSM KIDIIPNPQE 2275 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6778 24.421 2 1165.6343 1165.6343 L R 72 82 PSM KIETIEVMED 2276 sp|P51991-2|ROA3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:35 ms_run[2]:scan=5404 22.042 2 1221.5799 1221.5799 G R 129 139 PSM KILLTEPPMNPT 2277 sp|P61160|ARP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7068 24.896 2 1352.7374 1352.7374 C K 106 118 PSM KILYLTPEQE 2278 sp|P62495-2|ERF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6794 24.445 2 1232.6653 1232.6653 E K 309 319 PSM KITMIAEPLE 2279 sp|Q15029-2|U5S1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7354 25.398 2 1143.6209 1143.6209 N K 649 659 PSM KIVLAGCVPQAQP 2280 sp|Q5VV42-2|CDKAL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 7-UNIMOD:4 ms_run[2]:scan=6422 23.834 2 1379.7595 1379.7595 K R 62 75 PSM KLDDDGLPFIGA 2281 sp|Q9H9Y6-3|RPA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8912 28.98 2 1259.6398 1259.6398 Q K 844 856 PSM KLDIPTGTTPQ 2282 sp|P52732|KIF11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5794 22.819 2 1169.6292 1169.6292 L R 918 929 PSM KLDLPGNLPGS 2283 sp|P46013-2|KI67_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7410 25.489 2 1109.6081 1109.6081 Q K 1929 1940 PSM KLDVSNVATDTE 2284 sp|P50851-2|LRBA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5356 21.938 2 1290.6303 1290.6303 A R 1243 1255 PSM KLIPVLVNGM 2285 sp|Q92973-3|TNPO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:35 ms_run[2]:scan=7500 25.646 2 1098.6471 1098.6471 P K 257 267 PSM KLITEPAEIMA 2286 sp|P40123-3|CAP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:35 ms_run[2]:scan=6361 23.742 2 1230.653 1230.6530 S - 207 218 PSM KLLAETVAPAV 2287 sp|Q9BSJ8|ESYT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6921 24.65 2 1110.6649 1110.6649 E R 159 170 PSM KLLEPVVCMSDML 2288 sp|Q9UN37|VPS4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:4,9-UNIMOD:35 ms_run[2]:scan=8322 27.272 2 1549.7554 1549.7554 D R 396 409 PSM KLLTGELLPTDGMI 2289 sp|Q9UG63|ABCF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=9129 29.882 2 1499.8269 1499.8269 L R 441 455 PSM KLPEPSASLPNPPS 2290 sp|Q5TBB1-2|RNH2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6360 23.74 2 1432.7562 1432.7562 L K 233 247 PSM KLTLPLFGAM 2291 sp|Q9BWU0|NADAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:35 ms_run[2]:scan=9074 29.625 2 1105.6206 1105.6206 K K 602 612 PSM KLVAIVDVIDQN 2292 sp|P50914|RL14_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8589 27.979 2 1325.7555 1325.7555 G R 23 35 PSM KMDATANDVPSD 2293 sp|P13667|PDIA4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 2-UNIMOD:35 ms_run[2]:scan=3782 16.736 2 1278.5398 1278.5398 A R 582 594 PSM KMVVPGLDGAQIP 2294 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 2-UNIMOD:35 ms_run[2]:scan=7516 25.677 2 1339.717 1339.7170 L R 1158 1171 PSM KNPTTPSSVIFPLV 2295 sp|Q6P0N0|M18BP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=9129 29.882 2 1498.8395 1498.8395 D K 1020 1034 PSM KPADFEVPETFLN 2296 sp|Q86U38-2|NOP9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8822 28.648 2 1505.7402 1505.7402 C R 243 256 PSM KPGVAAPPEVAPAP 2297 sp|Q9Y520-3|PRC2C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5514 22.281 2 1299.7187 1299.7187 P K 105 119 PSM KPLEGLSNGNNITSAPPFASA 2298 sp|Q9UKX7-2|NUP50_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7837 26.28 3 2084.0538 2084.0538 G K 55 76 PSM KPLLPTPDLTL 2299 sp|Q6P1L5|F117B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8915 28.988 2 1206.7224 1206.7224 L K 519 530 PSM KPPPLGLCDYPSS 2300 sp|Q14166|TTL12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:4 ms_run[2]:scan=6693 24.271 2 1429.6912 1429.6912 A R 565 578 PSM KQDMPNAMPVSELTD 2301 sp|P84085|ARF5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 4-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=5353 21.929 2 1706.7491 1706.7491 N K 127 142 PSM KSEDFSLPAYMD 2302 sp|P13073|COX41_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=7298 25.294 2 1417.6071 1417.6071 V R 29 41 PSM KSEIEVISEPPEE 2303 sp|O75044|SRGP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6468 23.91 2 1484.7246 1484.7246 P K 798 811 PSM KSFYPEEVSSMVLT 2304 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8628 28.076 2 1615.7804 1615.7804 T K 112 126 PSM KSILVSPTGPS 2305 sp|Q14684-2|RRP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5506 22.262 2 1084.6128 1084.6128 D R 683 694 PSM KSIPLAMAPVFEQ 2306 sp|Q9UBF2-2|COPG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 7-UNIMOD:35 ms_run[2]:scan=7604 25.836 2 1445.7588 1445.7588 M K 577 590 PSM KSPQPDPVDTPAST 2307 sp|P46013-2|KI67_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4477 19.54 2 1438.694 1438.6940 C K 1983 1997 PSM KSPQSDPADTPTNT 2308 sp|P46013-2|KI67_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3604 15.875 2 1457.6634 1457.6634 C K 1500 1514 PSM KSVGMIAGGTGITPMLQVI 2309 sp|P00387-2|NB5R3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 5-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=8442 27.576 2 1904.0111 1904.0111 V R 150 169 PSM KTADDPSLSLI 2310 sp|P39656-3|OST48_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7807 26.221 2 1158.6132 1158.6132 F K 77 88 PSM KTATVYPEPQN 2311 sp|P48163-2|MAOX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4460 19.483 2 1246.6194 1246.6194 E K 450 461 PSM KTDPSILGGMIV 2312 sp|P48047|ATPO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:35 ms_run[2]:scan=7736 26.08 2 1245.6639 1245.6639 A R 176 188 PSM KTDTESELDLIS 2313 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7372 25.425 2 1349.6562 1349.6562 F R 760 772 PSM KTEMQDNTYPEIL 2314 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7744 26.093 2 1580.7392 1580.7392 Y R 491 504 PSM KTFDQLTPDES 2315 sp|Q15293|RCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5571 22.402 2 1279.5932 1279.5932 S K 70 81 PSM KTIDEGDADEVT 2316 sp|Q7LBC6-3|KDM3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4431 19.366 2 1291.578 1291.5780 L K 586 598 PSM KTMYPAPVTSSVYLS 2317 sp|O95163|ELP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7502 25.651 2 1642.8276 1642.8276 T R 794 809 PSM KTPVPSDIDIS 2318 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6118 23.358 2 1170.6132 1170.6132 L R 313 324 PSM KTTLILPTQQV 2319 sp|Q9UQR0|SCML2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7182 25.088 2 1240.7391 1240.7391 Q R 270 281 PSM KTVALDGTLFQ 2320 sp|Q14683|SMC1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7970 26.543 2 1191.6499 1191.6499 H K 637 648 PSM KTVEDADMELTS 2321 sp|Q9UJX4-2|APC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:35 ms_run[2]:scan=4744 20.423 2 1353.597 1353.5970 K R 47 59 PSM KTVGLPTAMAA 2322 sp|Q9UDR5|AASS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 9-UNIMOD:35 ms_run[2]:scan=5161 21.463 2 1074.5743 1074.5743 A K 872 883 PSM KTVNLSVTPSPAP 2323 sp|Q8IZ21-3|PHAR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5815 22.853 2 1309.7242 1309.7242 A R 203 216 PSM KVAAAVPVIIS 2324 sp|Q14919|NC2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7043 24.863 2 1066.675 1066.6750 G R 29 40 PSM KVAEVLQVPPM 2325 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=6031 23.225 2 1225.674 1225.6740 N R 100 111 PSM KVAMANIQPQMLVAGATSIA 2326 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 4-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=8080 26.751 3 2045.0649 2045.0649 C R 738 758 PSM KVDEIVVLSGDNS 2327 sp|Q14254|FLOT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6933 24.675 2 1373.7038 1373.7038 T K 377 390 PSM KVDFPTAIGMVVE 2328 sp|O96019|ACL6A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:35 ms_run[2]:scan=8492 27.715 2 1420.7272 1420.7272 P R 34 47 PSM KVDQVQDIVTGNPTVI 2329 sp|Q13576-3|IQGA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8019 26.629 2 1724.9309 1724.9309 S K 446 462 PSM KVEALPEQVAPES 2330 sp|Q96RE7|NACC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5647 22.556 2 1395.7246 1395.7246 E R 318 331 PSM KVFDGIPPPYD 2331 sp|Q6NVV1|R13P3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7337 25.368 2 1246.6234 1246.6234 L K 17 28 PSM KVFDPVPVGVT 2332 sp|Q08211|DHX9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7396 25.465 2 1156.6492 1156.6492 R K 697 708 PSM KVIIIGSGVSGLAAA 2333 sp|O60341|KDM1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7950 26.508 2 1354.8184 1354.8184 G R 280 295 PSM KVLEMDPLPSS 2334 sp|Q96SI9-2|STRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7202 25.128 2 1214.6217 1214.6217 Y K 310 321 PSM KVLTPELYAEL 2335 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8597 28.002 2 1274.7122 1274.7122 A R 32 43 PSM KVPIDGPPIDIG 2336 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7681 25.98 2 1219.6812 1219.6812 C R 1714 1726 PSM KVSPDMAIFITMNPGYAG 2337 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 6-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=7973 26.548 3 1942.9169 1942.9169 V R 2007 2025 PSM KVVPCLVTPVTG 2338 sp|O75369-5|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 5-UNIMOD:4 ms_run[2]:scan=6866 24.562 2 1268.7162 1268.7162 R R 987 999 PSM KVVPIASLTPYQS 2339 sp|P27694|RFA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7409 25.487 2 1401.7868 1401.7868 S K 183 196 PSM KYITGTDILDM 2340 sp|Q9Y3A6-2|TMED5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=7174 25.075 2 1284.6272 1284.6272 K K 141 152 PSM MLGGSGSHGR 2341 sp|Q05682-5|CALD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 1-UNIMOD:1,1-UNIMOD:35 ms_run[2]:scan=3679 16.244 2 1015.4505 1015.4505 - R 1 11 PSM PAYHSSLMDPDT 2342 sp|O15145|ARPC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 8-UNIMOD:35 ms_run[2]:scan=4805 20.583 2 1348.5605 1348.5605 M K 2 14 PSM PDPAKSAPAP 2343 sp|Q93079|H2B1H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=3901 17.296 2 949.4869 949.4869 M K 2 12 PSM PGHLQEGFGCVVTN 2344 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:4 ms_run[2]:scan=9920 32.684 2 1513.6984 1513.6984 M R 2 16 PSM PGHLQEGFGCVVTN 2345 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:4 ms_run[2]:scan=9312 30.535 2 1513.6984 1513.6984 M R 2 16 PSM PGHLQEGFGCVVTN 2346 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 10-UNIMOD:4 ms_run[2]:scan=9606 31.561 2 1513.6984 1513.6984 M R 2 16 PSM RAAETVVDPEMTPYLDIANQTG 2347 sp|Q9Y5A7-2|NUB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 11-UNIMOD:35 ms_run[2]:scan=8214 27.025 3 2406.1373 2406.1373 K R 199 221 PSM RALQAGQLENQAAPDDTQGSPDLGAVEL 2348 sp|Q16512-3|PKN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8302 27.224 3 2863.3948 2863.3948 R R 186 214 PSM RAQEAPGQAEPPAAAEVQGAGNENEP 2349 sp|O14745|NHRF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5374 21.974 3 2587.1899 2587.1899 L R 112 138 PSM RAVLVDLEPGTMDSV 2350 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 12-UNIMOD:35 ms_run[2]:scan=7395 25.464 2 1616.808 1616.8080 P R 62 77 PSM RCAPAPPPPPPPPTSGPIGGL 2351 sp|Q12830-4|BPTF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 2-UNIMOD:4 ms_run[2]:scan=7520 25.681 3 2032.0564 2032.0564 E R 19 40 PSM RDDGTGQLLLPLSDA 2352 sp|Q15149-7|PLEC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8890 28.901 2 1569.7999 1569.7999 R R 3834 3849 PSM RDGDGEVSEQEFL 2353 sp|P41208|CETN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7495 25.635 2 1479.6478 1479.6478 D R 151 164 PSM RDMTLPPETNVILT 2354 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 3-UNIMOD:35 ms_run[2]:scan=7428 25.521 2 1614.8287 1614.8287 A K 448 462 PSM RDPESETDNDSQEIF 2355 sp|P78527-2|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=6500 23.955 2 1780.7388 1780.7388 Y K 2485 2500 PSM RDVDETGITVASLE 2356 sp|Q8WU90|ZC3HF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7472 25.598 2 1503.7417 1503.7417 P R 340 354 PSM RDVQGTDASLDEELD 2357 sp|Q9UJZ1-2|STML2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5937 23.066 2 1661.738 1661.7380 S R 292 307 PSM REDDVGTGAGLLEI 2358 sp|P49368-2|TCPG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8627 28.073 2 1443.7205 1443.7205 L K 301 315 PSM REPELPCGLAPAVS 2359 sp|Q8TEQ6|GEMI5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 7-UNIMOD:4 ms_run[2]:scan=7460 25.57 2 1494.7501 1494.7501 A R 787 801 PSM REPELPCGLAPAVS 2360 sp|Q8TEQ6|GEMI5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 7-UNIMOD:4 ms_run[2]:scan=7667 25.95 2 1494.7501 1494.7501 A R 787 801 PSM RGPIPSGMQGPSPINMGAVVPQGS 2361 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 16-UNIMOD:35 ms_run[2]:scan=7137 25.007 3 2349.1569 2349.1569 P R 458 482 PSM RGVVDSEDLPLNIS 2362 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8164 26.91 2 1512.7784 1512.7784 I R 378 392 PSM RIEESDQGPYAIILAPT 2363 sp|Q9BUQ8|DDX23_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8677 28.206 3 1871.9629 1871.9629 D R 461 478 PSM RLMDGEEPLPMLPSY 2364 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 3-UNIMOD:35 ms_run[2]:scan=8829 28.673 2 1762.827 1762.8270 R K 878 893 PSM RLPDGSSFTNQFPSDAPLEEA 2365 sp|Q92575|UBXN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8544 27.849 3 2277.055 2277.0550 F R 325 346 PSM RLVDSPDIQPVGTCE 2366 sp|Q9UQR0|SCML2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 14-UNIMOD:4 ms_run[2]:scan=6325 23.682 2 1684.809 1684.8090 W K 108 123 PSM RPGDVEFEDFSQPMN 2367 sp|Q15642-5|CIP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 14-UNIMOD:35 ms_run[2]:scan=7370 25.422 2 1782.7519 1782.7519 A R 278 293 PSM RSLGDVDDGDTVTDFMAQE 2368 sp|Q969S9-5|RRF2M_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 16-UNIMOD:35 ms_run[2]:scan=7084 24.922 2 2085.8797 2085.8797 T R 98 117 PSM RTGAIVDVPVGEELLG 2369 sp|P25705-2|ATPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8868 28.823 2 1623.8832 1623.8832 K R 83 99 PSM RTIAMDGTEGLV 2370 sp|P06576|ATPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 5-UNIMOD:35 ms_run[2]:scan=5891 22.981 2 1277.6286 1277.6286 V R 109 121 PSM RTVLDPVTGDLSDT 2371 sp|Q15393|SF3B3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=7427 25.519 2 1487.7468 1487.7468 L R 676 690 PSM RVDYIMQLPVPMDAALN 2372 sp|P45974-2|UBP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 6-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=8459 27.623 3 1976.97 1976.9700 Q K 482 499 PSM RVPDVLVADPPIA 2373 sp|Q14697|GANAB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=8131 26.843 2 1360.7715 1360.7715 Y R 114 127 PSM TVKLGDGGSGEDGL 2374 sp|Q96RY5|CRML_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5861 22.925 2 1303.6256 1303.6256 M K 2 16 PSM VQKESQATLEE 2375 sp|O60502-3|OGA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=4090 18.041 2 1260.6198 1260.6198 M R 2 13 PSM KLVQDVANNTNEEAGDGTTTATVLA 2376 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=9494 31.183605588533332 3 2532.233717 2531.235105 A R 96 121 PSM RTLTIVDTGIGMT 2377 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=8192 26.978971236 2 1376.740729 1376.733351 D K 27 40 PSM PGHLQEGFGCVVTN 2378 sp|Q8NC51|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 10-UNIMOD:4 ms_run[1]:scan=6542 24.02922840933333 2 1513.6969 1513.6978 M R 2 16 PSM PGHLQEGFGCVVTN 2379 sp|Q8NC51|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 10-UNIMOD:4 ms_run[1]:scan=9405 30.876849377866666 2 1514.7002 1513.6982 M R 2 16 PSM KVGINYQPPTVVPGGDLA 2380 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=9320 30.5703245312 2 1823.980040 1823.978149 F K 352 370 PSM KDLYANTVLSGGTTMYPGIAD 2381 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 15-UNIMOD:35 ms_run[1]:scan=9598 31.5348074552 2 2203.056004 2202.051451 R R 291 312 PSM KVATPLPDPMAS 2382 sp|Q14126|DSG2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6813 24.480879898666668 2 1225.637820 1225.637660 Q R 919 931 PSM KQLLQTVNVPIIDGA 2383 sp|Q02952|AKA12_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=8849 28.746001095466667 2 1607.925144 1607.924657 S K 1372 1387 PSM KSYLPPPEQPSSGSL 2384 sp|Q5T8P6|RBM26_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6302 23.655368365866664 2 1585.798911 1585.798788 T K 79 94 PSM KDMFQETMEAM 2385 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 8-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=5443 22.127076699733333 2 1391.539847 1391.540725 D R 316 327 PSM RLMDGEEPLPMLPSY 2386 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 11-UNIMOD:35 ms_run[1]:scan=8697 28.26036902666667 2 1763.818071 1762.826994 R K 878 893 PSM KEVGSPPLDPTE 2387 sp|Q96EK5|KBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5202 21.553963856266666 2 1267.630006 1267.629597 M R 174 186 PSM KLEAEGVPEVSE 2388 sp|O76003|GLRX3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5656 22.569027752266667 2 1285.637575 1285.640162 V K 67 79 PSM KLEAEGVPEVSE 2389 sp|O76003|GLRX3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5649 22.558317387200002 2 1285.637575 1285.640162 V K 67 79 PSM KINVPELPTPDEDN 2390 sp|O43264|ZW10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=7350 25.392436143466668 2 1579.763887 1579.772967 S K 430 444 PSM KVLLPEYGGT 2391 sp|P61604|CH10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6419 23.8302339032 2 1075.591208 1075.591361 D K 70 80 PSM KAVVQSPQVTEVL 2392 sp|Q3KQU3|MA7D1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=7005 24.7939357736 2 1396.795922 1396.792580 K - 829 842 PSM RAAEDDEDDDVDT 2393 sp|P06454|PTMA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=3672 16.210374413866667 2 1464.549246 1464.548840 K K 90 103 PSM RAPPEPAPPAEATGAPAPS 2394 sp|P84157|MXRA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=4971 21.009963285866668 2 1782.890010 1782.890063 A R 39 58 PSM KVGIPVTDENGN 2395 sp|Q9H9B4|SFXN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5159 21.459181072266666 2 1242.609443 1241.625181 L R 202 214 PSM KEILVGDVGQTVDD 2396 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 25 ms_run[1]:scan=6518 23.996001468 2 1486.7566 1486.7510 G P 53 67 PSM KIDDMTAAPMDV 2397 sp|P15927|RFA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=7044 24.86470024533333 2 1305.593514 1305.594474 Y R 93 105 PSM KIDDMTAAPMDV 2398 sp|P15927|RFA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 10-UNIMOD:35 ms_run[1]:scan=5707 22.659812492 2 1321.589079 1321.589389 Y R 93 105 PSM KQLPPPPPPIPPP 2399 sp|Q7Z6E9|RBBP6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6454 23.887339734399998 2 1373.806662 1373.807108 R R 334 347 PSM KLPGELEPVQATQN 2400 sp|O75821|EIF3G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6266 23.590229274133332 2 1522.799148 1522.799122 E K 195 209 PSM KSIVTAEVSSMPAC 2401 sp|Q86SZ2|TPC6B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 14-UNIMOD:4 ms_run[1]:scan=6192 23.474336290666667 2 1478.701540 1478.710901 I K 136 150 PSM KETGDPGGQLVLAGDP 2402 sp|Q9HCE1|MOV10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6516 23.99301837146667 2 1552.772698 1552.773302 V R 666 682 PSM KSPSDLLDASAVSATS 2403 sp|O60499|STX10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=7049 24.8695331704 2 1547.771261 1547.767882 Q R 131 147 PSM KELALPGELTQS 2404 sp|O75436|VP26A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=7174 25.075200573333333 2 1284.692229 1284.692532 V R 93 105 PSM RLQQLLPASQSTQLPCSSSPQETTQS 2405 sp|Q6W2J9|BCOR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 16-UNIMOD:4 ms_run[1]:scan=7079 24.91136202426667 3 2872.405962 2871.403250 D R 1421 1447 PSM KEFGSLPTTPSEQ 2406 sp|O15400|STX7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5905 23.001166493333336 2 1419.696383 1419.688175 I R 71 84 PSM KDPVIASDGYSYE 2407 sp|Q8N9V3|WSDU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5948 23.091286665066665 2 1442.684258 1442.656540 M K 418 431 PSM KTVEVLEPEVT 2408 sp|Q7L576|CYFP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=6119 23.360279341866665 2 1242.670829 1242.670734 E K 110 121 PSM MRGGGFGDRD 2409 sp|Q92841-1|DDX17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 1-UNIMOD:1,1-UNIMOD:35 ms_run[1]:scan=4189 18.4094138792 2 1124.464720 1124.466906 - R 1 11 PSM KAVFPCPSEPALS 2410 sp|O14802|RPC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 6-UNIMOD:4 ms_run[1]:scan=6862 24.5559374864 2 1403.712871 1401.696237 I K 929 942 PSM KEVDEQMLNVQN 2411 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5612 22.485538766133335 2 1445.677778 1445.682044 M K 324 336 PSM KSPELPGVQEDEAAS 2412 sp|Q8N5S9|KKCC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5541 22.34012505173333 2 1555.738323 1555.736582 G - 491 506 PSM KNSPDLGPIGGPPNGML 2413 sp|Q8TB72|PUM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 16-UNIMOD:35 ms_run[1]:scan=7400 25.470781286666668 2 1678.843482 1678.834856 L - 1050 1067 PSM KALDLVSDPEYINLM 2414 sp|Q9H8M7|MINY3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=9179 30.1125336256 2 1722.866903 1719.875324 M K 333 348 PSM APKFPDSVEEL 2415 sp|Q15785|TOM34_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8059 26.714 2 1230.6132 1230.6132 M R 2 13 PSM KAIQDGTIVLMGTYDDGAT 2416 sp|Q92520|FAM3C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 11-UNIMOD:35 ms_run[2]:scan=7150 25.034 2 1983.9459 1983.9459 L K 137 156 PSM KALENDPDC 2417 sp|P13797-3|PLST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:4 ms_run[2]:scan=3570 15.707 2 1060.4495 1060.4495 N R 90 99 PSM KAMLESIGVPLE 2418 sp|P54577|SYYC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 3-UNIMOD:35 ms_run[2]:scan=7616 25.858 2 1301.6901 1301.6901 I K 102 114 PSM KASAEGPLLGPEAAPSGEGAGS 2419 sp|Q9BRJ6|CG050_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6049 23.249 3 1951.9487 1951.9487 K K 21 43 PSM KASTEGVAIQGQQGT 2420 sp|Q92621|NU205_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4281 18.78 2 1473.7423 1473.7423 Q R 69 84 PSM KAVASLPPEQMFELM 2421 sp|P33240-2|CSTF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 11-UNIMOD:35,15-UNIMOD:35 ms_run[2]:scan=7639 25.899 2 1721.8368 1721.8368 S K 130 145 PSM KDAEIPEGAA 2422 sp|O14654|IRS4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4392 19.217 2 999.48729 999.4873 V R 674 684 PSM KDATCELPLQ 2423 sp|Q8IXW5-2|RPAP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 5-UNIMOD:4 ms_run[2]:scan=5967 23.122 2 1173.57 1173.5700 E K 284 294 PSM KDDPENDNSELPTA 2424 sp|Q93009-3|UBP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4938 20.94 2 1543.6638 1543.6638 Q K 754 768 PSM KDEEMIGPIID 2425 sp|Q9NTK5-3|OLA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7633 25.887 2 1258.6115 1258.6115 L K 155 166 PSM KDGTAGIPNLQLYDV 2426 sp|Q9BY44-3|EIF2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8863 28.805 2 1602.8253 1602.8253 S K 75 90 PSM KDLFDPIIED 2427 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8692 28.248 2 1203.6023 1203.6023 F R 86 96 PSM KDLFDPIIED 2428 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8814 28.62 2 1203.6023 1203.6023 F R 86 96 PSM KDLFDPIIED 2429 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8928 29.034 2 1203.6023 1203.6023 F R 86 96 PSM KDLFDPIIED 2430 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9035 29.452 2 1203.6023 1203.6023 F R 86 96 PSM KDLFDPIIED 2431 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9134 29.903 2 1203.6023 1203.6023 F R 86 96 PSM KDLFDPIIED 2432 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9222 30.313 2 1203.6023 1203.6023 F R 86 96 PSM KDLFEPQTALL 2433 sp|Q9ULK4-6|MED23_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8807 28.602 2 1273.6918 1273.6918 D R 260 271 PSM KDLGGFDEDAEP 2434 sp|Q9BRK5-4|CAB45_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6092 23.32 2 1291.5568 1291.5568 G R 85 97 PSM KDLIGIDNLVVPG 2435 sp|Q9Y4F1|FARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8980 29.222 2 1351.7711 1351.7711 K R 745 758 PSM KDLILPTIQ 2436 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7857 26.324 2 1039.6277 1039.6277 F K 259 268 PSM KDLTGQVPTPVV 2437 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6701 24.282 2 1252.7027 1252.7027 Q K 519 531 PSM KDPDPDFSTV 2438 sp|Q6PCE3|PGM2L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5921 23.031 2 1119.5084 1119.5084 Q K 292 302 PSM KDSSYPYSQSDQSMN 2439 sp|O95429-2|BAG4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 14-UNIMOD:35 ms_run[2]:scan=4274 18.754 2 1751.6945 1751.6945 P R 260 275 PSM KEAALEPSME 2440 sp|Q9H3K2|GHITM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=4140 18.24 2 1119.5118 1119.5118 L K 63 73 PSM KEAEPDLLAVL 2441 sp|Q9UBB6-2|NCDN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9174 30.093 2 1196.6653 1196.6653 W R 195 206 PSM KEALCDPTVAS 2442 sp|Q9BRX2|PELO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 5-UNIMOD:4 ms_run[2]:scan=4739 20.411 2 1189.5649 1189.5649 L R 254 265 PSM KEAVFDDDMEQL 2443 sp|Q7Z460-2|CLAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=6478 23.923 2 1454.6235 1454.6235 L R 1215 1227 PSM KEDDALWPPPD 2444 sp|P61326|MGN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7422 25.511 2 1281.5877 1281.5877 T R 71 82 PSM KEDEPSVGQVA 2445 sp|Q9C0C9|UBE2O_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4637 20.097 2 1157.5564 1157.5564 H R 672 683 PSM KEDQTEYLEE 2446 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5137 21.407 2 1282.5565 1282.5565 L R 186 196 PSM KEEDEEGEDVVTSTG 2447 sp|Q8NFC6|BD1L1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4523 19.708 2 1622.6795 1622.6795 A R 1861 1876 PSM KEESFGPIMVIS 2448 sp|Q3SY69|AL1L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=8321 27.269 2 1351.6694 1351.6694 A K 823 835 PSM KEFLVLGEAPS 2449 sp|Q9NZQ3-3|SPN90_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7898 26.399 2 1188.639 1188.6390 C - 705 716 PSM KEGGGDEPLNFLDP 2450 sp|Q5JTH9-2|RRP12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8853 28.762 2 1486.694 1486.6940 L K 1010 1024 PSM KEGPVLATSSGAGVF 2451 sp|Q9H4A3-4|WNK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7298 25.294 2 1418.7405 1418.7405 V K 1434 1449 PSM KEITEGDEVEVYS 2452 sp|P51116|FXR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5717 22.678 2 1496.6882 1496.6882 N R 67 80 PSM KELASPVSPEL 2453 sp|Q5T4S7-3|UBR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6554 24.046 2 1168.634 1168.6340 Q R 174 185 PSM KELEGILLPSD 2454 sp|Q13438-4|OS9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8190 26.974 2 1212.6602 1212.6602 E R 438 449 PSM KELLTSFGPL 2455 sp|P26368-2|U2AF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8917 28.996 2 1103.6227 1103.6227 V K 276 286 PSM KELQLIPDQL 2456 sp|Q99567|NUP88_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8622 28.063 2 1195.6812 1195.6812 K R 663 673 PSM KELVYPPDYNPEG 2457 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6745 24.358 2 1519.7195 1519.7195 F K 485 498 PSM KEMAIPVLEA 2458 sp|P54886-2|P5CS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8129 26.839 2 1099.5947 1099.5947 L R 149 159 PSM KEPAAPVSIQ 2459 sp|Q14847-3|LASP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5036 21.177 2 1038.571 1038.5710 Y R 131 141 PSM KEPLPTLPLG 2460 sp|O43464-4|HTRA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8065 26.726 2 1063.6277 1063.6277 T R 237 247 PSM KEVEGDDVPESIMLEM 2461 sp|Q1KMD3|HNRL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9116 29.811 2 1819.822 1819.8220 R K 577 593 PSM KEVLSDPEM 2462 sp|Q13217|DNJC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=4476 19.538 2 1062.4903 1062.4903 A R 446 455 PSM KFLEESVSMSPEE 2463 sp|P15374|UCHL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=5797 22.825 2 1526.681 1526.6810 K R 121 134 PSM KFVELPGAEMG 2464 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:35 ms_run[2]:scan=6421 23.832 2 1192.5798 1192.5798 G K 186 197 PSM KGETVPLDVLQI 2465 sp|Q53H12|AGK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9100 29.731 2 1310.7446 1310.7446 V K 184 196 PSM KGIDPFSLDALS 2466 sp|P40227-2|TCPZ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8992 29.272 2 1261.6554 1261.6554 Q K 250 262 PSM KGIEILTDMS 2467 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 9-UNIMOD:35 ms_run[2]:scan=6384 23.776 2 1121.5638 1121.5638 E R 143 153 PSM KGSPMEISLPIALS 2468 sp|P09960-3|LKHA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 5-UNIMOD:35 ms_run[2]:scan=8705 28.284 2 1457.78 1457.7800 Y K 59 73 PSM KGVLFGVPGAFTPGCS 2469 sp|P30044-2|PRDX5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 15-UNIMOD:4 ms_run[2]:scan=8989 29.262 2 1592.8021 1592.8021 K K 34 50 PSM KIAVEPVNPSELP 2470 sp|Q15029-2|U5S1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7494 25.632 2 1391.766 1391.7660 I K 554 567 PSM KIDIDPEETV 2471 sp|P54727|RD23B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6648 24.194 2 1157.5816 1157.5816 F K 14 24 PSM KIDISPVLLQ 2472 sp|P49959-2|MRE11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8425 27.529 2 1124.6805 1124.6805 E K 161 171 PSM KIDPSSSLEAEPLS 2473 sp|Q7Z2Z1-2|TICRR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6404 23.81 2 1471.7406 1471.7406 K K 1576 1590 PSM KIETIEVMED 2474 sp|P51991-2|ROA3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6638 24.179 2 1205.585 1205.5850 G R 129 139 PSM KIEVIEIMTD 2475 sp|P09651-3|ROA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 8-UNIMOD:35 ms_run[2]:scan=6945 24.696 2 1205.6213 1205.6213 G R 130 140 PSM KIFQNAPTDPTQDFSTQVA 2476 sp|P45974-2|UBP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7563 25.758 3 2107.0222 2107.0222 E K 360 379 PSM KIGGIGTVPVG 2477 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6129 23.372 2 996.59678 996.5968 Y R 255 266 PSM KIIEDQQESLN 2478 sp|P05455|LA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4790 20.545 2 1315.662 1315.6620 K K 317 328 PSM KIPGSPPESMG 2479 sp|P50395-2|GDIB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:35 ms_run[2]:scan=4289 18.811 2 1114.5329 1114.5329 F R 57 68 PSM KITVTSEVPFS 2480 sp|P35268|RL22_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7224 25.168 2 1206.6496 1206.6496 S K 69 80 PSM KIVDVMDSSQQ 2481 sp|O75717|WDHD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 6-UNIMOD:35 ms_run[2]:scan=4231 18.574 2 1264.5969 1264.5969 V K 119 130 PSM KLAPITYPQGLAMA 2482 sp|P60763|RAC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8325 27.282 2 1472.8061 1472.8061 K R 133 147 PSM KLDQPVSAPPSP 2483 sp|Q16204|CCDC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5195 21.541 2 1234.6558 1234.6558 E R 234 246 PSM KLFQLPTPPLS 2484 sp|Q9Y6K0|CEPT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8873 28.837 2 1239.7227 1239.7227 N R 34 45 PSM KLGPQASSQVVMPPLV 2485 sp|Q86YP4-2|P66A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:35 ms_run[2]:scan=7255 25.219 2 1665.9124 1665.9124 S R 233 249 PSM KLLDAVDTYIPVPA 2486 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9071 29.609 2 1513.8392 1513.8392 Q R 238 252 PSM KLLPTVAGIPAS 2487 sp|Q96JM7-2|LMBL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7583 25.79 2 1165.7071 1165.7071 S K 667 679 PSM KLPFPIIDD 2488 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8923 29.018 2 1056.5855 1056.5855 E R 97 106 PSM KLPPLPAVE 2489 sp|O95793-2|STAU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7147 25.027 2 962.58007 962.5801 K R 170 179 PSM KLQPLSPVPSDIEIS 2490 sp|Q6UB35|C1TM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8209 27.016 2 1621.8927 1621.8927 L R 352 367 PSM KLVESLPQEI 2491 sp|P52815|RM12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7356 25.402 2 1154.6547 1154.6547 K K 163 173 PSM KMFVLDEADEMLS 2492 sp|P60842-2|IF4A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 2-UNIMOD:35 ms_run[2]:scan=8574 27.93 2 1542.6946 1542.6946 I R 177 190 PSM KNQIIACNGSIQSIPEIPDDL 2493 sp|P23921|RIR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:4 ms_run[2]:scan=8930 29.042 3 2324.1682 2324.1682 M K 656 677 PSM KNVLSETPAICPPQNTENQ 2494 sp|O75717|WDHD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 11-UNIMOD:4 ms_run[2]:scan=6449 23.878 3 2139.0266 2139.0266 L R 998 1017 PSM KPATLTTTSATS 2495 sp|O43670-2|ZN207_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3950 17.491 2 1177.619 1177.6190 S K 335 347 PSM KPDTIEVQQM 2496 sp|P35241-4|RADI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:35 ms_run[2]:scan=4334 18.979 2 1203.5805 1203.5805 R K 160 170 PSM KPEPPAMPQPVPTA 2497 sp|P23396|RS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:35 ms_run[2]:scan=4953 20.973 2 1474.749 1474.7490 G - 230 244 PSM KPLLESGTLGT 2498 sp|P22314-2|UBA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6318 23.674 2 1114.6234 1114.6234 R K 553 564 PSM KPLTPQGDELSEP 2499 sp|Q8NFA0|UBP32_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5575 22.414 2 1409.7038 1409.7038 H R 1323 1336 PSM KPLVQQPILPVV 2500 sp|Q5T8P6-3|RBM26_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8556 27.88 2 1329.8384 1329.8384 P K 618 630 PSM KPQEQLTLEPYE 2501 sp|P22087|FBRL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6846 24.532 2 1473.7351 1473.7351 M R 292 304 PSM KPVAIQTYPILGE 2502 sp|Q8TED0-3|UTP15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8001 26.6 2 1427.8024 1427.8024 Y K 5 18 PSM KPVLMALAEGPGAEGP 2503 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 5-UNIMOD:35 ms_run[2]:scan=9352 30.69 2 1551.7967 1551.7967 T R 575 591 PSM KPVTTPEEIAQVATISANGD 2504 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=9431 30.965 2 2040.0375 2040.0375 S K 160 180 PSM KQLFTDVATGEMS 2505 sp|Q6P3X3|TTC27_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:35 ms_run[2]:scan=6203 23.494 2 1441.6759 1441.6759 A R 803 816 PSM KQLLQTVNVPIIDGA 2506 sp|Q02952-3|AKA12_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8880 28.864 2 1607.9247 1607.9247 S K 1267 1282 PSM KQMGLQPYPEILVVS 2507 sp|O43353-2|RIPK2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 3-UNIMOD:35 ms_run[2]:scan=8711 28.303 2 1716.912 1716.9120 N R 376 391 PSM KQPGVDSLSPVASLP 2508 sp|Q9UBW7-2|ZMYM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7984 26.57 2 1493.809 1493.8090 Q K 210 225 PSM KQVAASTAQLLVAC 2509 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 14-UNIMOD:4 ms_run[2]:scan=6739 24.348 2 1458.7864 1458.7864 A K 2429 2443 PSM KSALIPVIPIT 2510 sp|Q6P1L5|F117B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8802 28.592 2 1150.7325 1150.7325 P K 325 336 PSM KSIIGMGTGAGAYILT 2511 sp|Q92597-3|NDRG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 6-UNIMOD:35 ms_run[2]:scan=7814 26.236 2 1567.828 1567.8280 L R 51 67 PSM KSLSEAPEDTST 2512 sp|P41214|EIF2D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4015 17.745 2 1263.583 1263.5830 D R 236 248 PSM KSLVDLTAVDVPT 2513 sp|O75489-2|NDUS3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8418 27.511 2 1356.75 1356.7500 F R 109 122 PSM KSVVIDCSSSQPQFCNAGSN 2514 sp|Q9HAS0|NJMU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:4,15-UNIMOD:4 ms_run[2]:scan=5663 22.58 2 2183.9576 2183.9576 H R 274 294 PSM KTDAGGEDAILQT 2515 sp|Q9NT62-2|ATG3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5526 22.315 2 1317.6412 1317.6412 A R 185 198 PSM KTELAEPIAI 2516 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7477 25.605 2 1083.6176 1083.6176 G R 1109 1119 PSM KTETILPPESENP 2517 sp|Q9H2G2-2|SLK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5757 22.758 2 1453.73 1453.7300 S K 731 744 PSM KTIQVDNTDAEG 2518 sp|P28838-2|AMPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4205 18.467 2 1289.6099 1289.6099 G R 325 337 PSM KTISPMVMDA 2519 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 6-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=4405 19.264 2 1123.5253 1123.5253 S K 792 802 PSM KTLCGTPNYIAPEVLS 2520 sp|P53350|PLK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 4-UNIMOD:4 ms_run[2]:scan=7717 26.046 2 1761.8971 1761.8971 K K 209 225 PSM KTLEDPDLNV 2521 sp|Q86VP6-2|CAND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6231 23.537 2 1142.5819 1142.5819 L R 845 855 PSM KTLFVGLPPPAD 2522 sp|O15381-3|NVL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8143 26.866 2 1253.702 1253.7020 D R 545 557 PSM KTLFVGLPPPAD 2523 sp|O15381-3|NVL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8315 27.256 2 1253.702 1253.7020 D R 545 557 PSM KTLGTPTQPGSTP 2524 sp|Q8NFH5-2|NUP35_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4437 19.391 2 1283.6721 1283.6721 I R 252 265 PSM KTLNEADCATVPPAI 2525 sp|P31040-3|SDHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 8-UNIMOD:4 ms_run[2]:scan=6292 23.642 2 1598.7974 1598.7974 D R 502 517 PSM KTMLESAGGLIQTA 2526 sp|Q9Y490|TLN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8112 26.807 2 1418.7439 1418.7439 A R 1604 1618 PSM KTPLPPELADVQA 2527 sp|Q9Y5V0|ZN706_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7951 26.51 2 1377.7504 1377.7504 P - 64 77 PSM KTTEEQVQASTPCP 2528 sp|Q14137|BOP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 13-UNIMOD:4 ms_run[2]:scan=4789 20.542 2 1574.7246 1574.7246 K R 96 110 PSM KTTVVYPATE 2529 sp|Q96C86|DCPS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4754 20.45 2 1107.5812 1107.5812 V K 128 138 PSM KTVMPYISTTPA 2530 sp|P05556-2|ITB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 4-UNIMOD:35 ms_run[2]:scan=5438 22.12 2 1323.6744 1323.6744 E K 190 202 PSM KVAEVLQVPPM 2531 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7908 26.419 2 1209.6791 1209.6791 N R 100 111 PSM KVFDGIPPPYD 2532 sp|Q6NVV1|R13P3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7081 24.913 2 1246.6234 1246.6234 L K 17 28 PSM KVGAEDADGIDMAY 2533 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:35 ms_run[2]:scan=5664 22.582 2 1469.6344 1469.6344 G R 282 296 PSM KVGDPVYLLGQ 2534 sp|Q5VT66-3|MARC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8090 26.767 2 1187.655 1187.6550 I - 242 253 PSM KVILEDDLVDSC 2535 sp|Q9NXL9-3|MCM9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:4 ms_run[2]:scan=7357 25.403 2 1404.6806 1404.6806 M K 221 233 PSM KVLCELADLQD 2536 sp|P17987|TCPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 4-UNIMOD:4 ms_run[2]:scan=7447 25.545 2 1302.649 1302.6490 A K 73 84 PSM KVLTMPETC 2537 sp|Q99460|PSMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 5-UNIMOD:35,9-UNIMOD:4 ms_run[2]:scan=4167 18.348 2 1093.5148 1093.5148 L R 890 899 PSM KVMENSSGTPDILT 2538 sp|Q96GD4-3|AURKB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 3-UNIMOD:35 ms_run[2]:scan=5752 22.749 2 1506.7236 1506.7236 Q R 56 70 PSM KVPIPAPNEVLND 2539 sp|Q9C0J8|WDR33_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7114 24.968 2 1404.7613 1404.7613 N R 512 525 PSM KVSTLPAITL 2540 sp|P07339|CATD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8330 27.293 2 1041.6434 1041.6434 E K 331 341 PSM KYPDISDSISTE 2541 sp|Q8IWI9|MGAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6328 23.686 2 1353.63 1353.6300 W R 552 564 PSM KYSDPPVNFLPVPS 2542 sp|Q6P158-3|DHX57_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8708 28.292 2 1558.8031 1558.8031 H R 329 343 PSM KYSPPAISPLVSE 2543 sp|Q14694|UBP10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7304 25.303 2 1386.7395 1386.7395 T K 363 376 PSM PDPSKSAPAP 2544 sp|Q8N257|H2B3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3811 16.888 2 965.48181 965.4818 M K 2 12 PSM PEPAKSAPAP 2545 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3640 16.052 2 963.50255 963.5025 M K 2 12 PSM PFSNSHNAL 2546 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=4937 20.938 2 985.46174 985.4617 M K 2 11 PSM PGHLQEGFGCVVTN 2547 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:4 ms_run[2]:scan=9702 31.903 2 1513.6984 1513.6984 M R 2 16 PSM PGHLQEGFGCVVTN 2548 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:4 ms_run[2]:scan=9506 31.224 2 1513.6984 1513.6984 M R 2 16 PSM RAAEDDEDDDVDT 2549 sp|P06454-2|PTMA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3595 15.834 2 1464.5488 1464.5488 K K 89 102 PSM RDFTPVCTTELG 2550 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:4 ms_run[2]:scan=7058 24.883 2 1394.65 1394.6500 P R 41 53 PSM RDGDPLPSSLSC 2551 sp|P53602|MVD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:4 ms_run[2]:scan=6213 23.509 2 1302.5874 1302.5874 S K 97 109 PSM RDLDAPDDVDFF 2552 sp|Q9BXP5-5|SRRT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8897 28.925 2 1423.6256 1423.6256 Y - 828 840 PSM RDQIPSPGLMVFP 2553 sp|P54709-2|AT1B3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:35 ms_run[2]:scan=8594 27.993 2 1471.7493 1471.7493 Y K 59 72 PSM RDVIDEPIIEEPS 2554 sp|O60216|RAD21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7299 25.295 2 1510.7515 1510.7515 Q R 437 450 PSM REGTGTEMPMIGD 2555 sp|Q02790|FKBP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 8-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=4384 19.192 2 1424.5912 1424.5912 K R 39 52 PSM RELEDPESAMLDTLD 2556 sp|Q86XZ4|SPAS2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 10-UNIMOD:35 ms_run[2]:scan=6937 24.681 2 1748.7775 1748.7775 A R 159 174 PSM RITSFVIPEPSPTSQTIQEGS 2557 sp|P41214|EIF2D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8205 27.008 3 2273.1539 2273.1539 P R 351 372 PSM RLASTAVESAGVSSAPEGTSPGD 2558 sp|Q9H0W5|CCDC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5291 21.806 3 2145.0186 2145.0186 A R 225 248 PSM RLFPPDDSPLPVSS 2559 sp|Q05519-2|SRS11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7816 26.239 2 1525.7777 1525.7777 L R 63 77 PSM RLLVTDMSDAEQY 2560 sp|O14929-2|HAT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7718 26.048 2 1539.7239 1539.7239 L R 251 264 PSM RQEDAPMIEPLVPEE 2561 sp|Q9Y2J2-3|E41L3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:35 ms_run[2]:scan=7384 25.444 2 1767.8349 1767.8349 A K 588 603 PSM RTLTTMAPYLSTEDVPLA 2562 sp|Q8TEX9|IPO4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=8893 28.909 2 1978.0081 1978.0081 L R 182 200 PSM RTYVTPPGTGFLPGDTA 2563 sp|Q9NPF4|OSGEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7919 26.442 2 1748.8733 1748.8733 R R 30 47 PSM RVLSQPMPPTAGEAEQAADQQE 2564 sp|Q9NZL4-2|HPBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6085 23.309 3 2352.1016 2352.1016 L R 98 120 PSM SRIYHDGAL 2565 sp|Q7Z6K5|ARPIN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 1-UNIMOD:1 ms_run[2]:scan=5903 22.999 2 1072.5302 1072.5302 M R 2 11 PSM KLVQDVANNTNEEAGDGTTTATVLA 2566 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9444 31.011404960266667 3 2532.237207 2531.235105 A R 96 121 PSM KDPGMGAMGGMGGGMGGGMF 2567 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35 ms_run[1]:scan=5624 22.5080658224 3 1865.684366 1865.687483 E - 554 574 PSM KDLFDPIIED 2568 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9942 32.76676159626667 2 1204.604975 1203.602320 F R 86 96 PSM KDLFDPIIED 2569 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9738 32.01557295813333 2 1203.601222 1203.602320 F R 86 96 PSM KDLFDPIIED 2570 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9922 32.6910100984 2 1203.601222 1203.602320 F R 86 96 PSM KDLFDPIIED 2571 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9639 31.677689876266665 2 1203.601222 1203.602320 F R 86 96 PSM KDLFDPIIED 2572 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9341 30.65036750746667 2 1203.601222 1203.602320 F R 86 96 PSM KDLFDPIIED 2573 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9541 31.340177491733336 2 1203.601222 1203.602320 F R 86 96 PSM KDLFDPIIED 2574 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9830 32.3557289824 2 1203.601222 1203.602320 F R 86 96 PSM KEELQANGSAPAAD 2575 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=4168 18.350489365866668 2 1400.641767 1399.657937 A K 55 69 PSM KVGINYQPPTVVPGGDLA 2576 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9416 30.910766019733334 2 1823.980040 1823.978149 F K 352 370 PSM KVGINYQPPTVVPGGDLA 2577 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9513 31.2474385608 2 1823.980040 1823.978149 F K 352 370 PSM KDYEEVGVDSVEGEGEEEGEEY 2578 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9484 31.14499964666667 2 2477.000340 2475.992534 E - 430 452 PSM KDLYANTVLSGGTTMYPGIAD 2579 sp|P60709|ACTB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 15-UNIMOD:35 ms_run[1]:scan=9364 30.734858692 2 2203.054295 2202.051451 R R 291 312 PSM KDYEEVGADSADGEDEGEEY 2580 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=9528 31.29383611253333 2 2206.836429 2205.834577 E - 430 450 PSM KSGGGTGEEPGSQGLNGEAGPEDST 2581 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=4735 20.402940081066667 3 2316.983376 2316.994206 S R 172 197 PSM KELAAEDEQVFLMKQQSLLA 2582 sp|O43237|DC1L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:35 ms_run[1]:scan=7456 25.560661878666668 3 2306.174666 2306.182799 D K 352 372 PSM KEVDEQMLNVQN 2583 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 7-UNIMOD:35 ms_run[1]:scan=4759 20.465869055200002 2 1462.660323 1461.676959 M K 324 336 PSM KGEQVSQNGLPAEQGSP 2584 sp|Q01082|SPTB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=4886 20.8064061728 2 1725.819154 1724.832942 S R 2123 2140 PSM RAAVDAGFVPNDMQVGQTG 2585 sp|P13804|ETFA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:35 ms_run[1]:scan=6157 23.419511669866665 2 1948.927619 1947.910875 S K 249 268 PSM KVAEVLQVPPM 2586 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:35 ms_run[1]:scan=7379 25.4372773024 2 1225.674568 1225.674045 N R 100 111 PSM KVLIIGGGDGGVL 2587 sp|P19623|SPEE_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8434 27.555427726133335 2 1197.714357 1196.712873 R R 96 109 PSM KQQAIELTQEEPYSDIIATPGP 2588 sp|O60216|RAD21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8601 28.014470720000002 3 2428.222023 2427.216936 K R 605 627 PSM KEACGGPSAMATPENLASLM 2589 sp|Q14781|CBX2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 4-UNIMOD:4,10-UNIMOD:35,20-UNIMOD:35 ms_run[1]:scan=6532 24.016859903466663 3 2065.911813 2065.911863 A K 219 239 PSM KEEMDFPQLM 2590 sp|O15371|EIF3D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 4-UNIMOD:35,10-UNIMOD:35 ms_run[1]:scan=6351 23.725599298400002 2 1298.548054 1298.552276 V K 171 181 PSM KEPEQEPVPAQFQ 2591 sp|Q96ME7|ZN512_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=5797 22.824501217066665 2 1525.741329 1525.741273 C K 541 554 PSM RAAEDDEDDDVDT 2592 sp|P06454|PTMA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=3761 16.638223624 2 1464.549246 1464.548840 K K 90 103 PSM KPVPDEEPNSTDVEETLE 2593 sp|P28289|TMOD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=6476 23.921039561066667 2 2026.923156 2026.921876 Y R 171 189 PSM KAILILDNDGD 2594 sp|P61923|COPZ1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=7269 25.243314094133332 2 1185.624162 1185.624118 V R 14 25 PSM KAMGYQPLVTMDDAME 2595 sp|Q15738|NSDHL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 11-UNIMOD:35,15-UNIMOD:35 ms_run[1]:scan=6190 23.47054046 2 1830.805123 1830.783809 K R 345 361 PSM RDSAPSTPTSPTEFLTPGL 2596 sp|Q9NZJ4|SACS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8854 28.76714465706667 2 1972.978767 1972.974186 S R 4255 4274 PSM KDLPSVQLLM 2597 sp|O15020|SPTN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 10-UNIMOD:35 ms_run[1]:scan=7671 25.9564055728 2 1159.632787 1158.631846 G K 1518 1528 PSM KCLDENLEDASQC 2598 sp|Q5JTJ3|COA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 2-UNIMOD:4,13-UNIMOD:4 ms_run[1]:scan=4944 20.9531510024 2 1580.665781 1580.644672 W K 67 80 PSM KELSPLPESYLSN 2599 sp|Q8N6M3|FITM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=7720 26.050677608266668 2 1475.760761 1475.750775 L K 39 52 PSM KALQAAYGASAPSVTSAAL 2600 sp|O43488|ARK72_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=7017 24.812210666666665 2 1775.945814 1775.941764 E R 278 297 PSM KDLEPVLSVGVFNN 2601 sp|O14657|TOR1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=8775 28.502563454933334 2 1529.8120 1529.8084 L K 241 255 PSM KEPSPPIDEVINTP 2602 sp|O60684|IMA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=7238 25.192508144266665 2 1534.788421 1534.787889 S R 110 124 PSM KEILSPVDIID 2603 sp|O14495|PLPP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8619 28.0569329064 2 1241.697070 1240.691469 R R 293 304 PSM KDPASLPQCLGPGCV 2604 sp|Q9P0U4|CXXC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 9-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=7090 24.9311515448 2 1598.792025 1597.759249 A R 367 382 PSM KIIGATDSCGDLMFLM 2605 sp|P45973|CBX5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 9-UNIMOD:4,13-UNIMOD:35,16-UNIMOD:35 ms_run[1]:scan=8411 27.484403255466667 2 1803.845461 1802.825280 E K 125 141 PSM KMISEGLDPDLLE 2606 sp|Q9Y3C0|WASC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 2-UNIMOD:35 ms_run[1]:scan=7996 26.591319629599997 2 1474.723734 1474.722512 N R 155 168 PSM KEDLPAENGET 2607 sp|P05114|HMGN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=4234 18.58288363946667 2 1202.530730 1201.546262 T K 71 82 PSM KVNFPENGFLSPD 2608 sp|P31689|DNJA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8466 27.638885761866668 2 1462.702880 1462.709245 F K 325 338 PSM KNLENGALQPSDLD 2609 sp|Q9Y6E0|STK24_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=6078 23.298585316533334 2 1513.724875 1512.742001 P R 347 361 PSM KIIQDESTQEDAM 2610 sp|O95789|ZMYM6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 13-UNIMOD:35 ms_run[1]:scan=4117 18.1527967848 2 1522.666797 1522.682104 A K 660 673 PSM RPAGPQLFLPDPDPQ 2611 sp|Q9BUH6|PAXX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 ms_run[1]:scan=8443 27.5772653352 2 1647.819701 1646.841656 P R 154 169 PSM KVVSVQAASVPIECSQ 2612 sp|Q14934|NFAC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 24 14-UNIMOD:4 ms_run[1]:scan=5998 23.168973916000002 2 1700.898396 1700.876721 G R 564 580 PSM ALRYPMAVGLN 2613 sp|Q9Y3U8|RL36_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 6-UNIMOD:35 ms_run[2]:scan=6595 24.107 2 1219.6383 1219.6383 M K 2 13 PSM GILEKISEIE 2614 sp|P55039|DRG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8585 27.966 2 1129.6231 1129.6231 M K 2 12 PSM KADLINNLGTIA 2615 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7937 26.487 2 1241.698 1241.6980 T K 95 107 PSM KAEDTISILPDDP 2616 sp|Q8WUH1|CHUR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7820 26.247 2 1412.7035 1412.7035 G R 120 133 PSM KAGEVINQPMMMAA 2617 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 12-UNIMOD:35 ms_run[2]:scan=6001 23.173 2 1505.704 1505.7040 Q R 889 903 PSM KALLLVPASVNCL 2618 sp|Q5SRE5-2|NU188_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 12-UNIMOD:4 ms_run[2]:scan=8882 28.869 2 1396.8112 1396.8112 T R 1030 1043 PSM KAMTEDGFLAVCSEA 2619 sp|P08243-3|ASNS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=7160 25.051 2 1643.7171 1643.7171 F K 64 79 PSM KAPGAIGPYSQAVLVD 2620 sp|P52758|RIDA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7418 25.504 2 1584.8512 1584.8512 A R 13 29 PSM KAPILIATDVAS 2621 sp|Q92841|DDX17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7009 24.801 2 1197.6969 1197.6969 G R 468 480 PSM KAVPVPNMTPSGVG 2622 sp|Q6P996-4|PDXD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 8-UNIMOD:35 ms_run[2]:scan=4931 20.921 2 1368.7071 1368.7071 F R 378 392 PSM KAVSTVVVTTAPSP 2623 sp|Q6P4R8-3|NFRKB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5484 22.209 2 1355.766 1355.7660 S K 1278 1292 PSM KDADLTDTAQT 2624 sp|Q13630|FCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4046 17.861 2 1177.5463 1177.5463 S R 44 55 PSM KDDSIEGIYDTL 2625 sp|P23921|RIR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8733 28.359 2 1367.6456 1367.6456 M K 224 236 PSM KDGSPIADDLLE 2626 sp|Q9BYT8|NEUL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7781 26.167 2 1271.6245 1271.6245 Y K 550 562 PSM KDILVATDVAG 2627 sp|Q9BUQ8|DDX23_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6274 23.603 2 1100.6077 1100.6077 A R 715 726 PSM KDIPGLTDTTVP 2628 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7087 24.927 2 1255.666 1255.6660 E R 119 131 PSM KDLFDPIIED 2629 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=10011 33.028 2 1203.6023 1203.6023 F R 86 96 PSM KDLGLAQDSATST 2630 sp|P31937|3HIDH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4820 20.62 2 1305.6412 1305.6412 A K 284 297 PSM KDMFQETMEAM 2631 sp|P35579|MYH9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=5487 22.221 2 1391.5407 1391.5407 D R 316 327 PSM KDVVMEPTM 2632 sp|Q9H0A0-2|NAT10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=4024 17.783 2 1080.4831 1080.4831 A K 850 859 PSM KDVVMEPTM 2633 sp|Q9H0A0-2|NAT10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 9-UNIMOD:35 ms_run[2]:scan=4565 19.87 2 1064.4882 1064.4882 A K 850 859 PSM KEAPPPVLLTP 2634 sp|P48634-2|PRC2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7105 24.954 2 1160.6805 1160.6805 D K 1325 1336 PSM KEDDALWPPPD 2635 sp|P61326|MGN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7211 25.144 2 1281.5877 1281.5877 T R 71 82 PSM KEDDALWPPPD 2636 sp|P61326|MGN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7691 25.996 2 1281.5877 1281.5877 T R 71 82 PSM KEDDLGAVEEQ 2637 sp|Q9BXB4|OSB11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4817 20.611 2 1231.5568 1231.5568 H R 356 367 PSM KEEPLPEEQ 2638 sp|O43491-3|E41L2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4326 18.946 2 1097.5241 1097.5241 D R 114 123 PSM KEETQPPVAL 2639 sp|Q8NC51-4|PAIRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5780 22.796 2 1110.5921 1110.5921 K K 92 102 PSM KEFPFDVQPVPL 2640 sp|Q96BJ3-3|AIDA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=9194 30.187 2 1414.7497 1414.7497 N R 106 118 PSM KEGIPPDQQ 2641 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4633 20.085 2 1010.5033 1010.5033 D R 33 42 PSM KEIEDFDSLEAL 2642 sp|P46060|RAGP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8758 28.443 2 1407.6769 1407.6769 I R 43 55 PSM KEITALAPSTM 2643 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 11-UNIMOD:35 ms_run[2]:scan=9067 29.59 2 1176.606 1176.6060 Q K 315 326 PSM KELEALDEVFT 2644 sp|Q9UMX5|NENF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8611 28.037 2 1292.65 1292.6500 A K 120 131 PSM KELEANVLATAPD 2645 sp|Q9NTJ3-2|SMC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6321 23.677 2 1369.7089 1369.7089 V K 840 853 PSM KELILDVVPSS 2646 sp|Q5H9F3-2|BCORL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8234 27.065 2 1198.6809 1198.6809 P R 1019 1030 PSM KELPIEVTMVCC 2647 sp|O75970-5|MPDZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 9-UNIMOD:35,11-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=7015 24.81 2 1493.6928 1493.6928 L R 620 632 PSM KEMEITEVEPPG 2648 sp|Q9NPI1|BRD7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35 ms_run[2]:scan=5350 21.923 2 1373.6384 1373.6384 A R 497 509 PSM KEMGQMQVLQM 2649 sp|Q92878-3|RAD50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35,6-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4125 18.187 2 1369.604 1369.6040 L K 904 915 PSM KEPPPPYVSA 2650 sp|Q86VI4-2|LAP4B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5033 21.172 2 1083.5601 1083.5601 A - 217 227 PSM KEPSPPIDEVINTP 2651 sp|O60684|IMA7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7282 25.265 2 1534.7879 1534.7879 S R 110 124 PSM KEQNSALPTSSQDEELMEVVE 2652 sp|Q9UQ35-2|SRRM2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8511 27.766 3 2362.0846 2362.0846 T K 1223 1244 PSM KEVDDLTAEL 2653 sp|Q9NTJ3-2|SMC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7265 25.237 2 1131.5659 1131.5659 E K 953 963 PSM KEVDEQMLAIQS 2654 sp|Q13509|TBB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 7-UNIMOD:35 ms_run[2]:scan=5331 21.888 2 1405.6759 1405.6759 M K 324 336 PSM KEVFEDAAEI 2655 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6879 24.583 2 1149.5554 1149.5554 L R 410 420 PSM KEVGEAICTDPLVS 2656 sp|P51649|SSDH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 8-UNIMOD:4 ms_run[2]:scan=6822 24.495 2 1516.7443 1516.7443 A K 265 279 PSM KEVLLFPAM 2657 sp|Q15046|SYK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 9-UNIMOD:35 ms_run[2]:scan=7909 26.421 2 1062.5784 1062.5784 I K 565 574 PSM KEVSEEQPVVTLE 2658 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6214 23.511 2 1485.7563 1485.7563 P K 211 224 PSM KFLDGIYVSE 2659 sp|P32969|RL9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7714 26.041 2 1169.5968 1169.5968 R K 174 184 PSM KFMELLEPLNE 2660 sp|Q01082|SPTB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35 ms_run[2]:scan=8247 27.092 2 1377.685 1377.6850 T R 1466 1477 PSM KGDAMIMEETG 2661 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35,7-UNIMOD:35 ms_run[2]:scan=3785 16.752 2 1212.5002 1212.5002 E K 51 62 PSM KGEIPALPPC 2662 sp|O75439|MPPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=6156 23.417 2 1080.5638 1080.5638 H K 268 278 PSM KGEIPALPPC 2663 sp|O75439|MPPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=6385 23.777 2 1080.5638 1080.5638 H K 268 278 PSM KGLDPLASEDTS 2664 sp|O95229-2|ZWINT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6023 23.21 2 1231.5932 1231.5932 A R 74 86 PSM KGLPLGSAVSSPVLFSPVG 2665 sp|Q8WUM0|NU133_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=9110 29.778 2 1811.0193 1811.0193 R R 35 54 PSM KGLSEDTTEETL 2666 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5375 21.976 2 1321.6249 1321.6249 V K 577 589 PSM KGMITVTDPDLIE 2667 sp|A0AVT1-2|UBA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35 ms_run[2]:scan=7086 24.925 2 1446.7276 1446.7276 E K 16 29 PSM KGVEAGPDLLQ 2668 sp|O60506-5|HNRPQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6306 23.661 2 1125.603 1125.6030 G - 400 411 PSM KGVNLPGAAVDLPAVSE 2669 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=9611 31.575 2 1635.8832 1635.8832 K K 207 224 PSM KIDATSASVLAS 2670 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5536 22.333 2 1161.6241 1161.6241 A R 119 131 PSM KIEDGNDFGVAIQE 2671 sp|Q9UL46|PSME2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7238 25.193 2 1533.7311 1533.7311 P K 131 145 PSM KIEGTPLETIQ 2672 sp|O43676|NDUB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6417 23.828 2 1227.6711 1227.6711 W K 23 34 PSM KIFVGGLSPDTPEE 2673 sp|Q14103-4|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=9449 31.03 2 1487.7508 1487.7508 K K 164 178 PSM KIISDNLTYC 2674 sp|Q9Y2X3|NOP58_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=5982 23.145 2 1225.6013 1225.6013 G K 196 206 PSM KITMIAEPLE 2675 sp|Q15029-2|U5S1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 4-UNIMOD:35 ms_run[2]:scan=6154 23.415 2 1159.6159 1159.6159 N K 649 659 PSM KIVYPPQLPGEP 2676 sp|Q9NWU5|RM22_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7433 25.526 2 1336.7391 1336.7391 N R 50 62 PSM KLATQLTGPVMPV 2677 sp|P26373-2|RL13_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7827 26.261 2 1353.769 1353.7690 L R 98 111 PSM KLAVNMVPFP 2678 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 6-UNIMOD:35 ms_run[2]:scan=8010 26.613 2 1130.6158 1130.6158 R R 252 262 PSM KLDDDGLIAPGV 2679 sp|P30876|RPB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7548 25.734 2 1211.6398 1211.6398 D R 847 859 PSM KLDPGLIMEQV 2680 sp|Q9Y5L4|TIM13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 8-UNIMOD:35 ms_run[2]:scan=7176 25.079 2 1257.6639 1257.6639 G K 16 27 PSM KLGDEDEEIDGDTN 2681 sp|P09884|DPOLA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4748 20.437 2 1548.6427 1548.6427 Q K 815 829 PSM KLIADVAPSAI 2682 sp|P39748|FEN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7219 25.16 2 1096.6492 1096.6492 A R 8 19 PSM KLLVLDPAQ 2683 sp|P50750|CDK9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7237 25.189 2 995.60153 995.6015 D R 294 303 PSM KLMPEIVATAS 2684 sp|Q92616|GCN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6853 24.544 2 1158.6318 1158.6318 E K 1734 1745 PSM KLNSNTQVVLLSATMPSDVLEVT 2685 sp|P60842-2|IF4A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 15-UNIMOD:35 ms_run[2]:scan=8983 29.236 3 2474.2938 2474.2938 Q K 202 225 PSM KLPSPLDITAE 2686 sp|Q7Z2Z2-2|EFL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8095 26.776 2 1182.6496 1182.6496 Q R 311 322 PSM KLPTPTSSVPAQ 2687 sp|Q9BTA9-3|WAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5049 21.209 2 1224.6714 1224.6714 S K 245 257 PSM KLSDPGIPITVLS 2688 sp|P23458|JAK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8560 27.889 2 1338.7759 1338.7759 I R 736 749 PSM KLTADPDSEIATTSL 2689 sp|O75928-3|PIAS2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6994 24.777 2 1560.7883 1560.7883 E R 330 345 PSM KLVMEEAPESY 2690 sp|Q9Y3I0|RTCB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 4-UNIMOD:35 ms_run[2]:scan=5277 21.768 2 1310.6064 1310.6064 P K 465 476 PSM KMALVLEALPQIAA 2691 sp|Q14254|FLOT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 2-UNIMOD:35 ms_run[2]:scan=8952 29.113 2 1482.848 1482.8480 A K 356 370 PSM KMFVLDEADEMLS 2692 sp|P60842-2|IF4A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 2-UNIMOD:35 ms_run[2]:scan=8178 26.945 2 1542.6946 1542.6946 I R 177 190 PSM KMIEEAGAIIST 2693 sp|O00154-2|BACH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 2-UNIMOD:35 ms_run[2]:scan=5835 22.888 2 1277.6537 1277.6537 L R 36 48 PSM KPEDPSLLEDP 2694 sp|P15121|ALDR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6184 23.46 2 1238.603 1238.6030 A R 222 233 PSM KPEEEITVGPVQ 2695 sp|P53618|COPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5832 22.884 2 1324.6874 1324.6874 L K 501 513 PSM KPEPELNAAIPSANPA 2696 sp|Q8WUM4|PDC6I_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6448 23.876 2 1617.8362 1617.8362 C K 525 541 PSM KPLSSLTPLIAAA 2697 sp|Q13153|PAK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8631 28.082 2 1280.7704 1280.7704 A K 525 538 PSM KPLSSLTPLIMAA 2698 sp|Q13177|PAK2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 11-UNIMOD:35 ms_run[2]:scan=8487 27.702 2 1356.7687 1356.7687 A K 504 517 PSM KPLTQSGGAPPPPGG 2699 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4219 18.526 2 1359.7147 1359.7147 E K 2121 2136 PSM KPLTSSSAAPQ 2700 sp|Q15691|MARE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=3652 16.113 2 1085.5717 1085.5717 K R 151 162 PSM KPTLMAAVPEIMD 2701 sp|O60488-2|ACSL4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=6565 24.063 2 1446.7098 1446.7098 L R 326 339 PSM KPTLMAAVPEIMD 2702 sp|O60488-2|ACSL4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=6577 24.079 2 1446.7098 1446.7098 L R 326 339 PSM KPVLMALAEGPGAEGP 2703 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35 ms_run[2]:scan=9442 31.005 2 1551.7967 1551.7967 T R 575 591 PSM KPVLMALAEGPGAEGP 2704 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35 ms_run[2]:scan=9643 31.694 2 1551.7967 1551.7967 T R 575 591 PSM KQDVVLNYPM 2705 sp|Q15029-2|U5S1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:35 ms_run[2]:scan=5991 23.158 2 1221.6064 1221.6064 A - 928 938 PSM KQPEDDLGFDPFDVT 2706 sp|O95628-5|CNOT4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=9179 30.113 2 1721.7784 1721.7784 S R 397 412 PSM KSCTQSATAPQQEADAEVNTETLN 2707 sp|Q9ULU4-2|PKCB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:4 ms_run[2]:scan=5465 22.172 3 2592.161 2592.1610 M K 488 512 PSM KSGDAAIVDMVPG 2708 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:35 ms_run[2]:scan=5285 21.789 2 1274.6177 1274.6177 L K 395 408 PSM KSGLPVGPENGVELS 2709 sp|P08240-2|SRPRA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6772 24.412 2 1481.7726 1481.7726 E K 163 178 PSM KSLEDQVEML 2710 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 9-UNIMOD:35 ms_run[2]:scan=5595 22.459 2 1206.5802 1206.5802 K R 167 177 PSM KSLTANPELID 2711 sp|Q9Y2L1-2|RRP44_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6063 23.269 2 1199.6398 1199.6398 V R 169 180 PSM KSPDSATVSGYDIM 2712 sp|Q6WCQ1-3|MPRIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 14-UNIMOD:35 ms_run[2]:scan=5613 22.488 2 1485.6657 1485.6657 E K 938 952 PSM KSPEPEVLSTQEDLFDQSN 2713 sp|Q12888|TP53B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8140 26.86 3 2162.0015 2162.0015 Q K 293 312 PSM KSPFSVAVSPSLDLS 2714 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8682 28.222 2 1532.8086 1532.8086 P K 958 973 PSM KSTLTDSLVC 2715 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=5418 22.079 2 1122.5591 1122.5591 G K 32 42 PSM KTALPAQSAATLPA 2716 sp|Q01082|SPTB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5714 22.673 2 1338.7507 1338.7507 A R 2177 2191 PSM KTCGFDFTGAVEDIS 2717 sp|P00505|AATM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:4 ms_run[2]:scan=8698 28.263 2 1645.7294 1645.7294 P K 185 200 PSM KTDGFGIDTC 2718 sp|P04632|CPNS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=5976 23.137 2 1112.4808 1112.4808 L R 135 145 PSM KTETQAEDTEPDPGES 2719 sp|Q92793-2|CBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=3845 17.062 2 1732.7275 1732.7275 M K 960 976 PSM KTGAAPIIDVV 2720 sp|P46776|RL27A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7515 25.674 2 1082.6336 1082.6336 N R 94 105 PSM KTGDVEDSTVL 2721 sp|Q9UNN5-2|FAF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5493 22.234 2 1162.5717 1162.5717 W K 146 157 PSM KTLFVGLPPPAD 2722 sp|O15381-3|NVL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7942 26.495 2 1253.702 1253.7020 D R 545 557 PSM KTPLPPELADVQA 2723 sp|Q9Y5V0|ZN706_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8024 26.638 2 1377.7504 1377.7504 P - 64 77 PSM KTVFGVEPDLT 2724 sp|Q96KP4-2|CNDP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7561 25.754 2 1204.634 1204.6340 M R 318 329 PSM KVAAPDVVVPTLDTV 2725 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8468 27.647 2 1522.8607 1522.8607 H R 2561 2576 PSM KVAGQDGSVVQF 2726 sp|P61956-2|SUMO2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6614 24.138 2 1233.6354 1233.6354 L K 21 33 PSM KVAMANIQPQMLVAGATSIA 2727 sp|P18206-2|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 4-UNIMOD:35 ms_run[2]:scan=8655 28.133 3 2029.07 2029.0700 C R 738 758 PSM KVDATAETDLA 2728 sp|P13667|PDIA4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4862 20.731 2 1132.5612 1132.5612 A K 234 245 PSM KVEMQPTELVS 2729 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 4-UNIMOD:35 ms_run[2]:scan=5048 21.207 2 1275.6381 1275.6381 S K 160 171 PSM KVFSLMDPNSPE 2730 sp|Q7L5D6-2|GET4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 6-UNIMOD:35 ms_run[2]:scan=6410 23.818 2 1378.6439 1378.6439 A R 57 69 PSM KVGDPQELNGIT 2731 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5729 22.701 2 1269.6565 1269.6565 T R 298 310 PSM KVGINYQPPTVVPGGDLA 2732 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8002 26.601 2 1823.9781 1823.9781 F K 352 370 PSM KVIGPEPTGFLL 2733 sp|Q8IUH4-2|ZDH13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8929 29.039 2 1269.7333 1269.7333 H K 16 28 PSM KVIVPNMEF 2734 sp|P55060-4|XPO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 7-UNIMOD:35 ms_run[2]:scan=6397 23.796 2 1091.5685 1091.5685 E R 290 299 PSM KVLEVPPVVYS 2735 sp|O00154-2|BACH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7524 25.686 2 1228.7067 1228.7067 D R 130 141 PSM KVLVDSLVEDD 2736 sp|Q92621|NU205_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7191 25.105 2 1230.6343 1230.6343 L R 1523 1534 PSM KVPDGMVGFIIG 2737 sp|Q96AE4|FUBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 6-UNIMOD:35 ms_run[2]:scan=8222 27.042 2 1247.6584 1247.6584 Y R 106 118 PSM KYQLDPTASISA 2738 sp|P45880-2|VDAC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6540 24.027 2 1292.6612 1292.6612 A K 224 236 PSM PAVSKGDGM 2739 sp|O94973-3|AP2A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 9-UNIMOD:35 ms_run[2]:scan=3372 14.935 2 876.40112 876.4011 M R 2 11 PSM PEPAKSAPAP 2740 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=3565 15.687 2 963.50255 963.5025 M K 2 12 PSM PGHLQEGFGCVVTN 2741 sp|Q8NC51-4|PAIRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4 ms_run[2]:scan=9823 32.332 2 1513.6984 1513.6984 M R 2 16 PSM RADGYEPPVQESV 2742 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5612 22.486 2 1445.6787 1445.6787 E - 252 265 PSM RAEEDVEPECIME 2743 sp|Q9UJU6-5|DBNL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 10-UNIMOD:4,12-UNIMOD:35 ms_run[2]:scan=5323 21.874 2 1621.66 1621.6600 A K 15 28 PSM RAFDEDEDDPYVPM 2744 sp|O14654|IRS4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 14-UNIMOD:35 ms_run[2]:scan=6499 23.953 2 1713.6828 1713.6828 A R 690 704 PSM RDGMDNQGGYGSVG 2745 sp|P31942-4|HNRH3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 4-UNIMOD:35 ms_run[2]:scan=4206 18.472 2 1427.5736 1427.5736 G R 156 170 PSM RDPEDPSAVAL 2746 sp|Q9UBF8-3|PI4KB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5966 23.12 2 1168.5724 1168.5724 K K 191 202 PSM RDVEDVPITVE 2747 sp|Q13895|BYST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6520 23.998 2 1270.6405 1270.6405 P - 427 438 PSM RELDMEPYTVAGVA 2748 sp|Q93008|USP9X_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 5-UNIMOD:35 ms_run[2]:scan=6727 24.33 2 1565.7396 1565.7396 P K 1820 1834 PSM RFDDAVVQSDM 2749 sp|P11142-2|HSP7C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 11-UNIMOD:35 ms_run[2]:scan=5097 21.32 2 1297.5609 1297.5609 R K 77 88 PSM RILGADTSVDLEETG 2750 sp|P25705-2|ATPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6993 24.776 2 1574.7788 1574.7788 E R 8 23 PSM RINPDGSQSVVEVPYA 2751 sp|Q9Y2B0|CNPY2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7124 24.982 2 1729.8635 1729.8635 F R 57 73 PSM RLLVVDPETDEQLQ 2752 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=7566 25.763 2 1653.8574 1653.8574 V K 87 101 PSM RLTGDVLQPPGTSVPIV 2753 sp|Q9UQR0|SCML2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=8593 27.991 2 1747.9832 1747.9832 C K 231 248 PSM RPPNEPEETPVQ 2754 sp|Q53H12|AGK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4296 18.842 2 1391.6681 1391.6681 E R 260 272 PSM RSGDETPGSEVPGD 2755 sp|Q1KMD3|HNRL2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=4271 18.738 2 1401.6008 1401.6008 E K 160 174 PSM RTDQDSVIGVSPAVMI 2756 sp|Q8WXG6-6|MADD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 15-UNIMOD:35 ms_run[2]:scan=8139 26.857 2 1702.856 1702.8560 Q R 1092 1108 PSM RYFEADPPGQVAASPDPTT 2757 sp|O43598|DNPH1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6148 23.404 3 2017.9381 2017.9381 D - 156 175 PSM KLVQDVANNTNEEAGDGTTTATVLA 2758 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9361 30.723977587466667 3 2532.237207 2531.235105 A R 96 121 PSM KLVQDVANNTNEEAGDGTTTATVLA 2759 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9387 30.824335172266668 3 2532.237207 2531.235105 A R 96 121 PSM KDPGMGAMGGMGGGMGGGMF 2760 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=4583 19.9199496032 2 1850.677351 1849.692568 E - 554 574 PSM KYTPTQQGNMQVLVTYGGDPIP 2761 sp|O75369|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 10-UNIMOD:35 ms_run[1]:scan=7896 26.394531431466664 3 2423.189483 2422.183862 V K 909 931 PSM KDLFDPIIED 2762 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9439 30.9959152664 2 1203.601222 1203.602320 F R 86 96 PSM KVLSSAASLPGSELPSS 2763 sp|O15027|SC16A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6585 24.089502982933332 2 1628.866764 1628.862117 P R 2264 2281 PSM KCLMDQATDPNILG 2764 sp|P78527|PRKDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 2-UNIMOD:4,4-UNIMOD:35 ms_run[1]:scan=6222 23.52201717066667 2 1590.732334 1590.738179 V R 4105 4119 PSM KEITALAPSTM 2765 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 11-UNIMOD:35 ms_run[1]:scan=10142 33.58140208106666 2 1176.605453 1176.606025 Q K 317 328 PSM KLYTLVLTDPDAPS 2766 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9420 30.926894909866668 2 1531.810166 1531.813375 G R 62 76 PSM RALTVPELTQQVFDA 2767 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9143 29.947051384799998 2 1686.909682 1686.894085 Y K 282 297 PSM KNIDINDVTPNC 2768 sp|P62195|PRS8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:4 ms_run[1]:scan=5661 22.576571414933333 2 1401.654629 1401.655829 D R 101 113 PSM RDPGVITYDLPTPPGE 2769 sp|P26640|SYVC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=8019 26.6288194576 2 1725.858250 1725.857366 K K 273 289 PSM KEFLQTESPESTELQS 2770 sp|Q8WXH0|SYNE2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6364 23.747280254133333 2 1852.876992 1851.873804 S R 6618 6634 PSM KEAVFDDDMEQL 2771 sp|Q7Z460|CLAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 9-UNIMOD:35 ms_run[1]:scan=6442 23.8656378432 2 1454.622045 1454.623526 L R 1282 1294 PSM RFEVQGLQPNGEEMTL 2772 sp|P22314|UBA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 14-UNIMOD:35 ms_run[1]:scan=7865 26.333806762666665 2 1863.867022 1862.883263 D K 957 973 PSM KDDEIEQLSTVLNLPT 2773 sp|Q86UP3|ZFHX4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9237 30.360294468266666 2 1813.948948 1813.930924 P R 2207 2223 PSM KTEPPQGEDQVDICNL 2774 sp|A1X283|SPD2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 14-UNIMOD:4 ms_run[1]:scan=7156 25.045246563733333 2 1841.844000 1841.846543 P R 651 667 PSM KVIFVDDYAVGC 2775 sp|Q9NR09|BIRC6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:4 ms_run[1]:scan=8079 26.749987537600003 2 1385.672284 1384.669688 D R 125 137 PSM KPTDSSPEVINYLGN 2776 sp|Q96Q15|SMG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7375 25.429923191466667 2 1632.808440 1632.799516 S K 1174 1189 PSM KEQVLEPMLNGTD 2777 sp|Q02880|TOP2B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 8-UNIMOD:35 ms_run[1]:scan=6006 23.184802933866667 2 1489.691896 1488.713010 Y K 957 970 PSM KELVYPPDYNPEG 2778 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9692 31.87000340373333 2 1520.728977 1519.719475 F K 526 539 PSM KELVYPPDYNPEG 2779 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=9632 31.6528046112 2 1520.722263 1519.719475 F K 526 539 PSM KDIVVQETMEDID 2780 sp|O43852|CALU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7282 25.264947218133333 2 1533.725015 1533.723240 M K 189 202 PSM KQQVTILATPLPEESM 2781 sp|Q12846|STX4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=8409 27.477001226933332 2 1783.938999 1783.938987 E K 64 80 PSM KLIAPVAEEEATVPNN 2782 sp|P07195|LDHB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6463 23.902202311200003 2 1694.871575 1693.888666 E K 7 23 PSM KTFVSDLLPPTD 2783 sp|Q7Z4Q2|HEAT3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=8606 28.026068651733333 2 1332.697630 1331.697283 R K 339 351 PSM KGLAITFVSDENDA 2784 sp|O00148|DX39A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7897 26.396952169066665 2 1479.700693 1478.725289 T K 383 397 PSM KTIALNGVEDV 2785 sp|Q3ZCQ8|TIM50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6591 24.097438325066665 2 1158.613572 1157.629203 L R 284 295 PSM KTIALNGVEDV 2786 sp|Q3ZCQ8|TIM50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6567 24.0650199072 2 1158.613572 1157.629203 L R 284 295 PSM KAPGAIGPYSQAVLVD 2787 sp|P52758|RIDA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7374 25.428844257066665 2 1584.849786 1584.851158 A R 13 29 PSM KEVGEAICTDPLVS 2788 sp|P51649|SSDH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 8-UNIMOD:4 ms_run[1]:scan=6844 24.527860401599998 2 1516.742686 1516.744310 A K 265 279 PSM KPTLMAAVPEIMD 2789 sp|O95573|ACSL3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:35 ms_run[1]:scan=7886 26.379571028533334 2 1431.717842 1430.714924 L R 376 389 PSM KPTLMAAVPEIMD 2790 sp|O95573|ACSL3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 12-UNIMOD:35 ms_run[1]:scan=7945 26.499989140533334 2 1431.717842 1430.714924 L R 376 389 PSM KEQISDIDDAV 2791 sp|P53999|TCP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 23 ms_run[1]:scan=6023 23.210379614399997 2 1231.5907 1231.5927 L R 114 125 PSM KILDVGCGGGLLTEPLG 2792 sp|Q9NZJ6|COQ3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 7-UNIMOD:4 ms_run[1]:scan=8862 28.800227832 2 1697.913736 1697.902208 M R 149 166 PSM RTETDSVGTPQSNGGM 2793 sp|Q9H0H5|RGAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 16-UNIMOD:35 ms_run[1]:scan=3778 16.719773053066668 2 1651.698408 1651.710778 P R 269 285 PSM KTLEEDEEELF 2794 sp|P43487|RANG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7669 25.952836374933334 2 1380.628186 1380.629657 I K 39 50 PSM KSPAGLQVLNDYLAD 2795 sp|P24534|EF1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=8308 27.244151179466666 2 1603.809585 1602.825337 L K 7 22 PSM KIQSSGGPLQITM 2796 sp|Q9HAB8|PPCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 13-UNIMOD:35 ms_run[1]:scan=5983 23.145863389333332 2 1375.731056 1374.717701 H K 195 208 PSM KELILFSNSDNE 2797 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=8030 26.651267459733333 2 1409.685240 1407.688175 N R 701 713 PSM KDCEVVMMIGLPGAG 2798 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 3-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=7185 25.093217391733333 2 1607.734715 1607.735737 K K 495 510 PSM KDNFTLIPEGTNGTEE 2799 sp|Q16555|DPYL2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=7567 25.7647502064 2 1764.838667 1763.821374 G R 345 361 PSM KLESVSEDPTQLEEVE 2800 sp|Q96KG9|SCYL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 ms_run[1]:scan=6804 24.462104632 2 1832.911565 1830.873469 S K 536 552 PSM KTAQETSTMTMNVSQVDDVVSS 2801 sp|Q8WYP5|ELYS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 23 9-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=5445 22.130151541866667 3 2389.060026 2389.062486 F K 1716 1738 PSM KAALIYTCTVC 2802 sp|Q9Y5V0|ZN706_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 8-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=6245 23.56 2 1298.6363 1298.6363 A R 34 45 PSM KADGTATAPPP 2803 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3523 15.494 2 1024.5189 1024.5189 Q R 706 717 PSM KAGDEIDEPSE 2804 sp|Q96ME7-2|ZN512_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4211 18.493 2 1188.5146 1188.5146 L R 150 161 PSM KALDLDSSC 2805 sp|P31948-3|STIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:4 ms_run[2]:scan=4838 20.673 2 1007.4594 1007.4594 Q K 429 438 PSM KAPDDLVAPVV 2806 sp|O43172-2|PRP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7122 24.98 2 1122.6285 1122.6285 T K 14 25 PSM KAPGFLQPPPL 2807 sp|Q9H074|PAIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8421 27.516 2 1163.6703 1163.6703 P R 49 60 PSM KAVTELNEPLSNED 2808 sp|Q04917|1433F_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5678 22.609 2 1557.7522 1557.7522 M R 28 42 PSM KCDEPILSN 2809 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 2-UNIMOD:4 ms_run[2]:scan=4807 20.588 2 1074.5016 1074.5016 L R 132 141 PSM KDAFPPLPE 2810 sp|Q00341-2|VIGLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7763 26.129 2 1012.5229 1012.5229 Y K 77 86 PSM KDAIAILDGIPS 2811 sp|Q9UJX3-2|APC7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8832 28.685 2 1211.6762 1211.6762 D R 153 165 PSM KDATNVGDEGGFAPNILEN 2812 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9998 32.977 2 1959.9174 1959.9174 G K 202 221 PSM KDDVVTFIDA 2813 sp|Q96J01-2|THOC3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7985 26.571 2 1121.5605 1121.5605 N K 161 171 PSM KDGTSPEEEIEIE 2814 sp|Q9H501|ESF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6300 23.653 2 1474.6675 1474.6675 A R 690 703 PSM KDIQEDSGMEP 2815 sp|O75844|FACE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:35 ms_run[2]:scan=3916 17.357 2 1263.5289 1263.5289 N R 292 303 PSM KDITDVDEM 2816 sp|Q6NUQ1|RINT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:35 ms_run[2]:scan=4370 19.129 2 1080.4645 1080.4645 Y K 465 474 PSM KDIVENYFM 2817 sp|Q13263|TIF1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:35 ms_run[2]:scan=7696 26.004 2 1173.5376 1173.5376 S R 127 136 PSM KDLDEDELLGNLSETEL 2818 sp|Q9NYL9|TMOD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9166 30.055 2 1931.9211 1931.9211 Y K 13 30 PSM KDLGLAQDSATST 2819 sp|P31937|3HIDH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4720 20.367 2 1305.6412 1305.6412 A K 284 297 PSM KDLLTIPPGF 2820 sp|Q15477|SKIV2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9006 29.33 2 1099.6277 1099.6277 E K 181 191 PSM KDLQMVNISL 2821 sp|Q99623-2|PHB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 5-UNIMOD:35 ms_run[2]:scan=7451 25.552 2 1175.622 1175.6220 S R 97 107 PSM KDMSPLSETEMALG 2822 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 3-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=7180 25.084 2 1539.6797 1539.6797 L K 504 518 PSM KDNPLDPVLA 2823 sp|Q96AG4|LRC59_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7025 24.827 2 1080.5815 1080.5815 L K 116 126 PSM KDPNCVGTVLAS 2824 sp|Q96EP5-2|DAZP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 5-UNIMOD:4 ms_run[2]:scan=5441 22.124 2 1259.618 1259.6180 F R 59 71 PSM KDTEPLIQTA 2825 sp|P48643-2|TCPE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5321 21.868 2 1114.587 1114.5870 I K 67 77 PSM KDVDGVTDINLG 2826 sp|Q6UB35|C1TM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6598 24.11 2 1244.6248 1244.6248 E K 177 189 PSM KDVFSPIGE 2827 sp|P55786-2|PSA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7132 24.996 2 990.50221 990.5022 V R 600 609 PSM KDVQMLQDAIS 2828 sp|Q16543|CDC37_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 5-UNIMOD:35 ms_run[2]:scan=5513 22.278 2 1262.6177 1262.6177 V K 312 323 PSM KDVSGPMPDSYSP 2829 sp|P26640|SYVC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=4933 20.925 2 1394.6024 1394.6024 K R 290 303 PSM KEAIEGTYID 2830 sp|P62280|RS11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5692 22.636 2 1137.5554 1137.5554 P K 48 58 PSM KEALTYDGALLGD 2831 sp|Q15056-2|IF4H_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7636 25.893 2 1364.6824 1364.6824 L R 96 109 PSM KEAMEDGEIDGN 2832 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 4-UNIMOD:35 ms_run[2]:scan=3872 17.182 2 1322.5296 1322.5296 A K 627 639 PSM KECSIYLIGGSIPEEDAG 2833 sp|Q9NQR4|NIT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 3-UNIMOD:4 ms_run[2]:scan=8369 27.384 2 1936.9088 1936.9088 A K 74 92 PSM KEDGTLPTNN 2834 sp|Q9NXF1-2|TEX10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3788 16.768 2 1087.5146 1087.5146 L R 48 58 PSM KEDTVQVSTLL 2835 sp|Q96AY3|FKB10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7780 26.165 2 1231.666 1231.6660 N R 152 163 PSM KEDVDDLVSQL 2836 sp|P12270|TPR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8534 27.824 2 1259.6245 1259.6245 N R 931 942 PSM KEEDEEEDVPGQA 2837 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4281 18.78 2 1473.6107 1473.6107 D K 401 414 PSM KEEDSAIPITVPG 2838 sp|Q99856|ARI3A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7092 24.933 2 1354.698 1354.6980 K R 399 412 PSM KEEIGNVQLE 2839 sp|Q86UP2-2|KTN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6099 23.331 2 1157.5928 1157.5928 L K 842 852 PSM KEGALCEENM 2840 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 6-UNIMOD:4,10-UNIMOD:35 ms_run[2]:scan=3794 16.801 2 1195.4849 1195.4849 T R 688 698 PSM KEGTICTESSQQEPIT 2841 sp|Q8N5U6|RNF10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 6-UNIMOD:4 ms_run[2]:scan=4867 20.745 2 1806.8306 1806.8306 L K 478 494 PSM KELLESLPLS 2842 sp|Q13042-4|CDC16_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8450 27.6 2 1127.6438 1127.6438 E K 88 98 PSM KELTAPDENIPA 2843 sp|P11387|TOP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5524 22.312 2 1296.6561 1296.6561 L K 603 615 PSM KELTDEEAE 2844 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3627 15.988 2 1062.4717 1062.4717 I R 105 114 PSM KELVYPPDYNPEG 2845 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9332 30.618 2 1519.7195 1519.7195 F K 485 498 PSM KEMAIPVLEA 2846 sp|P54886-2|P5CS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 3-UNIMOD:35 ms_run[2]:scan=6947 24.699 2 1115.5896 1115.5896 L R 149 159 PSM KETQIITGSDESC 2847 sp|Q9HAW4-3|CLSPN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 13-UNIMOD:4 ms_run[2]:scan=4588 19.932 2 1466.6559 1466.6559 S R 385 398 PSM KEVFGDDSEIS 2848 sp|O43395|PRPF3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5629 22.518 2 1224.551 1224.5510 L K 92 103 PSM KFGDPVVQSDM 2849 sp|P0DMV9|HS71B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6387 23.779 2 1221.57 1221.5700 R K 77 88 PSM KGCDVVVIPAGVP 2850 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 3-UNIMOD:4 ms_run[2]:scan=8081 26.752 2 1309.7064 1309.7064 L R 91 104 PSM KGGIVGMTLPIA 2851 sp|Q99714-2|HCD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=7329 25.35 2 1171.6635 1171.6635 S R 172 184 PSM KGIDPFSLDALS 2852 sp|P40227-2|TCPZ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9089 29.682 2 1261.6554 1261.6554 Q K 250 262 PSM KGLQPEDVNLLVTC 2853 sp|P53794|SC5A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 14-UNIMOD:4 ms_run[2]:scan=8265 27.135 2 1584.8181 1584.8181 I R 596 610 PSM KIDGSLEVPLE 2854 sp|Q9NVM9-2|INT13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7483 25.615 2 1198.6445 1198.6445 Y R 335 346 PSM KIDPLAPLD 2855 sp|P11766|ADHX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7974 26.549 2 980.55425 980.5542 A K 159 168 PSM KIDPLAPLD 2856 sp|P11766|ADHX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8168 26.918 2 980.55425 980.5542 A K 159 168 PSM KIDTIEIITD 2857 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7537 25.706 2 1159.6336 1159.6336 G R 137 147 PSM KIFVGGLSPDTPEE 2858 sp|Q14103-4|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9550 31.367 2 1487.7508 1487.7508 K K 164 178 PSM KIIDGLLVM 2859 sp|O43447-2|PPIH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:35 ms_run[2]:scan=7579 25.782 2 1016.594 1016.5940 G R 100 109 PSM KIVMETVPVL 2860 sp|Q9Y6K9|NEMO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 4-UNIMOD:35 ms_run[2]:scan=7323 25.338 2 1143.6573 1143.6573 H K 292 302 PSM KLAVNMVPFP 2861 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 6-UNIMOD:35 ms_run[2]:scan=7825 26.259 2 1130.6158 1130.6158 R R 252 262 PSM KLIEEVMIGED 2862 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=6816 24.484 2 1290.6377 1290.6377 C K 300 311 PSM KLITNDTFQPEIME 2863 sp|Q96RT1-7|ERBIN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 13-UNIMOD:35 ms_run[2]:scan=7340 25.374 2 1693.8233 1693.8233 N R 769 783 PSM KLLDDAMAAD 2864 sp|Q9HC38-2|GLOD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=4878 20.784 2 1077.5012 1077.5012 S K 273 283 PSM KLLGPLGM 2865 sp|P35573-2|GDE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 8-UNIMOD:35 ms_run[2]:scan=6751 24.368 2 843.48881 843.4888 K K 1390 1398 PSM KLPDLSPVEN 2866 sp|Q9Y520-3|PRC2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6459 23.896 2 1110.5921 1110.5921 Q K 2100 2110 PSM KLPVSVPMPIA 2867 sp|Q9Y6R4-2|M3K4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8522 27.796 2 1150.6784 1150.6784 A R 197 208 PSM KLQDLLVVPMQ 2868 sp|P52735-3|VAV2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 10-UNIMOD:35 ms_run[2]:scan=8292 27.194 2 1298.7268 1298.7268 F R 319 330 PSM KLSILYPATTG 2869 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7346 25.386 2 1162.6598 1162.6598 L R 144 155 PSM KLVQDVANNTNEEAGDGTTTATVLA 2870 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9317 30.561 3 2531.2351 2531.2351 A R 96 121 PSM KLVQDVANNTNEEAGDGTTTATVLA 2871 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9417 30.916 3 2531.2351 2531.2351 A R 96 121 PSM KMISDAIPEL 2872 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 2-UNIMOD:35 ms_run[2]:scan=7754 26.11 2 1131.5846 1131.5846 E K 272 282 PSM KMNLPGEVTFLPLN 2873 sp|Q9UQE7|SMC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9171 30.078 2 1571.8381 1571.8382 N K 578 592 PSM KPDPTPLLTS 2874 sp|Q9H1I8-3|ASCC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5715 22.675 2 1067.5863 1067.5863 M R 450 460 PSM KPETQSSPITVQSS 2875 sp|Q96CB8|INT12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4646 20.128 2 1487.7468 1487.7468 E K 122 136 PSM KPGDLESAPVL 2876 sp|P11717|MPRI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6825 24.499 2 1124.6077 1124.6077 C R 587 598 PSM KPLLPEPEE 2877 sp|P20810-4|ICAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5934 23.061 2 1050.5597 1050.5597 G K 309 318 PSM KPTTSPLIPTTTPA 2878 sp|Q9NZ52-3|GGA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6281 23.615 2 1423.7922 1423.7922 V R 412 426 PSM KSDAPDTLLLE 2879 sp|P53611|PGTB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7527 25.691 2 1200.6238 1200.6238 I K 11 22 PSM KSGDAAIVDMVPG 2880 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 10-UNIMOD:35 ms_run[2]:scan=5634 22.527 2 1274.6177 1274.6177 L K 395 408 PSM KSGDAAIVDMVPG 2881 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7362 25.41 2 1258.6227 1258.6227 L K 395 408 PSM KSPASDTYIVFGEA 2882 sp|E9PAV3|NACAM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8032 26.654 2 1483.7195 1483.7195 Y K 1976 1990 PSM KSSLGPVGLD 2883 sp|P17987|TCPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6134 23.381 2 971.52876 971.5288 V K 33 43 PSM KSTVVPVPYE 2884 sp|P78347-5|GTF2I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6124 23.366 2 1117.6019 1117.6019 G K 130 140 PSM KTAAFALPVLE 2885 sp|Q96GQ7|DDX27_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8885 28.881 2 1158.6649 1158.6649 G R 268 279 PSM KTEMIDQEEGIS 2886 sp|Q99598|TSNAX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 4-UNIMOD:35 ms_run[2]:scan=4667 20.203 2 1394.6235 1394.6235 V - 279 291 PSM KTFDQLTPEES 2887 sp|O43852-10|CALU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5616 22.493 2 1293.6089 1293.6089 A K 59 70 PSM KTGDPNQPVPQDT 2888 sp|Q8NFZ3-2|NLGNY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3927 17.407 2 1395.663 1395.6630 A K 364 377 PSM KTGQPMINLYTD 2889 sp|P35637-2|FUS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 6-UNIMOD:35 ms_run[2]:scan=6232 23.538 2 1395.6704 1395.6704 K R 315 327 PSM KTIEDTLMTV 2890 sp|P53367-3|ARFP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 8-UNIMOD:35 ms_run[2]:scan=7154 25.042 2 1165.59 1165.5900 N K 68 78 PSM KTIETSPSLS 2891 sp|Q9NVI1-2|FANCI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4622 20.049 2 1061.5605 1061.5605 G R 402 412 PSM KTLDPDPAI 2892 sp|P55060-4|XPO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5637 22.532 2 968.51786 968.5179 K R 17 26 PSM KTLEELDPES 2893 sp|Q6P161|RM54_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5681 22.615 2 1159.5608 1159.5608 P R 105 115 PSM KTLIEAGLPQ 2894 sp|O43390-3|HNRPR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6659 24.213 2 1068.6179 1068.6179 Y K 31 41 PSM KTLLQQSLPPESQQV 2895 sp|Q9UJY5-4|GGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7312 25.318 2 1694.9203 1694.9203 G R 341 356 PSM KTNPTEPVGVVC 2896 sp|Q16222-2|UAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 12-UNIMOD:4 ms_run[2]:scan=5062 21.239 2 1299.6493 1299.6493 E R 282 294 PSM KTPTAVVAPVE 2897 sp|P30622-2|CLIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5150 21.441 2 1110.6285 1110.6285 L K 24 35 PSM KTPTEAPADC 2898 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 10-UNIMOD:4 ms_run[2]:scan=3504 15.431 2 1088.4808 1088.4808 K R 10 20 PSM KTQMAEVLPSP 2899 sp|P11388|TOP2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 4-UNIMOD:35 ms_run[2]:scan=5423 22.091 2 1215.6169 1215.6169 K R 1204 1215 PSM KTSSLDPNDQVAMG 2900 sp|Q9NY61|AATF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 13-UNIMOD:35 ms_run[2]:scan=4506 19.647 2 1477.6719 1477.6719 R R 475 489 PSM KTTLPGVVNGANNPAI 2901 sp|Q92485-2|ASM3B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6817 24.486 2 1564.8573 1564.8573 W R 307 323 PSM KTTVQQEPLESGA 2902 sp|P49750-3|YLPM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4604 19.989 2 1386.6991 1386.6991 N K 257 270 PSM KTVAEVDSESLPSSS 2903 sp|P28715|ERCC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5210 21.582 2 1534.7362 1534.7362 A K 298 313 PSM KTVIVNMVDVA 2904 sp|P55010|IF5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=5759 22.76 2 1203.6533 1203.6533 I K 33 44 PSM KTVMPYISTTPA 2905 sp|P05556-2|ITB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6786 24.431 2 1307.6795 1307.6795 E K 190 202 PSM KTVPVEAVTS 2906 sp|Q14247-3|SRC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4541 19.785 2 1029.5706 1029.5706 Q K 299 309 PSM KTVSFEALPIM 2907 sp|O15084-2|ANR28_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 11-UNIMOD:35 ms_run[2]:scan=8043 26.684 2 1250.6581 1250.6581 S R 854 865 PSM KTVVAPMLDS 2908 sp|Q8NBJ5|GT251_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 7-UNIMOD:35 ms_run[2]:scan=5120 21.37 2 1075.5583 1075.5583 N R 185 195 PSM KVAEVLQVPPM 2909 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 11-UNIMOD:35 ms_run[2]:scan=7417 25.503 2 1225.674 1225.6740 N R 100 111 PSM KVALVYGQMNEPPGA 2910 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7170 25.069 2 1572.797 1572.7970 S R 264 279 PSM KVDDLPEDNQE 2911 sp|Q9BVC3|DCC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4566 19.873 2 1300.5783 1300.5783 L R 326 337 PSM KVDISEDGM 2912 sp|P40937-2|RFC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:35 ms_run[2]:scan=4174 18.363 2 1008.4434 1008.4434 E K 173 182 PSM KVDMLSEINIAP 2913 sp|A5YKK6-2|CNOT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 4-UNIMOD:35 ms_run[2]:scan=7618 25.861 2 1344.6959 1344.6959 L R 2146 2158 PSM KVDSPLPSD 2914 sp|Q12893|TM115_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4819 20.617 2 956.48148 956.4815 A K 317 326 PSM KVEITYTPSDGTQ 2915 sp|O75874|IDHC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5400 22.033 2 1437.6987 1437.6987 G K 151 164 PSM KVGINYQPPTVVPGGDLA 2916 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7705 26.021 2 1823.9781 1823.9781 F K 352 370 PSM KVLTMPETC 2917 sp|Q99460|PSMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:4 ms_run[2]:scan=5481 22.202 2 1077.5199 1077.5199 L R 890 899 PSM KVPAINVNDSVT 2918 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5851 22.909 2 1255.6772 1255.6772 L K 174 186 PSM KVTAVPTLL 2919 sp|Q9BRA2|TXD17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7627 25.877 2 940.59572 940.5957 L K 89 98 PSM KVTVDTGVIPASEE 2920 sp|O60841|IF2P_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5926 23.043 2 1443.7457 1443.7457 S K 284 298 PSM KVVASLPSISVPFGGA 2921 sp|O95405-2|ZFYV9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8939 29.068 2 1527.8661 1527.8661 P R 564 580 PSM KVVDLLAPYA 2922 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8789 28.55 2 1087.6277 1087.6277 I K 188 198 PSM KVVDLLAPYA 2923 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8904 28.95 2 1087.6277 1087.6277 I K 188 198 PSM KYPDANPNPNEQ 2924 sp|Q14683|SMC1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4088 18.034 2 1385.6212 1385.6212 T - 1222 1234 PSM MVDREQLVQ 2925 sp|P61981|1433G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:35 ms_run[2]:scan=4663 20.192 2 1132.5547 1132.5547 - K 1 10 PSM PFSNSHNAL 2926 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5105 21.335 2 985.46174 985.4617 M K 2 11 PSM RDPENFPFVVLGN 2927 sp|P51149|RAB7A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9155 30.006 2 1502.7518 1502.7518 P K 113 126 PSM RDPIPYLPPLE 2928 sp|P08621-2|RU17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8875 28.845 2 1308.7078 1308.7078 P K 16 27 PSM RDYMDTLPPTVGDDVG 2929 sp|Q16630-3|CPSF6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7730 26.071 2 1749.788 1749.7880 D K 50 66 PSM REDYDSVEQDGDEPGPQ 2930 sp|Q9Y5S9-2|RBM8A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4801 20.572 3 1934.7766 1934.7766 M R 50 67 PSM REVDIGIPDATG 2931 sp|P55072|TERA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6646 24.19 2 1241.6252 1241.6252 D R 365 377 PSM RGPPPPPGDEN 2932 sp|Q13435|SF3B2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3616 15.936 2 1131.5309 1131.5309 P R 247 258 PSM RLEEGPPVTTVLT 2933 sp|P08559-3|ODPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7022 24.822 2 1410.7718 1410.7718 H R 45 58 PSM RMPDCSVALPFPSIS 2934 sp|Q14676-3|MDC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 2-UNIMOD:35,5-UNIMOD:4 ms_run[2]:scan=8840 28.709 2 1691.8011 1691.8011 G K 58 73 PSM RTPIQVESSPQPGLPAGEQLEGL 2935 sp|Q99618|CDCA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8417 27.509 3 2402.2442 2402.2442 L K 36 59 PSM RTPTPAGPTIMPLI 2936 sp|Q96PU8-5|QKI_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=8914 28.986 2 1463.817 1463.8170 L R 234 248 PSM RTPVQPNPIVYMM 2937 sp|O96000-2|NDUBA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 12-UNIMOD:35,13-UNIMOD:35 ms_run[2]:scan=6004 23.179 2 1576.7742 1576.7742 R K 16 29 PSM RVETPVLPPVLVP 2938 sp|P84022-3|SMAD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=9056 29.542 2 1414.8548 1414.8548 Q R 24 37 PSM RVLVEPDAGAGVAVM 2939 sp|P42126-2|ECI1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=7469 25.593 2 1482.7864 1482.7864 Q K 46 61 PSM SKAHPPEL 2940 sp|P62308|RUXG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 1-UNIMOD:1 ms_run[2]:scan=5135 21.402 2 919.47633 919.4763 M K 2 10 PSM KVAAPDVVVPTLDTV 2941 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=8446 27.588408813866668 2 1522.860367 1522.860660 H R 2561 2576 PSM KDMSPLSETEMALG 2942 sp|P27816|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 3-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=7161 25.0519861528 2 1539.678833 1539.679661 L K 504 518 PSM KTTTAAAVASTGPSS 2943 sp|P27816|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=3853 17.1034330856 2 1348.684002 1348.683424 A R 809 824 PSM RLEQGQAIDDLMPAQ 2944 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 12-UNIMOD:35 ms_run[1]:scan=6138 23.387570164266666 2 1700.8272 1699.8192 Q K 366 381 PSM KLMIEMDGTEN 2945 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6774 24.414634121866666 2 1279.575915 1279.578824 D K 92 103 PSM KDATNVGDEGGFAPNILEN 2946 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9960 32.8312945512 2 1960.921152 1959.917400 G K 202 221 PSM KMVGVPAALDMMLTG 2947 sp|P40939|ECHA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 11-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=8118 26.814572369066664 2 1564.750897 1564.766308 P R 190 205 PSM KLYTLVLTDPDAPS 2948 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9518 31.2632133232 2 1531.810166 1531.813375 G R 62 76 PSM KEQVLEPMLNGTE 2949 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 8-UNIMOD:35 ms_run[1]:scan=5981 23.1436113768 2 1502.713529 1502.728660 Y K 936 949 PSM RNLPLPPPPPP 2950 sp|P61978|HNRPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6339 23.7054536392 2 1193.692524 1193.692078 A R 305 316 PSM KGLVVDMDGFEEE 2951 sp|P49588|SYAC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 7-UNIMOD:35 ms_run[1]:scan=6784 24.429407025866666 2 1482.6529 1482.6543 E R 432 445 PSM KITMIAEPLE 2952 sp|Q15029|U5S1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7323 25.3384261608 2 1143.618827 1143.620947 N K 684 694 PSM KTLFQPQTGAYQTLA 2953 sp|P53992|SC24C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7574 25.777529247466667 2 1665.875165 1665.872622 E K 670 685 PSM KLAEIGAPIQGN 2954 sp|Q13435|SF3B2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6126 23.368507848266667 2 1210.657816 1209.671737 A R 35 47 PSM KDFLPVDPATSNG 2955 sp|P10586|PTPRF_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7198 25.121600644 2 1359.665293 1359.667045 F R 170 183 PSM KVDGTLLVGEDAP 2956 sp|Q9HCK8|CHD8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6930 24.6705700288 2 1312.691813 1312.687447 N R 2320 2333 PSM KIVLAGCVPQAQP 2957 sp|Q5VV42|CDKAL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:4 ms_run[1]:scan=6410 23.817663136533334 2 1379.760027 1379.759506 K R 132 145 PSM RAAAPQAWAGPMEEPPQAQAPP 2958 sp|Q16643|DREB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 12-UNIMOD:35 ms_run[1]:scan=6467 23.906964636533335 3 2288.088278 2286.085151 T R 390 412 PSM KELVYPPDYNPEG 2959 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9339 30.643648890666668 2 1520.724993 1519.719475 F K 526 539 PSM KELVYPPDYNPEG 2960 sp|P12956|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9555 31.384025112266666 2 1520.724985 1519.719475 F K 526 539 PSM KEVDLSDIINTPLP 2961 sp|P49848|TAF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9238 30.363244353066666 2 1552.842991 1552.834839 E R 110 124 PSM KIFVGGLSPDTPEE 2962 sp|Q14103|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=9322 30.5812325728 2 1488.754549 1487.750775 K K 183 197 PSM RAPEEELPPLDPEEI 2963 sp|Q8IY67|RAVR1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=8542 27.84389884 2 1732.848931 1732.851946 R R 30 45 PSM KSIVTAEVSSMPAC 2964 sp|Q86SZ2|TPC6B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 14-UNIMOD:4 ms_run[1]:scan=6218 23.5167070784 2 1478.701540 1478.710901 I K 136 150 PSM KDDGDPPLLYDE 2965 sp|O14730|RIOK3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7078 24.910578712266666 2 1375.613823 1375.614341 L - 508 520 PSM KTPADCPVIAIDSF 2966 sp|Q9BS26|ERP44_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 6-UNIMOD:4 ms_run[1]:scan=8682 28.221717421599998 2 1532.7511 1532.7540 Q R 313 327 PSM KVPQVSTPTLVEVS 2967 sp|P02768|ALBU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7093 24.9343807152 2 1482.829180 1482.829360 K R 438 452 PSM KAPEPPPALIV 2968 sp|Q9H6S0|YTDC2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=7386 25.447425128266666 2 1130.669094 1130.669946 M R 796 807 PSM KEVEIDQLNEQVT 2969 sp|Q99996|AKAP9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6314 23.667997470933337 2 1543.778296 1543.772967 E K 2290 2303 PSM KMEGSTGVIIVNPNC 2970 sp|Q9C0F0|ASXL3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 22 2-UNIMOD:35,15-UNIMOD:4 ms_run[1]:scan=5944 23.0843098976 2 1634.7622 1633.7802 T R 1151 1166 PSM KDVDGLTSINAG 2971 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=5735 22.711645653599998 2 1189.582438 1188.598632 E R 122 134 PSM KEIPVESIEEVS 2972 sp|O60502|OGA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6624 24.1598943784 2 1357.704430 1357.697677 S K 257 269 PSM RDIIEQPVLVQGNSN 2973 sp|Q7Z3U7|MON2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6839 24.520652190133333 2 1682.857401 1680.879498 H R 188 203 PSM KASPVTSPAAAFPTASPAN 2974 sp|Q9UIF9|BAZ2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6236 23.543469170399998 2 1783.912720 1783.910464 P K 494 513 PSM RDAEDAMDAMDGAVLDG 2975 sp|Q01130|SRSF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 7-UNIMOD:35,10-UNIMOD:35 ms_run[1]:scan=4950 20.96878880026667 2 1784.699397 1782.703644 K R 66 83 PSM RALPVEAPPPGPEGAPSAP 2976 sp|Q9BVL4|SELO_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=6187 23.465126030399997 2 1808.942366 1808.942098 L R 56 75 PSM APSRNGMVL 2977 sp|P26373-2|RL13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 7-UNIMOD:35 ms_run[2]:scan=4459 19.477 2 959.48585 959.4859 M K 2 11 PSM KAAGLATMISTM 2978 sp|O75533|SF3B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 8-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5126 21.383 2 1225.6046 1225.6046 A R 602 614 PSM KADGGTQVIDT 2979 sp|P09622-2|DLDH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4323 18.937 2 1103.5459 1103.5459 T K 67 78 PSM KAESTPEIAEQ 2980 sp|Q13098-5|CSN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4295 18.837 2 1201.5826 1201.5826 S R 220 231 PSM KAPLVCLPVFVS 2981 sp|Q9H0W9-4|CK054_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 6-UNIMOD:4 ms_run[2]:scan=9124 29.85 2 1328.7526 1328.7526 M R 133 145 PSM KASQDPFPAAIIL 2982 sp|Q96KB5|TOPK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9200 30.215 2 1369.7606 1369.7606 Y K 132 145 PSM KATFSPIVTVEP 2983 sp|Q12955-6|ANK3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7777 26.16 2 1287.7075 1287.7075 N R 330 342 PSM KDAFPPLPE 2984 sp|Q00341-2|VIGLN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7213 25.147 2 1012.5229 1012.5229 Y K 77 86 PSM KDAQPSFSAEDIA 2985 sp|P25205|MCM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6532 24.017 2 1377.6412 1377.6412 S K 270 283 PSM KDCVGPEVE 2986 sp|P00558-2|PGK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:4 ms_run[2]:scan=4315 18.909 2 1031.4594 1031.4594 L K 69 78 PSM KDDTDPGQL 2987 sp|O43913-2|ORC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4380 19.173 2 987.4509 987.4509 Q K 283 292 PSM KDLALGLVPGD 2988 sp|Q92614-3|MY18A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8039 26.673 2 1096.6128 1096.6128 T R 264 275 PSM KDMGEDLECLCQIM 2989 sp|P78344-2|IF4G2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35,9-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=8777 28.506 2 1756.714 1756.7140 L R 245 259 PSM KDMQPSMESDMALV 2990 sp|P27816-6|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=5158 21.458 2 1628.6732 1628.6732 A K 290 304 PSM KDNIQPTTE 2991 sp|Q9Y2W1|TR150_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=3739 16.531 2 1044.5088 1044.5088 E - 947 956 PSM KDPDQLYTTL 2992 sp|Q92830-2|KAT2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7222 25.165 2 1192.5976 1192.5976 L K 318 328 PSM KDPLPTIAS 2993 sp|Q9BZE1|RM37_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5946 23.088 2 940.52295 940.5229 T R 233 242 PSM KDQVANSAFVE 2994 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5362 21.949 2 1206.5881 1206.5881 T R 499 510 PSM KDSLDQFDC 2995 sp|Q9HAV4|XPO5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 9-UNIMOD:4 ms_run[2]:scan=5774 22.783 2 1126.4601 1126.4601 Q K 1123 1132 PSM KDVLEVGELA 2996 sp|Q9GZZ1|NAA50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7505 25.656 2 1071.5812 1071.5812 Y K 37 47 PSM KDYEEVGADSADGEDEGEEY 2997 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9903 32.622 2 2205.8346 2205.8346 E - 430 450 PSM KEAILDIITS 2998 sp|P08133-2|ANXA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8629 28.077 2 1101.6281 1101.6281 D R 8 18 PSM KEDGQEYAQVI 2999 sp|P47813|IF1AX_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6177 23.45 2 1278.6092 1278.6092 F K 29 40 PSM KEEDEEPESPPE 3000 sp|Q9H1E3|NUCKS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4030 17.804 2 1413.5783 1413.5783 P K 206 218 PSM KEEDGSLSLDGADSTGVVA 3001 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9365 30.74 2 1848.8589 1848.8589 L K 676 695 PSM KEEVLPINVGMLNGGQ 3002 sp|O94830-2|DDHD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 11-UNIMOD:35 ms_run[2]:scan=8128 26.836 2 1712.8767 1712.8767 V R 261 277 PSM KEFSPFGTITSA 3003 sp|P11940-2|PABP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8231 27.059 2 1283.6398 1283.6398 R K 312 324 PSM KEGAAGAGVAQAGPLVDGELL 3004 sp|Q4V328-4|GRAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8631 28.082 3 1922.0109 1922.0109 L R 118 139 PSM KEGAAVIDVGIN 3005 sp|P13995-2|MTDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6562 24.058 2 1184.6401 1184.6401 I R 164 176 PSM KEGPPPASPAQLLS 3006 sp|Q3LXA3-2|TKFC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6925 24.657 2 1390.7456 1390.7456 L K 420 434 PSM KEIQVIPLQ 3007 sp|P29218|IMPA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7111 24.964 2 1066.6386 1066.6386 A R 264 273 PSM KEITALAPSTM 3008 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 11-UNIMOD:35 ms_run[2]:scan=4742 20.418 2 1176.606 1176.6060 Q K 315 326 PSM KELLESLPLS 3009 sp|Q13042-4|CDC16_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8413 27.492 2 1127.6438 1127.6438 E K 88 98 PSM KELVYPPDYNPEG 3010 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9430 30.96 2 1519.7195 1519.7195 F K 485 498 PSM KEMGQMQVLQM 3011 sp|Q92878-3|RAD50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35,6-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4121 18.174 2 1369.604 1369.6040 L K 904 915 PSM KENVLIGDGAGF 3012 sp|P11310|ACADM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7681 25.98 2 1218.6245 1218.6245 P K 259 271 PSM KEPILVCPPL 3013 sp|Q8N5N7-2|RM50_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 7-UNIMOD:4 ms_run[2]:scan=8023 26.636 2 1164.6577 1164.6577 K R 46 56 PSM KEPSEVPTP 3014 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4638 20.1 2 982.49713 982.4971 Q K 46 55 PSM KEPSEVPTP 3015 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4763 20.475 2 982.49713 982.4971 Q K 46 55 PSM KESLPPAAEPSPVS 3016 sp|Q9NWT1|PK1IP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5901 22.997 2 1407.7246 1407.7246 M K 310 324 PSM KEVFPVLAA 3017 sp|Q8WUM4|PDC6I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7930 26.471 2 972.56442 972.5644 P K 239 248 PSM KEVVEEAENG 3018 sp|P06454-2|PTMA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=3904 17.305 2 1102.5142 1102.5142 K R 21 31 PSM KEVVIVSAT 3019 sp|P24752|THIL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5067 21.256 2 944.55425 944.5542 L R 40 49 PSM KEVVIVSAT 3020 sp|P24752|THIL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5071 21.266 2 944.55425 944.5542 L R 40 49 PSM KGGEEPIEESNILSPVQDGT 3021 sp|Q14571|ITPR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7661 25.934 2 2098.0066 2098.0066 V K 1147 1167 PSM KGIEILTDMS 3022 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 9-UNIMOD:35 ms_run[2]:scan=6613 24.136 2 1121.5638 1121.5638 E R 143 153 PSM KGPMETGLFPGSNATF 3023 sp|Q9H825-2|METL8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 4-UNIMOD:35 ms_run[2]:scan=8257 27.115 2 1668.7818 1668.7818 K R 133 149 PSM KIADPTLAEMG 3024 sp|Q6P996-4|PDXD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 10-UNIMOD:35 ms_run[2]:scan=5030 21.162 2 1160.5747 1160.5747 E K 7 18 PSM KIAPPETPDS 3025 sp|Q9NZI8|IF2B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4488 19.582 2 1053.5342 1053.5342 I K 440 450 PSM KIEPADMNESC 3026 sp|Q9UPN9-2|TRI33_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 7-UNIMOD:35,11-UNIMOD:4 ms_run[2]:scan=3623 15.97 2 1308.5326 1308.5326 V K 839 850 PSM KIFVGGLSPDTPEE 3027 sp|Q14103-4|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9647 31.709 2 1487.7508 1487.7508 K K 164 178 PSM KIGPILDTNALQGEV 3028 sp|P30154-5|2AAB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8433 27.552 2 1566.8617 1566.8617 Q K 431 446 PSM KILIANTGMDTD 3029 sp|P78371-2|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6197 23.484 2 1290.649 1290.6490 A K 189 201 PSM KLAPALATGNTVVM 3030 sp|P30837|AL1B1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7247 25.206 2 1384.7748 1384.7748 W K 195 209 PSM KLASETEDNDNSLGDILQASDNLS 3031 sp|Q9NZ52-3|GGA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8905 28.954 3 2548.1776 2548.1776 F R 142 166 PSM KLDDLSTCNDLIA 3032 sp|Q969R2-6|OSBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 8-UNIMOD:4 ms_run[2]:scan=6798 24.454 2 1476.713 1476.7130 L K 54 67 PSM KLEEILPLGPN 3033 sp|Q96EK7-2|F120B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8338 27.307 2 1221.6969 1221.6969 K K 283 294 PSM KLEGQGDVPTP 3034 sp|Q9Y2Z0-2|SGT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5132 21.396 2 1139.5823 1139.5823 E K 224 235 PSM KLGDEDEEIDGDTN 3035 sp|P09884|DPOLA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4917 20.891 2 1548.6427 1548.6427 Q K 815 829 PSM KLGMENDDTAVQYAIG 3036 sp|Q05048|CSTF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 4-UNIMOD:35 ms_run[2]:scan=6719 24.315 2 1739.8036 1739.8036 I R 55 71 PSM KLITPAVVSE 3037 sp|P62851|RS25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5992 23.159 2 1055.6227 1055.6227 Y R 66 76 PSM KLLIEMEQ 3038 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 6-UNIMOD:35 ms_run[2]:scan=5569 22.397 2 1018.5369 1018.5369 V R 358 366 PSM KLLTDDGN 3039 sp|Q13200-2|PSMD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4217 18.517 2 874.43961 874.4396 D K 230 238 PSM KLPPGGLPGIDLSDP 3040 sp|O15391|TYY2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8445 27.586 2 1474.8031 1474.8031 K K 218 233 PSM KLPQLPITNFS 3041 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8714 28.309 2 1256.7129 1256.7129 N R 179 190 PSM KLTDCVVM 3042 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 5-UNIMOD:4,8-UNIMOD:35 ms_run[2]:scan=4517 19.691 2 980.46709 980.4671 G R 46 54 PSM KLVQDVANNTNEEAGDGTTTATVLA 3043 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9652 31.726 3 2531.2351 2531.2351 A R 96 121 PSM KLVTTVTEIAG 3044 sp|Q01518-2|CAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6430 23.845 2 1130.6547 1130.6547 Q - 464 475 PSM KMEMEMEQVFEM 3045 sp|Q16181-2|SEPT7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 2-UNIMOD:35,4-UNIMOD:35,6-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5183 21.518 2 1624.6129 1624.6129 K K 351 363 PSM KNLVTEDVM 3046 sp|P06744|G6PI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 9-UNIMOD:35 ms_run[2]:scan=4946 20.96 2 1063.522 1063.5220 S R 57 66 PSM KPDQIGIITPYEGQ 3047 sp|Q92900-2|RENT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7504 25.654 2 1557.8039 1557.8039 A R 786 800 PSM KPEFVDIINA 3048 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8275 27.154 2 1144.6128 1144.6128 L K 238 248 PSM KPGAPPQPAVSA 3049 sp|Q6ZSJ8-2|CA122_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4319 18.925 2 1118.6084 1118.6084 A R 21 33 PSM KPGEIDPNPET 3050 sp|Q99459|CDC5L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4394 19.227 2 1195.5721 1195.5721 L K 124 135 PSM KPLLPSQLV 3051 sp|P14735|IDE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7821 26.249 2 993.62227 993.6223 T R 756 765 PSM KPMEIDGEVEIPSS 3052 sp|O60907-2|TBL1X_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35 ms_run[2]:scan=6259 23.582 2 1545.7232 1545.7232 A K 159 173 PSM KPQPLQQPSQPQQPPPTQQAVA 3053 sp|Q8WWM7-6|ATX2L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5218 21.6 3 2392.2499 2392.2499 L R 3 25 PSM KPVIITAPVSA 3054 sp|Q4KMG0-2|CDON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6258 23.58 2 1094.6699 1094.6699 F K 404 415 PSM KQAGGFLGPPPPSG 3055 sp|Q9UM00-1|TMCO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5929 23.052 2 1308.6826 1308.6826 T K 172 186 PSM KQDTLELESPSLTSTPVCSQ 3056 sp|P10244-2|MYBB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 18-UNIMOD:4 ms_run[2]:scan=7495 25.635 3 2219.0627 2219.0627 N K 438 458 PSM KQELIEDLQPDINQNVQ 3057 sp|Q9UJC3-2|HOOK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7874 26.353 3 2023.0222 2023.0222 K K 525 542 PSM KSLPVPGALEQVAS 3058 sp|O95785-4|WIZ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7398 25.468 2 1394.7769 1394.7769 K R 14 28 PSM KSNLVISDPIPGA 3059 sp|Q9UQB8-3|BAIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7589 25.801 2 1309.7242 1309.7242 S K 262 275 PSM KSTLTDSLVC 3060 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 10-UNIMOD:4 ms_run[2]:scan=5945 23.086 2 1122.5591 1122.5591 G K 32 42 PSM KSVSTPLTTLDATSD 3061 sp|Q2KHR3-2|QSER1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6686 24.259 2 1534.7726 1534.7726 Y K 1005 1020 PSM KTAADVVSPGANSVDS 3062 sp|Q01804-5|OTUD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4768 20.489 2 1516.7369 1516.7369 P R 933 949 PSM KTANVPQTVPM 3063 sp|P46937-5|YAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 11-UNIMOD:35 ms_run[2]:scan=4443 19.412 2 1200.6173 1200.6173 P R 76 87 PSM KTEIMSPLYQDEAP 3064 sp|Q8IY81|SPB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7535 25.704 2 1620.7705 1620.7705 L K 579 593 PSM KTLETVPLE 3065 sp|P22626|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5889 22.978 2 1028.5754 1028.5754 E R 3 12 PSM KTLTGVLPE 3066 sp|Q8WVY7|UBCP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6137 23.385 2 956.55425 956.5542 L R 33 42 PSM KTSAPITCELLN 3067 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 8-UNIMOD:4 ms_run[2]:scan=6869 24.566 2 1345.6912 1345.6912 D K 1992 2004 PSM KTVIVTPSQ 3068 sp|Q16822|PCKGM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4505 19.643 2 971.56515 971.5651 S R 108 117 PSM KTYLDGEGCIVTE 3069 sp|Q15054-3|DPOD3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 9-UNIMOD:4 ms_run[2]:scan=6356 23.734 2 1483.6865 1483.6865 S K 284 297 PSM KVEDVSAVEIVGGAT 3070 sp|Q92598-2|HS105_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7197 25.119 2 1472.7722 1472.7722 L R 331 346 PSM KVEVSEDEPAS 3071 sp|O75683|SURF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4041 17.843 2 1188.551 1188.5510 N K 202 213 PSM KVFVDLLPATQCT 3072 sp|Q14CX7-2|NAA25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 12-UNIMOD:4 ms_run[2]:scan=8524 27.803 2 1490.7803 1490.7803 L K 370 383 PSM KVGINYQPPTVVPGGDLA 3073 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9195 30.192 2 1823.9781 1823.9781 F K 352 370 PSM KVLAPQISFAPEIASEEE 3074 sp|P16083|NQO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8676 28.204 2 1957.0044 1957.0044 F R 183 201 PSM KVPEESVLPLVQ 3075 sp|Q9UKV3-5|ACINU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8259 27.119 2 1336.7602 1336.7602 E K 494 506 PSM KVPQPVPLIAQ 3076 sp|Q7Z333-3|SETX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6908 24.632 2 1188.723 1188.7230 L K 1636 1647 PSM KVVEGTPLIDG 3077 sp|Q14739|LBR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6017 23.201 2 1126.6234 1126.6234 G R 279 290 PSM PSKGPLQSVQVFG 3078 sp|P62249|RS16_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9371 30.763 2 1342.7245 1342.7245 M R 2 15 PSM RAEDNADTLALVFEAPNQE 3079 sp|P12004|PCNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=9060 29.56 2 2101.9916 2101.9916 L K 91 110 PSM RALIPLALEGTDVGQT 3080 sp|Q9H3U1-2|UN45A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8749 28.408 2 1652.9097 1652.9097 G K 676 692 PSM RASGDYDNDCTNPITPLCTQPDQVI 3081 sp|Q8TAF3-4|WDR48_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 10-UNIMOD:4,18-UNIMOD:4 ms_run[2]:scan=8412 27.488 3 2849.2596 2849.2596 F K 251 276 PSM RATDPSQVPDVISSI 3082 sp|O60343-2|TBCD4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8385 27.419 2 1583.8155 1583.8155 F R 160 175 PSM RDGEEAGAYDGP 3083 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=4406 19.268 2 1235.5055 1235.5055 F R 107 119 PSM RDGETLEELM 3084 sp|P13797-3|PLST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 10-UNIMOD:35 ms_run[2]:scan=6010 23.192 2 1207.5391 1207.5391 L K 211 221 PSM RDMEALNVLPPDVLT 3085 sp|P49589-2|SYCC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35 ms_run[2]:scan=8712 28.306 2 1697.8658 1697.8658 H R 225 240 PSM RGDLGIEIPAE 3086 sp|P14618-2|KPYM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7832 26.271 2 1168.6088 1168.6088 A K 294 305 PSM RLPDGTSLTQTF 3087 sp|Q04323|UBXN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=7585 25.792 2 1334.683 1334.6830 V R 219 231 PSM RPQDALEGVVLSPSLEA 3088 sp|Q9NVI7-3|ATD3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8766 28.475 2 1779.9367 1779.9367 S R 231 248 PSM SPVLHFYV 3089 sp|O15067|PUR4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=8583 27.96 2 960.5069 960.5069 M R 2 10 PSM KGDVTITNDGATIL 3090 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=7208 25.138986073866665 2 1417.740566 1416.746024 G K 65 79 PSM KVGINYQPPTVVPGGDLA 3091 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=9616 31.590300842399998 2 1823.980040 1823.978149 F K 352 370 PSM KLADDLSTLQE 3092 sp|Q14980|NUMA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=6652 24.199381384266665 2 1231.624427 1231.629597 Q K 897 908 PSM KPLTQSGGAPPPPGG 3093 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4183 18.391441020266665 2 1359.715278 1359.714664 E K 2121 2136 PSM KEVDEQMLNVQN 3094 sp|Q13885|TBB2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 7-UNIMOD:35 ms_run[1]:scan=4901 20.848247600266667 2 1462.664839 1461.676959 M K 324 336 PSM KPTPIQTQAIPAIMSG 3095 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 14-UNIMOD:35 ms_run[1]:scan=6420 23.831304701066664 2 1667.893744 1667.891643 E R 394 410 PSM KEAYMGNVLQGGEGQAPT 3096 sp|P24752|THIL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 5-UNIMOD:35 ms_run[1]:scan=5414 22.071493586133332 2 1864.860528 1864.862528 V R 87 105 PSM KLITNDTFQPEIME 3097 sp|Q96RT1|ERBIN_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 13-UNIMOD:35 ms_run[1]:scan=7312 25.318440719733335 2 1693.823716 1693.823289 N R 769 783 PSM KQGDTILVSGM 3098 sp|Q8TEM1|PO210_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 11-UNIMOD:35 ms_run[1]:scan=5253 21.700764825866667 2 1164.601834 1163.585624 A K 201 212 PSM KTGQPMINLYTD 3099 sp|P35637|FUS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 6-UNIMOD:35 ms_run[1]:scan=6329 23.687697659466668 2 1395.669370 1395.670417 K R 316 328 PSM KVAPAPAVV 3100 sp|P62424|RL7A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4810 20.593505581066665 2 850.526856 850.527639 K K 11 20 PSM KIFVGGLSPDTPEE 3101 sp|Q14103|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=9607 31.565113681333333 2 1488.755054 1487.750775 K K 183 197 PSM PAYHSSLMDPDT 3102 sp|O15145|ARPC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 21 8-UNIMOD:35 ms_run[1]:scan=4775 20.507518659466665 2 1348.5588 1348.5600 M K 2 14 PSM RGAPAAAAAAAPPPTPAPPPPPAPVAAAAPA 3103 sp|Q6SPF0|SAMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=6703 24.286124709333333 3 2661.440249 2661.439106 P R 116 147 PSM KAPEPPPALIV 3104 sp|Q9H6S0|YTDC2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=7380 25.4382585752 2 1130.669094 1130.669946 M R 796 807 PSM KVEDLSTCNDLIA 3105 sp|P22059|OSBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 8-UNIMOD:4 ms_run[1]:scan=6798 24.453533649066667 2 1476.716051 1476.713010 S K 217 230 PSM KLEETLPVI 3106 sp|O43681|GET3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=8077 26.746756321066666 2 1040.611166 1040.611762 S R 221 230 PSM KSELPTDNSETVENT 3107 sp|O43422|P52K_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4830 20.64726140266667 2 1662.764132 1662.758439 S - 747 762 PSM KILADPLDQM 3108 sp|Q16799|RTN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 10-UNIMOD:35 ms_run[1]:scan=6707 24.2927953464 2 1158.588303 1158.595461 N K 180 190 PSM KTDPPIIEGNMEAA 3109 sp|Q12860|CNTN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=6214 23.510690184266664 2 1484.724094 1484.718095 A R 653 667 PSM RIPSAVGYQPTLATDMGTMQE 3110 sp|P06576|ATPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 16-UNIMOD:35 ms_run[1]:scan=7088 24.928220437066667 3 2282.073107 2281.071869 G R 324 345 PSM KAGVVNGTGAPGQSPGAG 3111 sp|Q13330|MTA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4135 18.22433014186667 2 1524.753754 1523.769219 V R 373 391 PSM KDGTDGETEVGEIQQN 3112 sp|Q6NZY4|ZCHC8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=4737 20.406948596 2 1720.742702 1718.759502 G K 339 355 PSM KVNQIGSVTESLQAC 3113 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 15-UNIMOD:4 ms_run[1]:scan=6368 23.754390879733332 2 1632.813328 1632.814121 L K 343 358 PSM KAGFAGDDAP 3114 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4536 19.765 2 947.43486 947.4349 C R 18 28 PSM KALAAGGVGSIV 3115 sp|O15511|ARPC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6510 23.979 2 1041.6182 1041.6182 E R 131 143 PSM KALDLDSSC 3116 sp|P31948-3|STIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 9-UNIMOD:4 ms_run[2]:scan=4697 20.283 2 1007.4594 1007.4594 Q K 429 438 PSM KALTLIAGSPL 3117 sp|Q86VP6-2|CAND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8298 27.211 2 1082.6699 1082.6699 V K 462 473 PSM KAQIGTVLPSLID 3118 sp|Q7Z460-2|CLAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8690 28.243 2 1353.7868 1353.7868 F R 86 99 PSM KAQLFALTGVQPA 3119 sp|P54578-2|UBP14_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8290 27.186 2 1342.7609 1342.7609 F R 30 43 PSM KAVDTDMIILPCLS 3120 sp|O43149|ZZEF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 7-UNIMOD:35,12-UNIMOD:4 ms_run[2]:scan=8678 28.21 2 1590.7997 1590.7997 A R 2535 2549 PSM KAVGDGIVLC 3121 sp|P13797-3|PLST_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:4 ms_run[2]:scan=6204 23.495 2 1030.5481 1030.5481 F K 113 123 PSM KDATLTALD 3122 sp|P40939|ECHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5469 22.18 2 946.49713 946.4971 L R 390 399 PSM KDGIVLGADT 3123 sp|Q99436-2|PSB7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5741 22.728 2 987.52368 987.5237 Y R 52 62 PSM KDINTFVGTPVE 3124 sp|P46013-2|KI67_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6725 24.328 2 1318.6769 1318.6769 E K 1555 1567 PSM KDIPGLTDTTVP 3125 sp|P62753|RS6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6868 24.565 2 1255.666 1255.6660 E R 119 131 PSM KDIQEDSGMEP 3126 sp|O75844|FACE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 9-UNIMOD:35 ms_run[2]:scan=3800 16.833 2 1263.5289 1263.5289 N R 292 303 PSM KDLEPPIVA 3127 sp|Q16832|DDR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6355 23.73 2 980.55425 980.5542 L R 153 162 PSM KDLSTIEPL 3128 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6926 24.658 2 1014.5597 1014.5597 I K 101 110 PSM KDPADETEAD 3129 sp|P16949|STMN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=3429 15.176 2 1089.4462 1089.4462 S - 140 150 PSM KDPDEDLEQVS 3130 sp|Q8N3R3-4|TCAIM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5149 21.439 2 1273.5674 1273.5674 F R 30 41 PSM KDPQEPIM 3131 sp|P30038-2|AL4A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 8-UNIMOD:35 ms_run[2]:scan=3974 17.58 2 972.45863 972.4586 S K 377 385 PSM KDTPDEPWAFPA 3132 sp|Q7KZF4|SND1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8474 27.662 2 1372.6299 1372.6299 A R 71 83 PSM KDTYIIECQGIGMTNPNL 3133 sp|O00442|RTCA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 8-UNIMOD:4,13-UNIMOD:35 ms_run[2]:scan=7620 25.863 2 2081.9762 2081.9762 A - 349 367 PSM KDVDGVTDINLG 3134 sp|Q6UB35|C1TM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6676 24.244 2 1244.6248 1244.6248 E K 177 189 PSM KEDGAISTIVL 3135 sp|P50990-3|TCPQ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7977 26.556 2 1144.634 1144.6340 E R 294 305 PSM KEEEMDDMD 3136 sp|Q9HD45|TM9S3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 5-UNIMOD:35,8-UNIMOD:35 ms_run[2]:scan=3337 14.768 2 1172.3849 1172.3849 S R 257 266 PSM KEEETSIDVAG 3137 sp|P53985|MOT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4742 20.418 2 1176.551 1176.5510 S K 462 473 PSM KEGDVLTPEQA 3138 sp|Q9UKD2|MRT4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5000 21.092 2 1185.5877 1185.5877 C R 177 188 PSM KEIDTDSTSQGES 3139 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=3476 15.319 2 1395.6001 1395.6001 R K 2823 2836 PSM KEIIDLVLD 3140 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8283 27.168 2 1056.6067 1056.6067 G R 112 121 PSM KEILPFTD 3141 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7673 25.959 2 961.51205 961.5120 C R 751 759 PSM KELEEIVQPIIS 3142 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8241 27.08 2 1396.7813 1396.7813 K K 621 633 PSM KELEGILLPSD 3143 sp|Q13438-4|OS9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8267 27.136 2 1212.6602 1212.6602 E R 438 449 PSM KEMEQLVLD 3144 sp|Q96A49|SYAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 3-UNIMOD:35 ms_run[2]:scan=5761 22.762 2 1119.5482 1119.5482 R K 292 301 PSM KEPLIPASP 3145 sp|Q9Y613|FHOD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5950 23.094 2 950.54368 950.5437 P K 516 525 PSM KETSALEASSPLLTGQILE 3146 sp|Q14746-2|COG2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8920 29.009 3 1986.0521 1986.0521 S R 153 172 PSM KFAAATGATPIAG 3147 sp|P08865|RSSA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5405 22.043 2 1174.6346 1174.6346 L R 89 102 PSM KFDDGDVTEC 3148 sp|Q93008|USP9X_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:4 ms_run[2]:scan=4736 20.405 2 1184.4656 1184.4656 Y K 1899 1909 PSM KFDTGNLCMVTGGANLG 3149 sp|P62701|RS4X_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 8-UNIMOD:4 ms_run[2]:scan=8135 26.849 2 1753.8127 1753.8127 I R 174 191 PSM KFPLTTESAM 3150 sp|P62750|RL23A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6900 24.619 2 1123.5583 1123.5583 I K 78 88 PSM KGEDQSELVTTVD 3151 sp|Q8NC56-2|LEMD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5427 22.099 2 1419.6729 1419.6729 L K 37 50 PSM KGLDPALGSETLAS 3152 sp|Q9Y448-2|SKAP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6624 24.16 2 1357.7089 1357.7089 S R 224 238 PSM KGLDPYNVLAP 3153 sp|P10606|COX5B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8201 26.999 2 1185.6394 1185.6394 K K 57 68 PSM KGTEPIVVDPFDP 3154 sp|P22681|CBL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8701 28.273 2 1412.7187 1412.7187 I R 424 437 PSM KICNEILTSPCSPEI 3155 sp|Q9BPX3|CND3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 3-UNIMOD:4,11-UNIMOD:4 ms_run[2]:scan=7600 25.828 2 1759.8485 1759.8485 M R 833 848 PSM KIIIPEIQ 3156 sp|P55060-4|XPO2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7664 25.941 2 952.59572 952.5957 E K 768 776 PSM KIIPLYSTLPPQQQQ 3157 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7678 25.973 3 1752.9774 1752.9774 I R 384 399 PSM KIMATPEQVG 3158 sp|P12956-2|XRCC6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 3-UNIMOD:35 ms_run[2]:scan=4336 18.988 2 1088.5536 1088.5536 E K 410 420 PSM KIPEIQATM 3159 sp|Q9Y3E7-2|CHMP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 9-UNIMOD:35 ms_run[2]:scan=5322 21.871 2 1045.5478 1045.5478 V R 53 62 PSM KIVGPSGAAVPC 3160 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 12-UNIMOD:4 ms_run[2]:scan=5256 21.709 2 1154.6118 1154.6118 S K 1007 1019 PSM KLAVNMVPFP 3161 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8756 28.436 2 1114.6209 1114.6209 R R 252 262 PSM KLAVNMVPFP 3162 sp|P04350|TBB4A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8759 28.445 2 1114.6209 1114.6209 R R 252 262 PSM KLEVDIPLV 3163 sp|P78344-2|IF4G2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8925 29.024 2 1024.6168 1024.6168 P K 593 602 PSM KLLDSITVPVA 3164 sp|O00203-3|AP3B1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8332 27.297 2 1154.6911 1154.6911 A R 436 447 PSM KLPEEPIT 3165 sp|Q9BYD2|RM09_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5339 21.903 2 925.51205 925.5120 L R 207 215 PSM KLSDGVAVL 3166 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6475 23.919 1 900.52803 900.5280 A K 396 405 PSM KLTADPDSEIATTSL 3167 sp|O75928-3|PIAS2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7002 24.788 2 1560.7883 1560.7883 E R 330 345 PSM KMDATANDVPSPYEV 3168 sp|P30101|PDIA3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6650 24.196 2 1635.745 1635.7450 A R 433 448 PSM KMFVLDEADEMLS 3169 sp|P60842-2|IF4A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 11-UNIMOD:35 ms_run[2]:scan=8242 27.082 2 1542.6946 1542.6946 I R 177 190 PSM KNDLAVVDV 3170 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6756 24.379 2 971.52876 971.5288 A R 333 342 PSM KNPTIVNFPITNVDL 3171 sp|Q53GS9-2|SNUT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=9165 30.052 2 1683.9196 1683.9196 E R 363 378 PSM KPAIVEAGGMQALG 3172 sp|P14923|PLAK_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:35 ms_run[2]:scan=5345 21.914 2 1356.7071 1356.7071 N K 345 359 PSM KPDDGISPE 3173 sp|Q96I24|FUBP3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4044 17.855 2 956.44509 956.4451 F R 290 299 PSM KPDFVGFEIPD 3174 sp|P00492|HPRT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8879 28.861 2 1262.6183 1262.6183 Y K 175 186 PSM KPLLPAGIQD 3175 sp|Q8IWA4|MFN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6608 24.127 2 1050.6073 1050.6073 L K 481 491 PSM KPSCTIIPLM 3176 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 4-UNIMOD:4,10-UNIMOD:35 ms_run[2]:scan=6889 24.599 2 1174.609 1174.6090 L K 776 786 PSM KPVLMALAEGPGAEGP 3177 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 5-UNIMOD:35 ms_run[2]:scan=9334 30.625 2 1551.7967 1551.7967 T R 575 591 PSM KPVTTPEEIAQVATISANGD 3178 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8131 26.843 3 2040.0375 2040.0375 S K 160 180 PSM KQDLPDAM 3179 sp|P62330|ARF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 8-UNIMOD:35 ms_run[2]:scan=4031 17.809 2 932.42733 932.4273 N K 123 131 PSM KQEVPICTDPIS 3180 sp|Q96EK7-2|F120B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 7-UNIMOD:4 ms_run[2]:scan=6166 23.436 2 1385.6861 1385.6861 S K 505 517 PSM KQITEDTVEFGS 3181 sp|P28288-2|ABCD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5958 23.108 2 1352.646 1352.6460 F - 538 550 PSM KQTLDEPEVPEIFT 3182 sp|Q6NZY4-2|ZCHC8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8679 28.214 2 1644.8247 1644.8247 E K 337 351 PSM KSAIDLTPIVVED 3183 sp|Q14839|CHD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8313 27.254 2 1398.7606 1398.7606 E K 1647 1660 PSM KSGDAAIVDMVPG 3184 sp|Q5VTE0|EF1A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:35 ms_run[2]:scan=5461 22.166 2 1274.6177 1274.6177 L K 395 408 PSM KSGLPVGPENGVELS 3185 sp|P08240-2|SRPRA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6784 24.429 2 1481.7726 1481.7726 E K 163 178 PSM KSLDIAPGDMLD 3186 sp|Q9H4B0-3|OSGP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:35 ms_run[2]:scan=6342 23.711 2 1289.6173 1289.6173 G K 191 203 PSM KSMFAGVPTM 3187 sp|O15260-2|SURF4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 3-UNIMOD:35,10-UNIMOD:35 ms_run[2]:scan=5275 21.763 2 1099.5042 1099.5042 G R 139 149 PSM KSTPVTSAVQIPEV 3188 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7578 25.781 2 1454.7981 1454.7981 V K 527 541 PSM KSTPVTVVLPDT 3189 sp|Q15029-2|U5S1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6838 24.519 2 1255.7024 1255.7024 I K 147 159 PSM KSTPYECGFDPMSPA 3190 sp|P03897|NU3M_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 7-UNIMOD:4,12-UNIMOD:35 ms_run[2]:scan=6138 23.388 2 1701.7015 1701.7015 E R 33 48 PSM KTDEIGEICVSS 3191 sp|Q9P265|DIP2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 9-UNIMOD:4 ms_run[2]:scan=6146 23.401 2 1336.618 1336.6180 C R 745 757 PSM KTDYIPLLDVDE 3192 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8974 29.2 2 1419.7133 1419.7133 G K 44 56 PSM KTLEEPVSTE 3193 sp|Q99590|SCAFB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4475 19.536 2 1131.5659 1131.5659 K K 1450 1460 PSM KTLQALQIPAA 3194 sp|P46940|IQGA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7167 25.062 2 1152.6867 1152.6867 Q K 556 567 PSM KTSSVFEDPVIS 3195 sp|Q9Y2R9|RT07_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7215 25.153 2 1307.6609 1307.6609 G K 81 93 PSM KTTLLEGFAGVEEA 3196 sp|P35658-2|NU214_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8610 28.035 2 1463.7508 1463.7508 L R 758 772 PSM KTVLDQQQTPS 3197 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4316 18.912 2 1243.6408 1243.6408 L R 1128 1139 PSM KVASSPVMVSNPAT 3198 sp|P51610-2|HCFC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5245 21.685 2 1386.7177 1386.7177 V R 525 539 PSM KVDQEIINIMQD 3199 sp|O96000-2|NDUBA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 10-UNIMOD:35 ms_run[2]:scan=6683 24.256 2 1460.7181 1460.7181 Y R 91 103 PSM KVNATGPQFVSGVIV 3200 sp|Q4G0J3|LARP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8221 27.04 2 1514.8457 1514.8457 E K 443 458 PSM KVNIVPVIA 3201 sp|Q15019|SEPT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7413 25.493 2 951.6117 951.6117 N K 174 183 PSM KVPSALAPASQEPSPAASAEADG 3202 sp|O00429-7|DNM1L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5694 22.638 3 2150.0491 2150.0491 S K 332 355 PSM KVQPPTPLLPSV 3203 sp|O60885|BRD4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8007 26.61 2 1274.7598 1274.7598 Q K 937 949 PSM KVTDAIVLLD 3204 sp|P11172-3|UMPS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8318 27.262 2 1085.6332 1085.6332 L R 53 63 PSM KVVVIPYVSS 3205 sp|Q86V21-2|AACS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7513 25.67 2 1089.6434 1089.6434 K R 235 245 PSM KVVVQGIPEVS 3206 sp|O14802|RPC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6559 24.053 2 1153.6707 1153.6707 P R 1198 1209 PSM KVYTITPLLSDN 3207 sp|P32121-5|ARRB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8080 26.751 2 1362.7395 1362.7395 C R 256 268 PSM MVTRFLGP 3208 sp|O14957|QCR10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 1-UNIMOD:35 ms_run[2]:scan=6268 23.592 2 935.48987 935.4899 - R 1 9 PSM PPKVTSELL 3209 sp|Q9NQW7-2|XPP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6637 24.178 2 982.5699 982.5699 M R 2 11 PSM RAVFVDLEPTVIDEV 3210 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=9150 29.982 2 1700.8985 1700.8985 P R 64 79 PSM RDLYPDSDWVPPPPPV 3211 sp|Q96T37-4|RBM15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8799 28.582 2 1848.9046 1848.9046 D R 534 550 PSM RDPPMFIPTPVD 3212 sp|Q92621|NU205_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 5-UNIMOD:35 ms_run[2]:scan=7474 25.601 2 1399.6806 1399.6806 M R 1603 1615 PSM REDPLIIPVPASENPF 3213 sp|P50150|GBG4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=9192 30.176 2 1792.9359 1792.9359 V R 50 66 PSM REPCITPSGITYD 3214 sp|Q9UNE7-2|CHIP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 4-UNIMOD:4 ms_run[2]:scan=7135 25.003 2 1507.6977 1507.6977 M R 169 182 PSM REPEDEGEDDD 3215 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=3388 15.017 2 1304.464 1304.4640 K - 239 250 PSM REPGAPPDPETPAV 3216 sp|O15013-7|ARHGA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5333 21.891 2 1431.6994 1431.6994 R R 907 921 PSM REVDDLGPEVGDI 3217 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7449 25.547 2 1412.6783 1412.6783 K K 371 384 PSM RGLLPGLLPAPAD 3218 sp|Q6P2E9|EDC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8941 29.074 2 1288.7503 1288.7503 P K 678 691 PSM RGPLEPSEPAVVAAA 3219 sp|P29372-5|3MG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6521 24 2 1462.778 1462.7780 E R 229 244 PSM RGPLPAAPPVAPE 3220 sp|Q9NQC3-2|RTN4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6033 23.227 2 1270.7034 1270.7034 P R 91 104 PSM RIDAAEGPSDIPD 3221 sp|P42771-2|CDN2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5539 22.338 2 1354.6365 1354.6365 A - 93 106 PSM RLDIDSPPITA 3222 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6979 24.756 2 1196.6401 1196.6401 C R 32 43 PSM RLLDMDGIIVE 3223 sp|Q14152-2|EIF3A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 5-UNIMOD:35 ms_run[2]:scan=7804 26.214 2 1288.6697 1288.6697 A K 306 317 PSM RMPDCSVALPFPSIS 3224 sp|Q14676-3|MDC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 5-UNIMOD:4 ms_run[2]:scan=9027 29.417 2 1675.8062 1675.8062 G K 58 73 PSM RNVIPDTPPSTPLVPS 3225 sp|Q9UKA4|AKA11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=7478 25.607 2 1688.9097 1688.9097 D R 1094 1110 PSM RPLFSPLSSSPTPMTIC 3226 sp|Q96F44-3|TRI11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 14-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=8327 27.287 2 1905.9329 1905.9329 L R 438 455 PSM RSLEEGEGPIAVIMTPT 3227 sp|Q7L014|DDX46_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=8852 28.757 2 1798.9135 1798.9135 Q R 438 455 PSM RVPDGMVGLIIG 3228 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 6-UNIMOD:35 ms_run[2]:scan=7871 26.348 2 1241.6802 1241.6802 Y R 150 162 PSM KAGEVINQPMMMAA 3229 sp|P18206|VINC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=4358 19.074348995466668 2 1489.690098 1489.709127 Q R 889 903 PSM RDMTLPPETNVILT 3230 sp|P27816|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:35 ms_run[1]:scan=7896 26.394531431466664 2 1614.828574 1614.828708 A K 448 462 PSM KTDPTTLTDEEIN 3231 sp|P11586|C1TC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=5728 22.699558142666667 2 1476.684249 1475.699134 E R 504 517 PSM KPVLMALAEGPGAEGP 3232 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35 ms_run[1]:scan=9538 31.3316486184 2 1552.801243 1551.796680 T R 575 591 PSM KTVTNAVVTVPAYFNDSQ 3233 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8225 27.048097816 2 1952.986420 1952.984357 G R 137 155 PSM RESNTPAPSTQGLPDSWGIIAEP 3234 sp|O14654|IRS4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8924 29.020774430933333 3 2422.177346 2422.176468 K R 929 952 PSM KELILFSNSDNE 3235 sp|P11388|TOP2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8048 26.693844159466668 2 1408.672459 1407.688175 N R 701 713 PSM RLDIDSPPITA 3236 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 20 ms_run[1]:scan=6767 24.403376106133333 2 1197.6592 1196.6392 C R 32 43 PSM KGVNLPGAAVDLPAVSE 3237 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=9828 32.34900613546667 2 1636.887069 1635.883186 K K 207 224 PSM KEAPEPGMEVV 3238 sp|O15067|PUR4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:35 ms_run[1]:scan=4706 20.312874089599998 2 1200.567810 1200.569640 S K 440 451 PSM KENDPEANIDTIYD 3239 sp|Q14966|ZN638_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=6650 24.1964876736 2 1635.741179 1635.726411 V R 995 1009 PSM KEPEAPEM 3240 sp|Q9UHD8|SEPT9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:35 ms_run[1]:scan=3701 16.3545401528 2 945.412469 945.411348 E - 579 587 PSM KTVLDQQQTPS 3241 sp|P42704|LPPRC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=4293 18.8282797544 2 1243.640684 1243.640831 L R 1128 1139 PSM KAAAGQESEGPAVGPPQPLG 3242 sp|O14497|ARI1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=5854 22.91395875546667 2 1859.938080 1859.937741 M K 51 71 PSM KAPGMNTIDQGMAAL 3243 sp|Q9Y5A9|YTHD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35,12-UNIMOD:35 ms_run[1]:scan=5472 22.1855678128 2 1549.732319 1548.727614 N K 178 193 PSM RVPASETSPGPPPMGPPPPSS 3244 sp|Q9HD15|SRA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 14-UNIMOD:35 ms_run[1]:scan=4896 20.835597618666668 3 2056.987830 2056.988791 P K 62 83 PSM KPVVEMDGDEMT 3245 sp|P48735|IDHP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=3844 17.0562855472 2 1381.573579 1381.574133 A R 48 60 PSM KPEPPAMPQPVPTA 3246 sp|P23396|RS3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 7-UNIMOD:35 ms_run[1]:scan=4887 20.809293650933334 3 1474.747633 1474.749001 G - 230 244 PSM KPLTPDQDEPPF 3247 sp|Q9Y2I7|FYV1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=6796 24.448002646400003 2 1382.673090 1382.671797 F K 31 43 PSM RATDPSQVPDVISSI 3248 sp|O60343|TBCD4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8398 27.447570150933334 2 1584.795560 1583.815501 F R 160 175 PSM KIPVENILGEVGDGF 3249 sp|Q9H845|ACAD9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=9225 30.323990569600003 2 1585.823993 1585.835174 T K 279 294 PSM KLQDLAGGIFPEDEIPE 3250 sp|P56182|RRP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=9105 29.755215129066666 2 1870.943333 1869.936010 R K 330 347 PSM KDVLEVGELA 3251 sp|Q9GZZ1|NAA50_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=7489 25.6225096656 2 1071.581114 1071.581191 Y K 37 47 PSM RAEEYEFLTPVEEAP 3252 sp|P52565|GDIR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8578 27.943979332266668 2 1778.840075 1778.836296 P K 152 167 PSM KEVNGQPVGSDP 3253 sp|Q14168|MPP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=3917 17.360852157866667 2 1226.578529 1225.593881 I R 210 222 PSM KEQGVTFPSGDIQEQLI 3254 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=8693 28.250561005333335 3 1890.953449 1887.957808 F R 257 274 PSM KLATVVGENGSVL 3255 sp|Q9NQS7|INCE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=7210 25.143043994933333 2 1287.710138 1285.724166 E R 109 122 PSM RLLDMDGIIVE 3256 sp|Q14152|EIF3A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35 ms_run[1]:scan=7777 26.160207869066667 2 1288.666419 1288.669688 A K 340 351 PSM KEVSVETVSILS 3257 sp|Q02952|AKA12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=7496 25.63617186213333 2 1289.699110 1289.707848 D K 1248 1260 PSM RDASLMVTNDGATIL 3258 sp|P78371|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 6-UNIMOD:35 ms_run[1]:scan=7694 26.001186083733334 2 1592.771436 1591.787572 G K 57 72 PSM KIISNASCTTNCLAPLA 3259 sp|P04406|G3P_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 8-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=7263 25.23268509973333 2 1833.899518 1832.912455 L K 145 162 PSM KDPGMGAMGGMGGGMGGGMF 3260 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=4715 20.351584417066665 2 1881.678589 1881.682398 E - 554 574 PSM KTMGFCYQILTEPNADP 3261 sp|O95373|IPO7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 3-UNIMOD:35,6-UNIMOD:4 ms_run[1]:scan=8260 27.120437107733334 2 2000.932881 1999.901950 Q R 410 427 PSM RFDDMSSPGLELPSCELS 3262 sp|Q6IN85|P4R3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:35,15-UNIMOD:4 ms_run[1]:scan=8279 27.160082490933334 2 2054.882840 2054.892508 E R 121 139 PSM RLLVVDPETDEQLQ 3263 sp|O14745|NHRF1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 ms_run[1]:scan=7480 25.610580275733334 2 1653.857129 1653.857366 V K 87 101 PSM GGGDLNLK 3264 sp|Q9NXE8|CWC25_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4436 19.386 2 772.40792 772.4079 M K 2 10 PSM KAFLASPEYVNLPINGNG 3265 sp|P09211|GSTP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8612 28.04 2 1902.984 1902.9840 L K 191 209 PSM KAGPPASIVPLM 3266 sp|O96013|PAK4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 12-UNIMOD:35 ms_run[2]:scan=6850 24.539 2 1195.6635 1195.6635 A R 574 586 PSM KAINQQTGAFVEIS 3267 sp|Q92945|FUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6675 24.242 2 1504.7886 1504.7886 V R 448 462 PSM KAPEDTVAEM 3268 sp|P78559|MAP1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 10-UNIMOD:35 ms_run[2]:scan=3813 16.899 2 1105.4961 1105.4961 H K 1509 1519 PSM KASGPPVSELIT 3269 sp|P16402|H13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6767 24.403 2 1197.6605 1197.6605 R K 35 47 PSM KAVDPSSVALVTLGSS 3270 sp|Q8TEM1-2|PO210_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8099 26.784 2 1529.8301 1529.8301 L K 644 660 PSM KAVDSLVPIG 3271 sp|P25705-2|ATPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6742 24.353 2 997.5808 997.5808 I R 144 154 PSM KAVEDDFVEM 3272 sp|Q9BTE3-3|MCMBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 10-UNIMOD:35 ms_run[2]:scan=5603 22.473 2 1197.5224 1197.5224 T R 396 406 PSM KCLDENLEDASQC 3273 sp|Q5JTJ3-3|COA6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 2-UNIMOD:4,13-UNIMOD:4 ms_run[2]:scan=5257 21.714 2 1580.6447 1580.6447 W K 21 34 PSM KDDPSLIEGLDNQ 3274 sp|Q9UII4|HERC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7204 25.132 2 1442.6889 1442.6889 S K 231 244 PSM KDEEETVTT 3275 sp|Q14677-2|EPN4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3733 16.503 2 1050.4717 1050.4717 F K 233 242 PSM KDGAPQVCPIPPEQS 3276 sp|Q9Y5S2|MRCKB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:4 ms_run[2]:scan=5323 21.874 2 1621.777 1621.7770 C K 1068 1083 PSM KDGEDLMDESVL 3277 sp|Q13616|CUL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 7-UNIMOD:35 ms_run[2]:scan=6431 23.846 2 1365.597 1365.5970 L K 105 117 PSM KDGVMDLLTPVQTV 3278 sp|Q7L3T8|SYPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9071 29.609 2 1514.8014 1514.8014 T - 462 476 PSM KDLFDPIIED 3279 sp|P12277|KCRB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=10092 33.365 2 1203.6023 1203.6023 F R 86 96 PSM KDPLGAEAAPGALGQV 3280 sp|Q8WYQ5-3|DGCR8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7230 25.178 2 1492.7886 1492.7886 E K 408 424 PSM KDPPDLLD 3281 sp|Q96SI9-2|STRBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5884 22.966 2 911.46001 911.4600 M R 170 178 PSM KDPYTATMIGFS 3282 sp|Q8TC07-2|TBC15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:35 ms_run[2]:scan=6869 24.566 2 1345.6224 1345.6224 K K 223 235 PSM KDQIYDIFQ 3283 sp|P60842-2|IF4A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8826 28.661 2 1168.5764 1168.5764 F K 193 202 PSM KDSEDITGTLAQQLP 3284 sp|Q6P6B7|ANR16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8116 26.812 2 1614.8101 1614.8101 L R 332 347 PSM KDSTLIMQLL 3285 sp|P62258-2|1433E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 7-UNIMOD:35 ms_run[2]:scan=9000 29.309 2 1176.6424 1176.6424 Y R 193 203 PSM KDTDSEEEI 3286 sp|P0DP25|CALM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4225 18.544 2 1064.451 1064.4510 M R 78 87 PSM KDVLETFTV 3287 sp|P21926|CD9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8568 27.911 2 1050.5597 1050.5597 K K 170 179 PSM KDVMPEVN 3288 sp|P06744|G6PI_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 4-UNIMOD:35 ms_run[2]:scan=3774 16.699 2 946.44298 946.4430 G K 116 124 PSM KEAELDVNEELD 3289 sp|P43034|LIS1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6135 23.383 2 1402.6464 1402.6464 K K 33 45 PSM KEDIDTAM 3290 sp|Q16836|HCDH_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:35 ms_run[2]:scan=3580 15.757 2 937.40626 937.4063 S K 241 249 PSM KEDSQPPTPVSQ 3291 sp|Q92785|REQU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3993 17.651 2 1311.6307 1311.6307 D R 241 253 PSM KEGIPPDQQ 3292 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3555 15.64 2 1010.5033 1010.5033 D R 33 42 PSM KEGIPPDQQ 3293 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3634 16.026 2 1010.5033 1010.5033 D R 33 42 PSM KEGIPPDQQ 3294 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3750 16.584 2 1010.5033 1010.5033 D R 33 42 PSM KEGVECEVINM 3295 sp|P11177-2|ODPB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 6-UNIMOD:4,11-UNIMOD:35 ms_run[2]:scan=5050 21.21 2 1322.5846 1322.5846 S R 240 251 PSM KEIDVIDVT 3296 sp|Q9UPP1-5|PHF8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6721 24.319 2 1030.5546 1030.5546 D R 155 164 PSM KEITALAPSTM 3297 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 11-UNIMOD:35 ms_run[2]:scan=7451 25.552 2 1176.606 1176.6060 Q K 315 326 PSM KELPAPMLSAIQ 3298 sp|Q6ZRQ5|MMS22_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 7-UNIMOD:35 ms_run[2]:scan=6765 24.401 2 1312.7061 1312.7061 E K 984 996 PSM KELTDEEAE 3299 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3873 17.185 2 1062.4717 1062.4717 I R 105 114 PSM KELVYPPDYNPEG 3300 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9426 30.949 2 1519.7195 1519.7195 F K 485 498 PSM KEPEAPEM 3301 sp|Q9UHD8-3|SEPT9_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:35 ms_run[2]:scan=3510 15.447 2 945.41135 945.4113 E - 415 423 PSM KEPEMPGP 3302 sp|P35659-2|DEK_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 5-UNIMOD:35 ms_run[2]:scan=3656 16.131 2 899.40587 899.4059 E R 21 29 PSM KEPGIAGLM 3303 sp|Q9P016-2|THYN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 9-UNIMOD:35 ms_run[2]:scan=5683 22.617 2 930.48445 930.4845 C K 119 128 PSM KEPLVDVVDP 3304 sp|Q99873-2|ANM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7131 24.994 2 1109.5968 1109.5968 I K 209 219 PSM KESTSTESSSQDVESTFSSPEDSLP 3305 sp|Q96RU2-3|UBP28_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7623 25.869 3 2660.1461 2660.1461 S K 486 511 PSM KEVEIVASSDSSISS 3306 sp|Q6P2E9|EDC4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5394 22.017 2 1536.7519 1536.7519 A K 96 111 PSM KGDSSAEEL 3307 sp|P26373-2|RL13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4201 18.448 2 934.42436 934.4244 K K 89 98 PSM KIDTIEIITD 3308 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7671 25.956 2 1159.6336 1159.6336 G R 137 147 PSM KIETTVPPSGLNLN 3309 sp|P26358|DNMT1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7469 25.593 2 1481.809 1481.8090 N R 530 544 PSM KIGELLDQASVT 3310 sp|Q9NX46|ADPRS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7080 24.912 2 1272.6925 1272.6925 K R 248 260 PSM KIGIVGLPNVG 3311 sp|Q9NTK5-3|OLA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8189 26.972 2 1065.6546 1065.6546 L K 24 35 PSM KIGTAEPDYGALYEG 3312 sp|P19174|PLCG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7006 24.795 2 1582.7515 1582.7515 E R 763 778 PSM KIISNASCTTNCLAPLA 3313 sp|P04406-2|G3P_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:4,12-UNIMOD:4 ms_run[2]:scan=7033 24.847 2 1832.9125 1832.9125 L K 103 120 PSM KIIYIAPM 3314 sp|O75643|U520_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:35 ms_run[2]:scan=6152 23.411 2 963.54633 963.5463 F R 537 545 PSM KILDATPACLP 3315 sp|Q9Y5Y2|NUBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 9-UNIMOD:4 ms_run[2]:scan=7177 25.08 2 1197.6427 1197.6427 Q - 261 272 PSM KLDGTEING 3316 sp|Q13247-3|SRSF6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4321 18.931 2 945.47673 945.4767 D R 165 174 PSM KLLDEAIQAV 3317 sp|Q96QK1|VPS35_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7852 26.312 2 1098.6285 1098.6285 E K 14 24 PSM KLNQPPEDGISSV 3318 sp|O43684-2|BUB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5607 22.478 2 1382.7042 1382.7042 F K 8 21 PSM KLPFLPTPMG 3319 sp|Q9UJ83-3|HACL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 9-UNIMOD:35 ms_run[2]:scan=8334 27.3 2 1115.6049 1115.6049 Y K 159 169 PSM KLPFLPTPMG 3320 sp|Q9UJ83-3|HACL1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8960 29.145 2 1099.61 1099.6100 Y K 159 169 PSM KLPIEETLEDSPQT 3321 sp|Q9UKG1|DP13A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7467 25.587 2 1598.8039 1598.8039 D R 6 20 PSM KLPSDVVTAV 3322 sp|P04181|OAT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6487 23.935 2 1027.5914 1027.5914 M R 362 372 PSM KLSDGVAVL 3323 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6470 23.913 2 900.52803 900.5280 A K 396 405 PSM KLSDGVAVL 3324 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6697 24.275 2 900.52803 900.5280 A K 396 405 PSM KLVGPEEALSPGEA 3325 sp|O60568|PLOD3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6329 23.688 2 1395.7246 1395.7246 V R 358 372 PSM KLVPEAVGDQ 3326 sp|P49589-2|SYCC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5061 21.237 2 1054.5659 1054.5659 G K 285 295 PSM KLYTLVLTDPDAPS 3327 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9316 30.556 2 1531.8134 1531.8134 G R 62 76 PSM KLYTLVLTDPDAPS 3328 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9641 31.684 2 1531.8134 1531.8134 G R 62 76 PSM KMISDAIPEL 3329 sp|P40926-2|MDHM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 2-UNIMOD:35 ms_run[2]:scan=7380 25.438 2 1131.5846 1131.5846 E K 272 282 PSM KNLDDGIDDE 3330 sp|P11940-2|PABP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4712 20.337 2 1132.4884 1132.4884 V R 299 309 PSM KNLETPLC 3331 sp|P54819-4|KAD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:4 ms_run[2]:scan=5279 21.772 2 973.49027 973.4903 E K 37 45 PSM KNPEVPVNFAEFS 3332 sp|O15347|HMGB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8506 27.752 2 1476.7249 1476.7249 K K 30 43 PSM KPAIAPPVFVFQ 3333 sp|Q9H6Z4-3|RANB3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8994 29.281 2 1312.7543 1312.7543 E K 9 21 PSM KPALPAGTEDTA 3334 sp|P06396-2|GELS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4537 19.77 2 1169.5928 1169.5928 P K 226 238 PSM KPDDGISPE 3335 sp|Q96I24|FUBP3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3862 17.141 2 956.44509 956.4451 F R 290 299 PSM KPDDGTTPE 3336 sp|Q96AE4|FUBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3395 15.044 2 958.42436 958.4244 F R 312 321 PSM KPGEIDPNPET 3337 sp|Q99459|CDC5L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4381 19.178 2 1195.5721 1195.5721 L K 124 135 PSM KPIFGIPLADAVE 3338 sp|Q15311|RBP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9140 29.935 2 1368.7653 1368.7653 L R 187 200 PSM KPQVVVAPVLMS 3339 sp|Q9H074|PAIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 11-UNIMOD:35 ms_run[2]:scan=6684 24.257 2 1282.7319 1282.7319 A K 115 127 PSM KPVEVSPAVT 3340 sp|Q8N0X7|SPART_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4608 20.003 2 1025.5757 1025.5757 E K 465 475 PSM KPVQTVNITAGFPVVGQ 3341 sp|P38398-8|BRCA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8426 27.533 2 1753.9727 1753.9727 I K 871 888 PSM KQVIDVLETD 3342 sp|P80303-2|NUCB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7026 24.829 2 1158.6132 1158.6132 L K 59 69 PSM KSGVLDESTIATIL 3343 sp|O95747|OXSR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9069 29.598 2 1445.7977 1445.7977 H R 114 128 PSM KSLLQMVPLDEGASE 3344 sp|Q01968-2|OCRL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 6-UNIMOD:35 ms_run[2]:scan=7958 26.522 2 1631.8076 1631.8076 E R 707 722 PSM KSNTYILINTLEPVEEDAEM 3345 sp|Q96MG7|NSE3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 20-UNIMOD:35 ms_run[2]:scan=8973 29.197 3 2324.1094 2324.1094 P R 148 168 PSM KSSGPTSLFAVTVAPPGA 3346 sp|Q00839-2|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9489 31.162 2 1685.8988 1685.8988 G R 186 204 PSM KSVSGTDVQEEC 3347 sp|P49321-4|NASP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 12-UNIMOD:4 ms_run[2]:scan=3680 16.25 2 1337.5769 1337.5769 E R 179 191 PSM KTAVAPIE 3348 sp|P05141|ADT2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=4409 19.278 2 827.47527 827.4753 S R 23 31 PSM KTEMQDNTYPEIL 3349 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 4-UNIMOD:35 ms_run[2]:scan=7318 25.328 2 1596.7341 1596.7341 Y R 491 504 PSM KTIAQGNLSNTDVQAA 3350 sp|P22695|QCR2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5098 21.322 2 1629.8322 1629.8322 V K 359 375 PSM KTLFVGLPPPAD 3351 sp|O15381-3|NVL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8497 27.726 2 1253.702 1253.7020 D R 545 557 PSM KTLLYNPFPPTNESDVI 3352 sp|Q969X6-2|UTP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9029 29.428 2 1946.9989 1946.9989 D R 502 519 PSM KTLSDDLDEAA 3353 sp|Q9H0A0-2|NAT10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5943 23.082 2 1176.551 1176.5510 M K 859 870 PSM KTLTPISAAYA 3354 sp|P31939-2|PUR9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6265 23.589 2 1134.6285 1134.6285 Y R 293 304 PSM KTPEASPEP 3355 sp|Q99460|PSMD1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3786 16.758 2 954.46583 954.4658 G K 310 319 PSM KTPEDGDYSYEIIE 3356 sp|P46821|MAP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7279 25.261 2 1657.7359 1657.7359 T K 1931 1945 PSM KTTLVIME 3357 sp|Q14974-2|IMB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 7-UNIMOD:35 ms_run[2]:scan=5426 22.097 2 949.51542 949.5154 Q R 404 412 PSM KTVVLPPIVAS 3358 sp|O75152|ZC11A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7559 25.751 2 1122.7012 1122.7012 K R 442 453 PSM KVAPAQPSEEGPG 3359 sp|P23588-2|IF4B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3854 17.109 2 1265.6252 1265.6252 G R 472 485 PSM KVGINYQPPTVVPGGDLA 3360 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9716 31.94 2 1823.9781 1823.9781 F K 352 370 PSM KVGINYQPPTVVPGGDLA 3361 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=9808 32.276 2 1823.9781 1823.9781 F K 352 370 PSM KVLEGMEVV 3362 sp|P23284|PPIB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 6-UNIMOD:35 ms_run[2]:scan=5226 21.621 2 1018.5369 1018.5369 G R 171 180 PSM KVLTEIIAS 3363 sp|P08758|ANXA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6527 24.01 2 972.58555 972.5855 E R 108 117 PSM KVVNIVPVIA 3364 sp|Q9UHD8-3|SEPT9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8005 26.606 2 1050.6801 1050.6801 S K 271 281 PSM KVVPEMTEIL 3365 sp|P13804-2|ETFA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 6-UNIMOD:35 ms_run[2]:scan=6375 23.764 2 1173.6315 1173.6315 F K 272 282 PSM MVTRFLGP 3366 sp|O14957|QCR10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7039 24.854 2 919.49496 919.4950 - R 1 9 PSM RAGLAMPGPPLGPVLGQ 3367 sp|Q9Y3B7-3|RM11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 6-UNIMOD:35 ms_run[2]:scan=7978 26.559 2 1645.8974 1645.8974 V R 25 42 PSM RAPLPDLYPFGTM 3368 sp|Q92841|DDX17_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 13-UNIMOD:35 ms_run[2]:scan=8866 28.816 2 1492.7384 1492.7384 I R 68 81 PSM RDLTDYLM 3369 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 8-UNIMOD:35 ms_run[2]:scan=7707 26.024 2 1041.4801 1041.4801 G K 183 191 PSM RDPPMFIPTPVD 3370 sp|Q92621|NU205_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=8400 27.452 2 1383.6857 1383.6857 M R 1603 1615 PSM REDEEESLNEVGYDDIGGC 3371 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 19-UNIMOD:4 ms_run[2]:scan=7240 25.195 3 2184.8753 2184.8753 K R 191 210 PSM RGDGPICLVLAPT 3372 sp|Q92841|DDX17_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 7-UNIMOD:4 ms_run[2]:scan=8637 28.094 2 1367.7231 1367.7231 E R 241 254 PSM RLDIDSPPITA 3373 sp|P14618-2|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6850 24.539 2 1196.6401 1196.6401 C R 32 43 PSM RPVTAGEEDEQVPDSIDA 3374 sp|Q9Y3D0|CIA2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5928 23.048 2 1926.8807 1926.8807 E R 26 44 PSM RSVPTSTVFYPSDGVATE 3375 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=7080 24.912 3 1911.9214 1911.9214 F K 438 456 PSM RVPPPPPIA 3376 sp|P07910-3|HNRPC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5198 21.545 2 942.56509 942.5651 A R 62 71 PSM RVPPPPPIA 3377 sp|P07910-3|HNRPC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5337 21.898 2 942.56509 942.5651 A R 62 71 PSM RVPPPPPIA 3378 sp|P07910-3|HNRPC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5505 22.259 2 942.56509 942.5651 A R 62 71 PSM RVPPPPPIA 3379 sp|P07910-3|HNRPC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5690 22.634 2 942.56509 942.5651 A R 62 71 PSM SKAHPPEL 3380 sp|P62308|RUXG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 1-UNIMOD:1 ms_run[2]:scan=5104 21.333 2 919.47633 919.4763 M K 2 10 PSM KVGINYQPPTVVPGGDLA 3381 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=9890 32.5751337928 2 1824.983668 1823.978149 F K 352 370 PSM KEITALAPSTM 3382 sp|P62736|ACTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:35 ms_run[1]:scan=6253 23.574221086399998 2 1176.606017 1176.606025 Q K 317 328 PSM KFVEGLPINDFS 3383 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8683 28.223206913333335 2 1365.682975 1364.697617 W R 298 310 PSM KGFGFVDFNSEEDA 3384 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8881 28.865306704533335 2 1561.658078 1560.673253 S K 610 624 PSM KALDLDSSC 3385 sp|P31948|STIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 9-UNIMOD:4 ms_run[1]:scan=4743 20.420598325866667 2 1007.457089 1007.459361 Q K 453 462 PSM RPAMEPGNGSLDLGGDSAG 3386 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 4-UNIMOD:35 ms_run[1]:scan=5812 22.847205490399997 2 1816.789862 1815.805741 G R 50 69 PSM KLQPSSSPENSLDPFPP 3387 sp|Q8WWM7|ATX2L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=7916 26.4345831664 2 1839.942302 1838.905044 F R 553 570 PSM RLDIDSPPITA 3388 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=6924 24.655422428266668 2 1196.640456 1196.640102 C R 32 43 PSM KLEAEGVPEVSE 3389 sp|O76003|GLRX3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=5632 22.5243261704 2 1285.637575 1285.640162 V K 67 79 PSM KAVEDDFVEM 3390 sp|Q9BTE3|MCMBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:35 ms_run[1]:scan=5593 22.455318019466667 2 1197.521944 1197.522355 T R 571 581 PSM KVGDDVEFEVSSD 3391 sp|O75534|CSDE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=6449 23.878240225333332 2 1424.6293 1424.6302 L R 64 77 PSM KPLDICEFPFGS 3392 sp|Q99717|SMAD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 6-UNIMOD:4 ms_run[1]:scan=8987 29.254799806666664 2 1409.6602 1408.6692 L K 105 117 PSM KEGIPPDQQ 3393 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=4610 20.012030233866668 2 1010.502989 1010.503275 D R 33 42 PSM RIADISQVYTQNAEM 3394 sp|P60900|PSA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 15-UNIMOD:35 ms_run[1]:scan=6507 23.969570465866664 2 1754.8292 1753.8302 K R 117 132 PSM KLCEAICPAQAITIEAEP 3395 sp|O00217|NDUS8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 3-UNIMOD:4,7-UNIMOD:4 ms_run[1]:scan=8258 27.1162618816 2 2013.996970 2012.991099 C R 115 133 PSM KIDPLAPLD 3396 sp|P11766|ADHX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8213 27.022387599733335 2 980.553860 980.554247 A K 159 168 PSM KLAPITYPQGLAMA 3397 sp|P60763|RAC3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8300 27.21560085546667 2 1472.808726 1472.806122 K R 133 147 PSM KIFVGGLSPDTPEE 3398 sp|Q14103|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=9367 30.746962745066664 2 1487.751481 1487.750775 K K 183 197 PSM KMADEAVCVGPAPTS 3399 sp|P05165|PCCA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 2-UNIMOD:35,8-UNIMOD:4 ms_run[1]:scan=4893 20.83039146133333 2 1547.698835 1547.695980 V K 104 119 PSM KIVYPPQLPGEP 3400 sp|Q9NWU5|RM22_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=7405 25.479789556266667 2 1336.739435 1336.739088 N R 50 62 PSM KGEIPALPPC 3401 sp|O75439|MPPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:4 ms_run[1]:scan=6294 23.6446288872 2 1080.562639 1080.563767 H K 268 278 PSM SKAHPPEL 3402 sp|A8MWD9|RUXGL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 1-UNIMOD:1 ms_run[1]:scan=5065 21.247951198666666 2 919.4744 919.4758 M K 2 10 PSM RQPETVLTETPQDTIELN 3403 sp|P30260|CDC27_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=7837 26.280219575466667 3 2084.053339 2083.043329 H R 196 214 PSM KQTLDEPEVPEIFT 3404 sp|Q6NZY4|ZCHC8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8698 28.262535589066665 2 1644.826760 1644.824668 E K 575 589 PSM KTANVPQTVPM 3405 sp|P46937|YAP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:35 ms_run[1]:scan=4429 19.360645029333334 2 1200.616761 1200.617259 P R 76 87 PSM KEEDSAIPITVPG 3406 sp|Q99856|ARI3A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=7068 24.89628715066667 2 1354.696023 1354.698011 K R 399 412 PSM KGVQVPASPDTVPQPSL 3407 sp|Q92613|JADE3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=7070 24.899076762666667 2 1718.906388 1718.920300 E R 78 95 PSM KEFPFDVQPVPL 3408 sp|Q96BJ3|AIDA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=9172 30.08289217866667 2 1414.748517 1414.749653 N R 106 118 PSM KVDLTPYPTISSIN 3409 sp|O43708|MAAI_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=7994 26.587344690666665 2 1547.8222 1546.8242 F K 177 191 PSM KVDLTPYPTISSIN 3410 sp|O43708|MAAI_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 19 ms_run[1]:scan=8052 26.703235644266666 2 1547.8222 1546.8242 F K 177 191 PSM KLLTLPNGE 3411 sp|Q14204|DYHC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=6958 24.717142799466668 2 984.548976 983.565147 N R 2323 2332 PSM KLIPVLVNGM 3412 sp|Q92973|TNPO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:35 ms_run[1]:scan=7575 25.778375081066667 2 1098.646639 1098.647102 P K 307 317 PSM KAGPPASIVPLM 3413 sp|O96013|PAK4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 12-UNIMOD:35 ms_run[1]:scan=6924 24.655422428266668 2 1196.668272 1195.663481 A R 574 586 PSM KVEIIANDQGN 3414 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=4999 21.08951475066667 2 1200.598020 1199.614616 G R 25 36 PSM KVEIIANDQGN 3415 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=4926 20.91084512986667 2 1200.598020 1199.614616 G R 25 36 PSM KVEPGLGADNSVV 3416 sp|P21333|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=5841 22.895585984533334 2 1285.677228 1283.672131 C R 1019 1032 PSM KALEQLNGFELAG 3417 sp|Q14498|RBM39_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8219 27.035979140266665 2 1389.713910 1388.729980 K R 306 319 PSM KDVNSSSPVMLAF 3418 sp|Q99598|TSNAX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 10-UNIMOD:35 ms_run[1]:scan=8048 26.693844159466668 2 1409.685240 1409.686067 G K 27 40 PSM KVNFPENGFLSPD 3419 sp|P31689|DNJA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8351 27.337450081866667 2 1462.702880 1462.709245 F K 325 338 PSM KVNFPENGFLSPD 3420 sp|P31689|DNJA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=8336 27.303927350933336 2 1462.702880 1462.709245 F K 325 338 PSM KAFYPEEISSMVLT 3421 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 11-UNIMOD:35 ms_run[1]:scan=8208 27.013393831466665 2 1629.806562 1629.796011 T K 112 126 PSM KADIEMPFDPS 3422 sp|O75369-5|FLNB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 6-UNIMOD:35 ms_run[2]:scan=6270 23.596 2 1264.5646 1264.5646 F K 1124 1135 PSM KAEQENQELPDEGTLEETLTNET 3423 sp|P50851-2|LRBA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8520 27.791 3 2617.1879 2617.1879 M R 1020 1043 PSM KALELDPDNETY 3424 sp|O43765|SGTA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6503 23.958 2 1406.6565 1406.6565 K K 184 196 PSM KALQEGAEIVVCTPG 3425 sp|Q86XP3-2|DDX42_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 12-UNIMOD:4 ms_run[2]:scan=6388 23.78 2 1570.8025 1570.8025 A R 252 267 PSM KAPGAIGPYSQAVLVD 3426 sp|P52758|RIDA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7429 25.523 2 1584.8512 1584.8512 A R 13 29 PSM KATQALVLAPT 3427 sp|P60842-2|IF4A1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6053 23.256 2 1111.6601 1111.6601 L R 99 110 PSM KAVGDTPIM 3428 sp|O94817|ATG12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 9-UNIMOD:35 ms_run[2]:scan=4214 18.501 2 946.47937 946.4794 L K 60 69 PSM KAYVDDTPAEQM 3429 sp|P07814|SYEP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 12-UNIMOD:35 ms_run[2]:scan=4209 18.487 2 1382.6024 1382.6024 G K 288 300 PSM KDDPSAMDFVTSAANL 3430 sp|Q9UBT2-2|SAE2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9085 29.669 2 1680.7665 1680.7665 D R 250 266 PSM KDDTDDEIA 3431 sp|P27824|CALX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3789 16.774 2 1020.4247 1020.4247 K K 90 99 PSM KDDTDDEIA 3432 sp|P27824|CALX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3981 17.606 2 1020.4247 1020.4247 K K 90 99 PSM KDFDDLCSLPDLNE 3433 sp|B2RTY4-3|MYO9A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 7-UNIMOD:4 ms_run[2]:scan=8602 28.016 2 1679.7349 1679.7349 Q K 146 160 PSM KDGVGMVEYL 3434 sp|Q13242|SRSF9_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8368 27.38 2 1109.5427 1109.5427 Q R 144 154 PSM KDLDVITIPS 3435 sp|O00139-2|KIF2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7769 26.144 2 1099.6125 1099.6125 M K 195 205 PSM KDLEPESD 3436 sp|Q9UKV3-5|ACINU_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3775 16.704 2 931.41346 931.4135 Q R 516 524 PSM KDLLTPVS 3437 sp|Q9C0B1|FTO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5923 23.034 2 871.50148 871.5015 G R 88 96 PSM KDLPVSEQQE 3438 sp|Q9UNM6|PSD13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4261 18.698 2 1171.5721 1171.5721 I R 186 196 PSM KDMELPTE 3439 sp|P27816-6|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 3-UNIMOD:35 ms_run[2]:scan=4355 19.062 2 977.43756 977.4376 V K 304 312 PSM KDPEQLMNTL 3440 sp|P30876|RPB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 7-UNIMOD:35 ms_run[2]:scan=5586 22.44 2 1203.5805 1203.5805 H R 578 588 PSM KDPGLVDQLV 3441 sp|P49591|SYSC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7762 26.126 2 1082.5972 1082.5972 F K 28 38 PSM KDPIDVNYE 3442 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5747 22.741 2 1091.5135 1091.5135 S K 787 796 PSM KDPSVTQVT 3443 sp|O15126-2|SCAM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4247 18.64 2 973.50803 973.5080 F R 19 28 PSM KDPYPEEMM 3444 sp|Q07157-2|ZO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 8-UNIMOD:35,9-UNIMOD:35 ms_run[2]:scan=4162 18.332 2 1170.4573 1170.4573 R R 925 934 PSM KDSPSVWAAVPG 3445 sp|P07737|PROF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7288 25.276 2 1212.6139 1212.6139 Y K 26 38 PSM KDTTVGTLSQ 3446 sp|P51665|PSMD7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4263 18.707 2 1048.5401 1048.5401 I R 180 190 PSM KDVIIADCG 3447 sp|P23284|PPIB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 8-UNIMOD:4 ms_run[2]:scan=5005 21.107 2 989.48518 989.4852 L K 195 204 PSM KEAAEAESGMAPGGPGEGDGSLVNAS 3448 sp|Q7L2E3-2|DHX30_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5818 22.857 3 2387.0547 2387.0547 T R 46 72 PSM KEDDDDALVPDS 3449 sp|Q5JRA6-2|TGO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5269 21.747 2 1317.5572 1317.5572 E K 412 424 PSM KEGDPAIYAE 3450 sp|Q9UGI8-2|TES_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5041 21.186 2 1091.5135 1091.5135 M R 235 245 PSM KEGIPPDQQ 3451 sp|P62987|RL40_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3842 17.045 2 1010.5033 1010.5033 D R 33 42 PSM KEGLPVALD 3452 sp|Q9Y224|RTRAF_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6660 24.214 2 940.52295 940.5229 T K 176 185 PSM KEINSDQATQGNISSD 3453 sp|Q29RF7|PDS5A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4110 18.124 2 1705.7755 1705.7755 N R 1219 1235 PSM KEITALAPSTM 3454 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 11-UNIMOD:35 ms_run[2]:scan=8401 27.454 2 1176.606 1176.6060 Q K 315 326 PSM KELEDFEM 3455 sp|Q9UG63|ABCF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 8-UNIMOD:35 ms_run[2]:scan=5483 22.206 2 1055.4481 1055.4481 T K 58 66 PSM KELVYPPDYNPEG 3456 sp|P12956-2|XRCC6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9530 31.301 2 1519.7195 1519.7195 F K 485 498 PSM KEMFEDTVEE 3457 sp|Q16576|RBBP7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 3-UNIMOD:35 ms_run[2]:scan=5100 21.326 2 1271.5227 1271.5227 S R 4 14 PSM KEPEMPGP 3458 sp|P35659-2|DEK_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 5-UNIMOD:35 ms_run[2]:scan=3577 15.745 2 899.40587 899.4059 E R 21 29 PSM KEPGTVALVS 3459 sp|Q9HAV7|GRPE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5286 21.791 2 999.56006 999.5601 G K 186 196 PSM KEPSATPPISNLT 3460 sp|P30622-2|CLIP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5987 23.153 2 1353.714 1353.7140 A K 177 190 PSM KEVPPTETVPQV 3461 sp|Q9UKL0|RCOR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5707 22.66 2 1322.7082 1322.7082 K K 285 297 PSM KEVVPQDGIPPP 3462 sp|Q69YN4-3|VIR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5786 22.806 2 1274.6871 1274.6871 S K 1663 1675 PSM KFNISNGGPAPEAITD 3463 sp|P36871|PGM1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6585 24.09 2 1629.7999 1629.7999 I K 130 146 PSM KGDEAEAEPEPELA 3464 sp|Q92791|SC65_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5220 21.607 2 1483.6678 1483.6678 A - 424 438 PSM KGIEILTDMS 3465 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8041 26.68 2 1105.5689 1105.5689 E R 143 153 PSM KGPLLEEQALT 3466 sp|Q52LJ0-1|FA98B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6552 24.043 2 1197.6605 1197.6605 Y K 26 37 PSM KLETDPAIVIN 3467 sp|Q9HAB8-2|PPCS_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6651 24.198 2 1211.6762 1211.6762 F R 58 69 PSM KLGFEDGSVL 3468 sp|P09936|UCHL1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8036 26.662 2 1063.555 1063.5550 D K 105 115 PSM KLPEMDID 3469 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 5-UNIMOD:35 ms_run[2]:scan=4822 20.625 2 975.4583 975.4583 K - 833 841 PSM KLTDCVVM 3470 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 5-UNIMOD:4,8-UNIMOD:35 ms_run[2]:scan=4839 20.675 2 980.46709 980.4671 G R 46 54 PSM KLYTLVLTDPDAPS 3471 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9580 31.468 2 1531.8134 1531.8134 G R 62 76 PSM KNSVTPDMMEEMY 3472 sp|P46777|RL5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 9-UNIMOD:35,12-UNIMOD:35 ms_run[2]:scan=5475 22.191 2 1605.6361 1605.6361 I K 228 241 PSM KNTVCPEQSEALAGGSAGDGAQAAGVT 3473 sp|Q8N1G0-2|ZN687_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 5-UNIMOD:4 ms_run[2]:scan=5587 22.444 3 2545.1715 2545.1715 V K 87 114 PSM KPAASSPETPSAGQQEA 3474 sp|Q9NQS7-2|INCE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3911 17.336 2 1654.7798 1654.7798 P K 416 433 PSM KPAPPPTIEE 3475 sp|P18583-2|SON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=4615 20.028 2 1077.5706 1077.5706 L K 1763 1773 PSM KPGVPMEIVLN 3476 sp|Q9Y4L1|HYOU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 6-UNIMOD:35 ms_run[2]:scan=6434 23.852 2 1211.6584 1211.6584 V K 51 62 PSM KPSQAPTVPSSLGFE 3477 sp|Q9ULL5-2|PRR12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7425 25.517 2 1543.7882 1543.7882 L R 192 207 PSM KPVLTAVPGIT 3478 sp|O75152|ZC11A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7134 25.001 2 1094.6699 1094.6699 E R 595 606 PSM KQDFETVLLLEPGN 3479 sp|Q9H6T3-3|RPAP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8986 29.251 2 1601.8301 1601.8301 A K 211 225 PSM KQLTVGLPPEP 3480 sp|P46019|KPB2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6741 24.351 2 1177.6707 1177.6707 Q R 849 860 PSM KSDTLPLAT 3481 sp|Q15269|PWP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5597 22.461 2 944.51786 944.5179 N R 46 55 PSM KSLDLVTM 3482 sp|Q14141-3|SEPT6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 8-UNIMOD:35 ms_run[2]:scan=5453 22.146 2 921.48412 921.4841 L K 163 171 PSM KTAVETAVLLL 3483 sp|P49368-2|TCPG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9091 29.69 2 1156.7067 1156.7067 Y R 469 480 PSM KTGIPLNVLP 3484 sp|Q96GA3|LTV1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8294 27.2 2 1050.6437 1050.6437 S K 381 391 PSM KTIAPALVS 3485 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5557 22.372 2 898.54877 898.5488 N K 71 80 PSM KTTGEVVSGVVS 3486 sp|Q14008-2|CKAP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5082 21.293 2 1161.6241 1161.6241 G K 84 96 PSM KTVELLSGVVDQT 3487 sp|Q9UJS0|CMC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7795 26.197 2 1387.7559 1387.7559 P K 56 69 PSM KVAPPAVLNDIS 3488 sp|Q9Y520-3|PRC2C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7142 25.016 2 1222.6921 1222.6921 N K 1995 2007 PSM KVDATADYIC 3489 sp|P53396-2|ACLY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 10-UNIMOD:4 ms_run[2]:scan=5416 22.075 2 1154.5278 1154.5278 A K 220 230 PSM KVGINYQPPTVVPGGDLA 3490 sp|Q9BQE3|TBA1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9743 32.035 2 1823.9781 1823.9781 F K 352 370 PSM KVLPPPAGYVPI 3491 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7835 26.276 2 1249.7434 1249.7434 Y R 413 425 PSM KVPAQANGTPTT 3492 sp|Q9BQG0|MBB1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=3716 16.426 2 1183.6197 1183.6197 A K 1219 1231 PSM PEPAKSAPAP 3493 sp|Q16778|H2B2E_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=9543 31.344 2 963.50255 963.5025 M K 2 12 PSM PRAQPSSASYQPVPADPFAIVS 3494 sp|Q4VCS5-2|AMOT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8809 28.607 3 2284.1488 2284.1488 M R 2 24 PSM RAEEITIPADVTPE 3495 sp|Q8IXI2-6|MIRO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7161 25.052 2 1539.7781 1539.7781 P R 36 50 PSM RDPTVEFPPDLCS 3496 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 12-UNIMOD:4 ms_run[2]:scan=7675 25.966 2 1531.6977 1531.6977 T R 3682 3695 PSM RDPTVEFPPDLCS 3497 sp|Q14204|DYHC1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 12-UNIMOD:4 ms_run[2]:scan=8776 28.505 2 1531.6977 1531.6977 T R 3682 3695 PSM RESNTPAPSTQGLPDSWGIIAEP 3498 sp|O14654|IRS4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8951 29.109 3 2422.1765 2422.1765 K R 929 952 PSM RGEIAGPPDTPYEGG 3499 sp|P61086-3|UBE2K_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5531 22.323 2 1514.7001 1514.7001 L R 40 55 PSM RGPLEPSEPAVVAAA 3500 sp|P29372-5|3MG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6506 23.969 2 1462.778 1462.7780 E R 229 244 PSM RITSFVIPEPSPTSQTIQEGS 3501 sp|P41214|EIF2D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=8221 27.04 3 2273.1539 2273.1539 P R 351 372 PSM RYGPEGEAVPVAIPEE 3502 sp|P54098|DPOG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7348 25.389 2 1711.8417 1711.8417 T R 177 193 PSM KLSPPYSSPQEFAQDVG 3503 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=9353 30.69527353146667 2 1849.889424 1848.889394 E R 750 767 PSM KGVGIISEGNETVEDIAA 3504 sp|P05023|AT1A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=7775 26.1540310736 3 1800.9212 1800.9102 A R 629 647 PSM KSSASAPDVDD 3505 sp|Q8NC51|PAIRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=3647 16.089919245333334 2 1090.4763 1090.4773 D P 390 401 PSM KEVFEDAAEI 3506 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=6927 24.659820012266668 2 1149.554656 1149.555370 L R 410 420 PSM RALTVPELTQQVFDA 3507 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=9158 30.019723792533334 2 1686.9092 1686.8932 Y K 282 297 PSM KETGTPISM 3508 sp|P09884|DPOLA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:35 ms_run[1]:scan=3834 17.0005316008 2 978.468138 978.469198 G K 402 411 PSM AHRPGPL 3509 sp|Q2NL82|TSR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 1-UNIMOD:1 ms_run[1]:scan=4658 20.173749978133333 2 788.4278 788.4288 A K 3 10 PSM KVGDVTPQV 3510 sp|Q13428|TCOF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=4988 21.061025386933334 2 941.517549 941.518196 G K 244 253 PSM KVAEVLQVPPM 3511 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:35 ms_run[1]:scan=5982 23.144800929600002 2 1225.673215 1225.674045 N R 100 111 PSM RLFPPDDSPLPVSS 3512 sp|Q05519|SRS11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=7858 26.3253632448 2 1525.778441 1525.777659 L R 63 77 PSM KSGQVYSFGCNDEGALG 3513 sp|P18754|RCC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:4 ms_run[1]:scan=7149 25.031900882133336 2 1788.762004 1787.778464 S R 84 101 PSM KGTPEQPQCGFSNAVVQIL 3514 sp|Q86SX6|GLRX5_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:4 ms_run[1]:scan=8949 29.102746546133336 3 2074.039053 2072.036075 L R 59 78 PSM KSDYDMVDYLNEL 3515 sp|Q14974|IMB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 6-UNIMOD:35 ms_run[1]:scan=8491 27.712078766666664 2 1619.690658 1619.702505 D R 749 762 PSM RGIVNGAAPELPVPTGGPAVGA 3516 sp|P21281|VATB2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=8260 27.120437107733334 2 2000.0682 1999.0842 M R 7 29 PSM KVLPPPAGYVPI 3517 sp|O75533|SF3B1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=7798 26.202795068 2 1249.743045 1249.743445 Y R 413 425 PSM KILQELPSVSQETL 3518 sp|Q96ST2|IWS1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=8134 26.848349158933335 2 1583.8783 1583.8765 L K 639 653 PSM KVVQNDAYTAPALPSSI 3519 sp|Q9BY77|PDIP3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 ms_run[1]:scan=7656 25.925184526666666 3 1772.9344 1772.9303 T R 229 246 PSM KMSASDPNSSIFLTDTA 3520 sp|P23381|SYWC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 2-UNIMOD:35 ms_run[1]:scan=7594 25.811497961333334 2 1800.812692 1799.824745 T K 349 366 PSM KMLVLDEADEMLN 3521 sp|P38919|IF4A3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 2-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=6572 24.072263653333334 2 1551.7146 1551.7155 I K 182 195 PSM KAQGPAGEVYCPSGD 3522 sp|Q8IU81|I2BP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4 ms_run[1]:scan=4983 21.047850618933335 2 1535.660439 1534.672208 I K 536 551 PSM RDPAGPPDGGPDTEP 3523 sp|Q9HBR0|S38AA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=4506 19.647361825333334 2 1476.663857 1476.648101 G R 812 827 PSM KTDGEPGPQGWSP 3524 sp|Q9H773|DCTP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5987 23.152534319999997 2 1354.614960 1354.615344 W R 74 87 PSM KDFLFTPTEVL 3525 sp|Q14147|DHX34_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=9212 30.271813739733332 2 1308.702338 1308.696555 G R 1126 1137 PSM KETCLIPAVQEP 3526 sp|Q14139|UBE4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:4 ms_run[1]:scan=7254 25.218062091466667 2 1383.706260 1383.706802 D K 487 499 PSM KGSQMGTVQPIPCLLSMPT 3527 sp|Q9NZB2|F120A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 5-UNIMOD:35,13-UNIMOD:4,17-UNIMOD:35 ms_run[1]:scan=8079 26.749987537600003 3 2076.003263 2076.005370 G R 519 538 PSM RGPLPAAPPVAPE 3528 sp|Q9NQC3|RTN4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=6140 23.390155538933335 2 1270.702518 1270.703371 P R 91 104 PSM RSTENGSAPSTAPTDQS 3529 sp|Q9BV68|RN126_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=3496 15.396348574933334 2 1705.740869 1704.755085 T R 45 62 PSM KTGEAYVQFEEPEMANQALL 3530 sp|Q12849|GRSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 18 14-UNIMOD:35 ms_run[1]:scan=8446 27.588408813866668 3 2283.0729 2283.0724 R K 289 309 PSM KLEEANGNTQMVE 3531 sp|O94906|PRP6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:35 ms_run[1]:scan=4065 17.93022954746667 2 1478.656706 1477.671873 A K 472 485 PSM RVPPPPPIA 3532 sp|P07910|HNRPC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5668 22.589206871200002 2 942.564056 942.565087 A R 142 151 PSM KSPVPVETL 3533 sp|Q32MZ4|LRRF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=6112 23.3496685552 2 969.550571 968.554247 K K 580 589 PSM KINGMVGLVP 3534 sp|P16333|NCK1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=7607 25.84034130666667 2 1026.595843 1026.589587 R K 234 244 PSM KTVGLPTAMAA 3535 sp|Q9UDR5|AASS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 9-UNIMOD:35 ms_run[1]:scan=5120 21.369556632266665 2 1074.574149 1074.574331 A K 872 883 PSM KTITVPVSGSP 3536 sp|Q7Z589|EMSY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5409 22.051154270666665 2 1084.612447 1084.612825 S K 229 240 PSM KLSDGFNGADL 3537 sp|P62333|PRS10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=7293 25.283570002399998 2 1136.535223 1135.550953 V R 333 344 PSM KVTETVMNGGM 3538 sp|Q5H9R7|PP6R3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 7-UNIMOD:35,11-UNIMOD:35 ms_run[1]:scan=3522 15.488614637333335 2 1198.520719 1197.536960 D K 788 799 PSM KVEIIANDQGN 3539 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5034 21.175107861866664 2 1200.598020 1199.614616 G R 25 36 PSM KLQAAVDGPMDK 3540 sp|P51572|BAP31_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 10-UNIMOD:35 ms_run[1]:scan=5096 21.318029799999998 2 1287.657993 1287.649287 A K 232 244 PSM KLVNANGEAVYC 3541 sp|P04040|CATA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 12-UNIMOD:4 ms_run[1]:scan=5388 22.0048669664 2 1337.628291 1336.644536 F K 221 233 PSM RPLVGVNGLDVTSL 3542 sp|P21333|FLNA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=8860 28.790119509333334 2 1439.799112 1438.814378 E R 1775 1789 PSM RETLLNSATTSLNS 3543 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=6219 23.518363230133332 2 1506.752348 1505.768550 D K 160 174 PSM KVLEQLTGQTPVFS 3544 sp|P62913|RL11_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=8052 26.703235644266666 2 1547.821883 1545.840259 A K 38 52 PSM KLEENLPILQQPTE 3545 sp|O60664|PLIN3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=7901 26.4045066168 2 1650.884681 1650.882852 D K 102 116 PSM KAEPVEVVAP 3546 sp|P09874|PARP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5502 22.252 2 1037.5757 1037.5757 V R 486 496 PSM KAGDPVILYVN 3547 sp|O15321-2|TM9S1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7387 25.449 2 1187.655 1187.6550 Y K 37 48 PSM KATNESEDEIPQLVPIG 3548 sp|O76021-2|RL1D1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8486 27.7 2 1838.9262 1838.9262 V K 136 153 PSM KAVLPTPVT 3549 sp|O75151|PHF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5709 22.665 2 924.56442 924.5644 K K 711 720 PSM KCGEDDETIPSEY 3550 sp|P20810-4|ICAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 2-UNIMOD:4 ms_run[2]:scan=5618 22.497 2 1541.6192 1541.6192 E R 286 299 PSM KDDEVQVV 3551 sp|Q9UNX3|RL26L_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4779 20.515 2 930.46583 930.4658 R R 51 59 PSM KDDPTLLSSG 3552 sp|P22061|PIMT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5250 21.697 2 1031.5135 1031.5135 R R 125 135 PSM KDEPDTNLVALM 3553 sp|O95433-2|AHSA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 12-UNIMOD:35 ms_run[2]:scan=6746 24.36 2 1360.6544 1360.6544 A K 125 137 PSM KDPFVIPLG 3554 sp|Q9H2U1-2|DHX36_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8841 28.713 2 984.56442 984.5644 F K 714 723 PSM KEAMEDGEIDGN 3555 sp|P19338|NUCL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 4-UNIMOD:35 ms_run[2]:scan=3509 15.443 2 1322.5296 1322.5296 A K 627 639 PSM KEEMDFPQLM 3556 sp|O15371-2|EIF3D_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 10-UNIMOD:35 ms_run[2]:scan=7640 25.899 2 1282.5574 1282.5574 V K 122 132 PSM KELIPDTS 3557 sp|Q53F19|NCBP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5138 21.409 2 901.47566 901.4757 L R 57 65 PSM KELLPEI 3558 sp|P49321-4|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7787 26.178 2 840.49567 840.4957 L R 579 586 PSM KELLPVLISAM 3559 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 11-UNIMOD:35 ms_run[2]:scan=8778 28.509 2 1228.7101 1228.7101 V K 199 210 PSM KEMVELPL 3560 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 3-UNIMOD:35 ms_run[2]:scan=7324 25.341 2 973.51542 973.5154 I R 217 225 PSM KEMVELPL 3561 sp|P55072|TERA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8194 26.983 2 957.5205 957.5205 I R 217 225 PSM KFLVGPDGVPL 3562 sp|P07203|GPX1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8613 28.044 2 1140.6543 1140.6543 E R 166 177 PSM KFQDGDLTLYQSNTIL 3563 sp|P09211|GSTP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8851 28.753 2 1854.9363 1854.9363 P R 55 71 PSM KGLTPSQIGVIL 3564 sp|P62277|RS13_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8653 28.127 2 1224.7442 1224.7442 K R 43 55 PSM KICEDSAEILDSDVLD 3565 sp|Q92973-3|TNPO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 3-UNIMOD:4 ms_run[2]:scan=8303 27.227 2 1820.835 1820.8350 Q R 112 128 PSM KIEPIPGESP 3566 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5383 21.997 2 1065.5706 1065.5706 V K 1160 1170 PSM KILDMCAAPGS 3567 sp|Q08J23|NSUN2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 5-UNIMOD:35,6-UNIMOD:4 ms_run[2]:scan=4651 20.147 2 1177.5471 1177.5471 H K 179 190 PSM KITIGQAPTE 3568 sp|P11586|C1TC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5185 21.522 2 1056.5815 1056.5815 R K 543 553 PSM KLAGTLERGAP 3569 sp|Q9NRC6|SPTN5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6921 24.65 2 1111.635 1111.6350 R R 3167 3178 PSM KLEAIITPPPA 3570 sp|O75367-2|H2AY_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6927 24.66 2 1148.6805 1148.6805 G K 123 134 PSM KLEVAPISDIIAI 3571 sp|P13804-2|ETFA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9253 30.397 2 1380.8228 1380.8228 A K 77 90 PSM KLEVIIPE 3572 sp|Q9NPD8|UBE2T_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7529 25.694 2 939.56408 939.5641 F R 52 60 PSM KLITSNTDASDGDSVALV 3573 sp|Q14789-3|GOGB1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7054 24.878 2 1804.9054 1804.9054 Q K 1090 1108 PSM KLIVALM 3574 sp|P08758|ANXA5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 7-UNIMOD:35 ms_run[2]:scan=6762 24.39 2 802.49865 802.4986 E K 79 86 PSM KLSGPILGPGSFPSDD 3575 sp|O14686|KMT2D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8071 26.736 2 1585.7988 1585.7988 S R 2755 2771 PSM KLYTLVLTDPDAPS 3576 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9744 32.041 2 1531.8134 1531.8134 G R 62 76 PSM KLYTLVLTDPDAPS 3577 sp|P30086|PEBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9839 32.39 2 1531.8134 1531.8134 G R 62 76 PSM KPADVYLIDEPSAYLDSEQ 3578 sp|P61221|ABCE1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8797 28.572 3 2152.0212 2152.0212 G R 478 497 PSM KPDVVITE 3579 sp|P49368-2|TCPG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4954 20.974 2 899.4964 899.4964 L K 248 256 PSM KPLPVPPELAPFVG 3580 sp|Q9UQB8-3|BAIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9248 30.385 2 1459.8439 1459.8439 A R 275 289 PSM KSFYPEEVSSMVLT 3581 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 11-UNIMOD:35 ms_run[2]:scan=9644 31.699 2 1631.7753 1631.7753 T K 112 126 PSM KSLDGVTND 3582 sp|Q9UBM7|DHCR7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=3749 16.58 2 947.45599 947.4560 A R 13 22 PSM KSLSSSVLPPSYASD 3583 sp|Q6P6C2-3|ALKB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6474 23.918 2 1536.7672 1536.7672 T R 284 299 PSM KTDSDIIA 3584 sp|P09012|SNRPA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4578 19.907 2 861.44436 861.4444 A K 88 96 PSM KTDSDIIS 3585 sp|P08579|RU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4314 18.904 2 877.43928 877.4393 A K 85 93 PSM KTEDSLMPEEEFL 3586 sp|Q15459|SF3A1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 7-UNIMOD:35 ms_run[2]:scan=8385 27.419 2 1582.7073 1582.7073 L R 686 699 PSM KTGEYPVPLI 3587 sp|P11310|ACADM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8227 27.052 2 1115.6227 1115.6227 D R 69 79 PSM KTIDDLED 3588 sp|P06753-2|TPM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4665 20.197 2 947.44476 947.4448 E K 215 223 PSM KTLAVSGLGVVG 3589 sp|P11388|TOP2A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7136 25.004 2 1099.6601 1099.6601 A R 466 478 PSM KTLPDEVLT 3590 sp|Q9BZZ5-1|API5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6024 23.212 2 1014.5597 1014.5597 L K 88 97 PSM KTPTTILLTPE 3591 sp|O43301|HS12A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7171 25.071 2 1212.6966 1212.6966 Q R 98 109 PSM KVEEDDYPSEELLEDENAINA 3592 sp|Q5JRA6-2|TGO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8475 27.664 3 2421.0707 2421.0707 S K 719 740 PSM KVEMQPTELVS 3593 sp|O43491-3|E41L2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6233 23.539 2 1259.6431 1259.6431 S K 160 171 PSM KVPDGMVGFIIG 3594 sp|Q96AE4|FUBP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 6-UNIMOD:35 ms_run[2]:scan=8386 27.421 2 1247.6584 1247.6584 Y R 106 118 PSM KVSDEPPQLPEPQP 3595 sp|O94761|RECQ4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6399 23.8 2 1559.7831 1559.7831 E R 154 168 PSM KVTEDEEPPTEQD 3596 sp|Q9UI26|IPO11_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4020 17.767 2 1515.6577 1515.6577 P K 904 917 PSM KVVSQYSSLLSPMSVNAVM 3597 sp|P50991|TCPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9107 29.766 3 2039.0431 2039.0431 S K 174 193 PSM MGPDRVTA 3598 sp|Q86Y97-2|KMT5C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 1-UNIMOD:35 ms_run[2]:scan=3686 16.278 2 861.40145 861.4015 - R 1 9 PSM PEPSKSAPAP 3599 sp|Q99877|H2B1N_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=3674 16.221 2 979.49746 979.4975 M K 2 12 PSM RAADPGPGAELDPAAPPPA 3600 sp|Q9BZL4-2|PP12C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6060 23.265 2 1768.8744 1768.8744 L R 72 91 PSM RALPPAQAGALLLALPPASPSAA 3601 sp|Q8WZA9|IRGQ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9184 30.139 3 2152.2368 2152.2368 R R 448 471 PSM RDGTGVVEFV 3602 sp|Q07955-3|SRSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=7711 26.034 2 1077.5455 1077.5455 Y R 154 164 PSM RDLVPGDTVCLSVGD 3603 sp|P98194-2|AT2C1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 10-UNIMOD:4 ms_run[2]:scan=7755 26.112 2 1601.7719 1601.7719 A R 153 168 PSM REECGPLPIVVASP 3604 sp|P82675|RT05_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 4-UNIMOD:4 ms_run[2]:scan=8078 26.749 2 1522.7814 1522.7814 I R 374 388 PSM RELDDATEANEGLS 3605 sp|P35580|MYH10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4997 21.086 2 1518.6798 1518.6798 Q R 1905 1919 PSM RGDGVVLVAPPL 3606 sp|P62310|LSM3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8457 27.617 2 1191.6976 1191.6976 V R 88 100 PSM RLLLPGELA 3607 sp|Q16778|H2B2E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=8213 27.022 2 980.60187 980.6019 V K 100 109 PSM RTPTPAGPTIMPLI 3608 sp|Q96PU8-5|QKI_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 11-UNIMOD:35 ms_run[2]:scan=7941 26.494 2 1479.8119 1479.8119 L R 234 248 PSM RVESPVLPPVLVP 3609 sp|Q99717|SMAD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=9005 29.327 2 1400.8391 1400.8391 K R 130 143 PSM KTTTLSGTAPAAGVVPS 3610 sp|P27816|MAP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=5581 22.429222726133332 2 1556.839406 1556.840987 K R 871 888 PSM KLSPPYSSPQEFAQDVG 3611 sp|Q13263|TIF1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=7780 26.165478814133333 3 1849.8912 1848.8892 E R 750 767 PSM RDPESETDNDSQEIF 3612 sp|P78527|PRKDC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=6563 24.059893087466666 2 1782.7792 1780.7382 Y K 2485 2500 PSM KTETVEEPMEEEEAA 3613 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 9-UNIMOD:35 ms_run[1]:scan=4702 20.299411642133336 2 1737.746747 1736.729842 S K 285 300 PSM KGVVDSDDLPLNVS 3614 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=9182 30.12850849093333 2 1457.759103 1456.740939 V R 434 448 PSM KDLTGQVPTPVV 3615 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6631 24.168473300533332 2 1252.702535 1252.702703 Q K 519 531 PSM KSTPVTSAVQIPEV 3616 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=7538 25.708677720799997 2 1454.799068 1454.798060 V K 527 541 PSM KVLGMDPLPQMSQ 3617 sp|Q96KR1|ZFR_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 5-UNIMOD:35 ms_run[1]:scan=6739 24.347688814666665 2 1458.719700 1458.721072 H R 1028 1041 PSM KVEMDNLDNAQTSGIEEPSET 3618 sp|Q96T23|RSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 4-UNIMOD:35 ms_run[1]:scan=5472 22.1855678128 3 2323.0212 2322.0162 T K 677 698 PSM RLDIDSPPITA 3619 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=7177 25.079586162666665 2 1196.640660 1196.640102 C R 32 43 PSM RLDIDSPPITA 3620 sp|P14618|KPYM_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=7009 24.801321150133333 2 1196.640660 1196.640102 C R 32 43 PSM KGADFLVTEVENGGSLGS 3621 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8525 27.805434417066667 2 1778.840075 1778.868659 Q K 188 206 PSM KQPAIMPGQSYGLEDGSCSY 3622 sp|P14866|HNRPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 6-UNIMOD:35,18-UNIMOD:4 ms_run[1]:scan=7225 25.16936240693333 2 2202.9571 2202.9556 S K 455 475 PSM KYLIANATNPES 3623 sp|P27348|1433T_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=5643 22.548528089066668 2 1320.655385 1319.672131 D K 103 115 PSM KEFCQQEVEPMC 3624 sp|Q96FW1|OTUB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:4 ms_run[1]:scan=4915 20.8869141128 2 1599.635486 1599.636751 V K 201 213 PSM KPNLGNGADLPNY 3625 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=6494 23.947448177866665 2 1372.6632 1371.6782 L R 160 173 PSM KVAEVLQVPPM 3626 sp|P19404|NDUV2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 11-UNIMOD:35 ms_run[1]:scan=6255 23.5765480632 2 1225.673215 1225.674045 N R 100 111 PSM KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE 3627 sp|P05387|RLA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=9379 30.796012381866667 3 2774.423189 2773.424637 G K 61 94 PSM KEGLPVALD 3628 sp|Q9Y224|RTRAF_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6654 24.202552381066667 2 940.522612 940.522947 T K 176 185 PSM KDVQMLQDAIS 3629 sp|Q16543|CDC37_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 5-UNIMOD:35 ms_run[1]:scan=5043 21.192745481866666 2 1262.6152 1262.6171 V K 312 323 PSM RETEDEPGEAGLSSGPAPGGLSGLWE 3630 sp|Q9UHR6|ZNHI2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=8919 29.004953745333335 3 2599.2012 2597.1872 Q R 75 101 PSM KGAEEMETVIPVDVM 3631 sp|Q99497|PARK7_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:35,15-UNIMOD:35 ms_run[1]:scan=6982 24.75971102826667 2 1678.778668 1678.779375 A R 12 27 PSM KVSMAPDGNGGLY 3632 sp|Q16222|UAP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:35 ms_run[1]:scan=5288 21.7956765936 2 1324.595479 1323.612902 N R 215 228 PSM KIFVGGLSPDTPEE 3633 sp|Q14103|HNRPD_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=9617 31.595627936000003 2 1488.755054 1487.750775 K K 183 197 PSM KVFVGGLSPDTSEEQI 3634 sp|O14979|HNRDL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=9515 31.25260722373333 2 1705.861179 1704.857031 K K 234 250 PSM KAAIPPPVYEEQD 3635 sp|Q96I25|SPF45_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=5654 22.5665631072 2 1455.726676 1455.724560 S R 206 219 PSM KVELVPPTPAEIP 3636 sp|O75964|ATP5L_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8219 27.035979140266665 2 1388.791361 1388.791518 A R 35 48 PSM KIVYPPQLPGEP 3637 sp|Q9NWU5|RM22_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=7367 25.415365023200003 2 1336.7389 1336.7386 N R 50 62 PSM KEPVETAVDNNS 3638 sp|Q6FI81|CPIN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=4099 18.0777869 2 1302.595351 1301.609925 L K 96 108 PSM KPEDTTIPSTELA 3639 sp|P48556|PSMD8_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=6008 23.187779916266667 2 1400.7026 1400.7030 Q K 324 337 PSM KEPLPTLPLG 3640 sp|O43464|HTRA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8044 26.686515136 2 1064.613119 1063.627747 T R 237 247 PSM KAALNALQPPEF 3641 sp|Q3ZAQ7|VMA21_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=8159 26.896817558666665 2 1297.7118 1297.7025 D R 6 18 PSM KAADEPAYLTVGTDVSA 3642 sp|P29374|ARI4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=4994 21.08131707733333 2 1708.845091 1706.836296 M K 2 19 PSM KTNLIVNYLPQNMTQEEL 3643 sp|Q12926|ELAV2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 13-UNIMOD:35 ms_run[1]:scan=8579 27.947281582133332 3 2163.096003 2163.088171 S K 38 56 PSM KISELGAGNGGVVF 3644 sp|Q02750|MP2K1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8243 27.0837272736 2 1347.702216 1346.719415 E K 70 84 PSM KNDGSVAGV 3645 sp|P30622|CLIP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=3983 17.613427577866666 2 845.417892 845.424296 G R 98 107 PSM KSPTSPTTPN 3646 sp|Q8IV61-2|GRP3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=3487 15.3595196416 2 1028.534145 1028.513839 S K 386 396 PSM KIIPLYSTLPPQQQQ 3647 sp|O43143|DHX15_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8154 26.884088692533332 3 1753.981567 1752.977421 I R 384 399 PSM KVPQPVPLIAQ 3648 sp|Q7Z333|SETX_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6851 24.540227340266664 2 1188.721417 1188.723044 L K 1636 1647 PSM MAAAPVAAGSGAGRG 3649 sp|Q8TEL6|TP4AP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=3404 15.074906890133333 2 1242.605370 1242.613904 - R 1 16 PSM RDNSTMGYMAA 3650 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 6-UNIMOD:35,9-UNIMOD:35 ms_run[1]:scan=3828 16.9718653 2 1248.474376 1247.491072 L K 620 631 PSM KSTPVTVVLPDT 3651 sp|Q15029|U5S1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6868 24.565464651733336 2 1255.704922 1255.702368 I K 182 194 PSM KVPAINVNDSVT 3652 sp|P23526|SAHH_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6111 23.348737185333334 2 1256.661373 1255.677216 L K 174 186 PSM KTPTPEPAEVET 3653 sp|Q9UHY1|NRBP_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=4677 20.229537332533333 2 1297.641331 1297.640162 V R 430 442 PSM KTIDDLEETLASA 3654 sp|P07951-2|TPM2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=5901 22.9966480064 2 1407.723181 1404.698405 E K 251 264 PSM KQLSFISPPTPQP 3655 sp|O43395|PRPF3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=7455 25.559460134133335 2 1439.783140 1438.782016 K K 158 171 PSM KTIEVLQLQDQGS 3656 sp|Q96GC5|RM48_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6981 24.7586068936 2 1457.776844 1457.772573 T K 130 143 PSM KLAAAISEVVSQTPASTTQAGAPP 3657 sp|P20810|ICAL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=7986 26.57330099653333 3 2294.217495 2294.211791 A R 534 558 PSM KTTLPGVVNGANNPAI 3658 sp|Q92485|ASM3B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6826 24.500658552266668 2 1564.857874 1564.857306 W R 307 323 PSM RDASLMVTNDGATIL 3659 sp|P78371|TCPB_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8435 27.558027783733333 2 1576.776054 1575.792657 G K 57 72 PSM KPTGSVGSTVTTPPPLV 3660 sp|Q86YP4|P66A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6747 24.361872357333333 2 1636.903532 1636.903587 Q R 178 195 PSM KILDQGEDFPASEMT 3661 sp|P30040|ERP29_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 14-UNIMOD:35 ms_run[1]:scan=6463 23.902202311200003 2 1695.765489 1695.766168 G R 208 223 PSM RDMEALNVLPPDVLT 3662 sp|P49589|SYCC_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 3-UNIMOD:35 ms_run[1]:scan=8694 28.252202521333334 2 1697.864654 1697.865822 H R 225 240 PSM KTETVEEPMEEEEAA 3663 sp|P14625|ENPL_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 9-UNIMOD:35 ms_run[1]:scan=4572 19.893883069066664 2 1736.728268 1736.729842 S K 285 300 PSM RPAMEPGNGSLDLGGDSAG 3664 sp|Q00839|HNRPU_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 4-UNIMOD:35 ms_run[1]:scan=5844 22.900767321066667 2 1816.789862 1815.805741 G R 50 69 PSM KDLVFNTESLPSVDN 3665 sp|Q70CQ2|UBP34_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=8037 26.6649212344 2 1677.835668 1676.825731 G R 673 688 PSM RNEGQLNGETNTPIEGNQAGDAAASA 3666 sp|P18583|SON_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=5374 21.974169209333336 3 2584.157960 2584.174964 G R 28 54