MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F29.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F29.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q14444|CAPR1_HUMAN	Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	76.0	null	54-UNIMOD:35	0.06	76.0	3	1	0
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null	54-UNIMOD:35	0.07	58.0	4	2	0
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.04	52.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.10	50.0	2	2	2
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	459-UNIMOD:35	0.05	48.0	1	1	1
PRT	sp|P31942-4|HNRH3_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	206-UNIMOD:35	0.10	48.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	14-UNIMOD:35,1096-UNIMOD:35	0.04	47.0	3	2	1
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.05	46.0	1	1	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	3	1	0
PRT	sp|O60293-4|ZC3H1_HUMAN	Isoform 4 of Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P09651-2|ROA1_HUMAN	Isoform A1-A of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	11	3	2
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	20	3	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	198-UNIMOD:35	0.10	33.0	4	3	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	330-UNIMOD:35,73-UNIMOD:35	0.16	32.0	6	5	3
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	60-UNIMOD:35,63-UNIMOD:35	0.37	31.0	7	4	3
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	12	6	3
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	163-UNIMOD:4	0.10	29.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	630-UNIMOD:35	0.03	28.0	2	2	2
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:35,62-UNIMOD:4	0.15	28.0	7	2	0
PRT	sp|Q9Y2A7|NCKP1_HUMAN	Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q8WXF1|PSPC1_HUMAN	Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	437-UNIMOD:35,443-UNIMOD:35,451-UNIMOD:35,455-UNIMOD:35,456-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	494-UNIMOD:35	0.11	27.0	7	5	4
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q9Y2Q5-3|LTOR2_HUMAN	Isoform 3 of Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.14	26.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	5	1	0
PRT	sp|Q9ULX6-2|AKP8L_HUMAN	Isoform 2 of A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	195-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|Q13443-2|ADAM9_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	553-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	560-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|Q15695|U2AFL_HUMAN	Putative U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 OS=Homo sapiens OX=9606 GN=ZRSR2P1 PE=5 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P61224-2|RAP1B_HUMAN	Isoform 2 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	94-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|Q9UHN6|CEIP2_HUMAN	Cell surface hyaluronidase OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	6	2	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.16	24.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P14927|QCR7_HUMAN	Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	33-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	2	2	2
PRT	sp|Q9NZE8|RM35_HUMAN	39S ribosomal protein L35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL35 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	21-UNIMOD:4	0.05	24.0	3	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	325-UNIMOD:35	0.09	23.0	16	3	1
PRT	sp|P08621-4|RU17_HUMAN	Isoform 4 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	405-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	68-UNIMOD:35,75-UNIMOD:35	0.08	23.0	2	2	2
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9BT25-2|HAUS8_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 8 OS=Homo sapiens OX=9606 GN=HAUS8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	293-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	220-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BXJ9-4|NAA15_HUMAN	Isoform 2 of N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NX20|RM16_HUMAN	39S ribosomal protein L16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P48637-2|GSHB_HUMAN	Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	27-UNIMOD:35	0.03	22.0	3	2	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	3	1	0
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	13-UNIMOD:4,16-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	779-UNIMOD:4,782-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q8NBF2-2|NHLC2_HUMAN	Isoform 2 of NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q6PD74|AAGAB_HUMAN	Alpha- and gamma-adaptin-binding protein p34 OS=Homo sapiens OX=9606 GN=AAGAB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|Q9H2U2-4|IPYR2_HUMAN	Isoform 4 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	44-UNIMOD:4	0.06	21.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	54-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9UBV2-2|SE1L1_HUMAN	Isoform 2 of Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	153-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P06280|AGAL_HUMAN	Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	404-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	3	2	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|O60870-2|KIN17_HUMAN	Isoform 2 of DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	28-UNIMOD:4,30-UNIMOD:35,31-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P35813-2|PPM1A_HUMAN	Isoform Alpha-2 of Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	29-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q8N9N2-2|ASCC1_HUMAN	Isoform 2 of Activating signal cointegrator 1 complex subunit 1 OS=Homo sapiens OX=9606 GN=ASCC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	339-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	662-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	328-UNIMOD:35,330-UNIMOD:35	0.01	20.0	4	1	0
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q16625-5|OCLN_HUMAN	Isoform 5 of Occludin OS=Homo sapiens OX=9606 GN=OCLN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	67-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q8N8L6|ARL10_HUMAN	ADP-ribosylation factor-like protein 10 OS=Homo sapiens OX=9606 GN=ARL10 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	178-UNIMOD:35,160-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|Q8NDV7-2|TNR6A_HUMAN	Isoform 2 of Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P01130-2|LDLR_HUMAN	Isoform 2 of Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96J02-3|ITCH_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6ZRS2-3|SRCAP_HUMAN	Isoform 3 of Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|P28799-3|GRN_HUMAN	Isoform 3 of Progranulin OS=Homo sapiens OX=9606 GN=GRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	363-UNIMOD:4,364-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6P1M0|S27A4_HUMAN	Long-chain fatty acid transport protein 4 OS=Homo sapiens OX=9606 GN=SLC27A4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	2	1	0
PRT	sp|Q8NCA9|ZN784_HUMAN	Zinc finger protein 784 OS=Homo sapiens OX=9606 GN=ZNF784 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|Q96SI1-2|KCD15_HUMAN	Isoform 2 of BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens OX=9606 GN=KCTD15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H9A6|LRC40_HUMAN	Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P52788-2|SPSY_HUMAN	Isoform 2 of Spermine synthase OS=Homo sapiens OX=9606 GN=SMS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q16352|AINX_HUMAN	Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	764-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	3	2	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.12	19.0	2	2	2
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8N6R0-1|EFNMT_HUMAN	Isoform 4 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	250-UNIMOD:4,95-UNIMOD:35,96-UNIMOD:4	0.05	19.0	2	2	2
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1239-UNIMOD:4,1243-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NQG6|MID51_HUMAN	Mitochondrial dynamics protein MID51 OS=Homo sapiens OX=9606 GN=MIEF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	2	2	2
PRT	sp|Q8IU60-2|DCP2_HUMAN	Isoform 2 of m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=DCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96PU5-9|NED4L_HUMAN	Isoform 8 of E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O00483|NDUA4_HUMAN	Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|Q9BQG2-2|NUD12_HUMAN	Isoform 2 of Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NR31-2|SAR1A_HUMAN	Isoform 2 of GTP-binding protein SAR1a OS=Homo sapiens OX=9606 GN=SAR1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	3023-UNIMOD:4	0.01	19.0	2	2	2
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	339-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	3	2	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	538-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q8N2G8-3|GHDC_HUMAN	Isoform 3 of GH3 domain-containing protein OS=Homo sapiens OX=9606 GN=GHDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	73-UNIMOD:4	0.04	19.0	2	2	2
PRT	sp|P23743|DGKA_HUMAN	Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P49427|UB2R1_HUMAN	Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens OX=9606 GN=CDC34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q6GQQ9-2|OTU7B_HUMAN	Isoform 2 of OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96F07-2|CYFP2_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	60-UNIMOD:35,63-UNIMOD:35	0.13	19.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	13	2	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	367-UNIMOD:35,369-UNIMOD:35	0.01	19.0	1	1	0
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	2	2	2
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.14	18.0	2	2	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	148-UNIMOD:4	0.00	18.0	1	1	1
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	211-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	276-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	2	2	2
PRT	sp|Q9BXW9|FACD2_HUMAN	Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	85-UNIMOD:4	0.10	18.0	2	1	0
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	32-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9H223|EHD4_HUMAN	EH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=EHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q96GY0|ZC21A_HUMAN	Zinc finger C2HC domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ZC2HC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1742-UNIMOD:4,1743-UNIMOD:35	0.00	18.0	2	2	2
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q5D862|FILA2_HUMAN	Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	2	2	2
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	3	3	3
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	680-UNIMOD:4	0.01	18.0	2	2	2
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q8IXM6-2|NRM_HUMAN	Isoform 2 of Nurim OS=Homo sapiens OX=9606 GN=NRM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q9UL03-3|INT6_HUMAN	Isoform 3 of Integrator complex subunit 6 OS=Homo sapiens OX=9606 GN=INTS6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q5TDH0-2|DDI2_HUMAN	Isoform 2 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	3	3	3
PRT	sp|Q7L523|RRAGA_HUMAN	Ras-related GTP-binding protein A OS=Homo sapiens OX=9606 GN=RRAGA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q9BTY2|FUCO2_HUMAN	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	269-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q96MX3|ZNF48_HUMAN	Zinc finger protein 48 OS=Homo sapiens OX=9606 GN=ZNF48 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|O43852-13|CALU_HUMAN	Isoform 13 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9Y6B6|SAR1B_HUMAN	GTP-binding protein SAR1b OS=Homo sapiens OX=9606 GN=SAR1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	193-UNIMOD:35	0.05	18.0	2	1	0
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	2	2	2
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q14139|UBE4A_HUMAN	Ubiquitin conjugation factor E4 A OS=Homo sapiens OX=9606 GN=UBE4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	755-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|P39880-9|CUX1_HUMAN	Isoform 11 of Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	2	2	2
PRT	sp|P08237|PFKAM_HUMAN	ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	379-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P02788|TRFL_HUMAN	Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	2	2	2
PRT	sp|Q13404-6|UB2V1_HUMAN	Isoform 4 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|O00743-2|PPP6_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9BV73-2|CP250_HUMAN	Isoform 2 of Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q9HA92|RSAD1_HUMAN	Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RSAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	53-UNIMOD:4,56-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q06481-4|APLP2_HUMAN	Isoform 4 of Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q96DU7|IP3KC_HUMAN	Inositol-trisphosphate 3-kinase C OS=Homo sapiens OX=9606 GN=ITPKC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	434-UNIMOD:4,436-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q8NDD1-6|CA131_HUMAN	Isoform 3 of Uncharacterized protein C1orf131 OS=Homo sapiens OX=9606 GN=C1orf131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q7L3S4|ZN771_HUMAN	Zinc finger protein 771 OS=Homo sapiens OX=9606 GN=ZNF771 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P36508-2|ZNF76_HUMAN	Isoform 1 of Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q14181|DPOA2_HUMAN	DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q8NEL9-2|DDHD1_HUMAN	Isoform 2 of Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	2	2	2
PRT	sp|Q9UPQ9-2|TNR6B_HUMAN	Isoform 3 of Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	927-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P08069|IGF1R_HUMAN	Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1247-UNIMOD:35,1248-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	120-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q07866-7|KLC1_HUMAN	Isoform P of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	568-UNIMOD:4,114-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|Q7L7X3-2|TAOK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q01081|U2AF1_HUMAN	Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	2	2	2
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	373-UNIMOD:4,376-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q59GN2|R39L5_HUMAN	Putative 60S ribosomal protein L39-like 5 OS=Homo sapiens OX=9606 GN=RPL39P5 PE=5 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.16	17.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q5SRI9|MANEA_HUMAN	Glycoprotein endo-alpha-1,2-mannosidase OS=Homo sapiens OX=9606 GN=MANEA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	2	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q3B7T1-4|EDRF1_HUMAN	Isoform 3 of Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q8NFI3|ENASE_HUMAN	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1548-UNIMOD:4	0.01	17.0	2	2	2
PRT	sp|Q8NC56|LEMD2_HUMAN	LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LEMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P61326-2|MGN_HUMAN	Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|Q4J6C6-4|PPCEL_HUMAN	Isoform 4 of Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	535-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q969P0-3|IGSF8_HUMAN	Isoform 3 of Immunoglobulin superfamily member 8 OS=Homo sapiens OX=9606 GN=IGSF8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	2	1	0
PRT	sp|Q9BQ52-2|RNZ2_HUMAN	Isoform 2 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	264-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q96SB8|SMC6_HUMAN	Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	3	2	1
PRT	sp|O43684|BUB3_HUMAN	Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	148-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	666-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q6NUK1|SCMC1_HUMAN	Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q15811-12|ITSN1_HUMAN	Isoform 12 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2573-UNIMOD:35	0.00	16.0	2	1	0
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	397-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9P035|HACD3_HUMAN	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q53FT3|HIKES_HUMAN	Protein Hikeshi OS=Homo sapiens OX=9606 GN=HIKESHI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9H6U6-6|BCAS3_HUMAN	Isoform 6 of Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q86XA9-2|HTR5A_HUMAN	Isoform 2 of HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	868-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|P10398-2|ARAF_HUMAN	Isoform 2 of Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	125-UNIMOD:4,128-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|P43304-2|GPDM_HUMAN	Isoform 2 of Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P57737-2|CORO7_HUMAN	Isoform 2 of Coronin-7 OS=Homo sapiens OX=9606 GN=CORO7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8IWR0|Z3H7A_HUMAN	Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	805-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q5HYI8|RABL3_HUMAN	Rab-like protein 3 OS=Homo sapiens OX=9606 GN=RABL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	2	2	2
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P21283|VATC1_HUMAN	V-type proton ATPase subunit C 1 OS=Homo sapiens OX=9606 GN=ATP6V1C1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	109-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q9Y4W2-3|LAS1L_HUMAN	Isoform 3 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	386-UNIMOD:4,389-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	2	1	0
PRT	sp|Q9GZT8-2|NIF3L_HUMAN	Isoform 2 of NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q00169|PIPNA_HUMAN	Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	2	1	0
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	2	2	2
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.11	16.0	1	1	1
PRT	sp|Q9H1Z4-2|WDR13_HUMAN	Isoform 2 of WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P09936|UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q16698-2|DECR_HUMAN	Isoform 2 of 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens OX=9606 GN=DECR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	2	2	2
PRT	sp|Q96RE7|NACC1_HUMAN	Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	787-UNIMOD:35,791-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q71F23-2|CENPU_HUMAN	Isoform 2 of Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9P032|NDUF4_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 OS=Homo sapiens OX=9606 GN=NDUFAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9C0C4|SEM4C_HUMAN	Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9Y4B4|ARIP4_HUMAN	Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	225-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.00	16.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q86WP2-3|GPBP1_HUMAN	Isoform 3 of Vasculin OS=Homo sapiens OX=9606 GN=GPBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	141-UNIMOD:4,144-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q5JTJ3-3|COA6_HUMAN	Isoform 3 of Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	12-UNIMOD:4	0.10	16.0	1	1	1
PRT	sp|A5PLN9-7|TPC13_HUMAN	Isoform 5 of Trafficking protein particle complex subunit 13 OS=Homo sapiens OX=9606 GN=TRAPPC13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	248-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|O43896|KIF1C_HUMAN	Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	685-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|O75586-3|MED6_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q03013-3|GSTM4_HUMAN	Isoform 3 of Glutathione S-transferase Mu 4 OS=Homo sapiens OX=9606 GN=GSTM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|O43683-2|BUB1_HUMAN	Isoform 2 of Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q70UQ0-3|IKIP_HUMAN	Isoform 3 of Inhibitor of nuclear factor kappa-B kinase-interacting protein OS=Homo sapiens OX=9606 GN=IKBIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.17	16.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q68CQ7-2|GL8D1_HUMAN	Isoform 2 of Glycosyltransferase 8 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GLT8D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q8N543|OGFD1_HUMAN	Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q03468|ERCC6_HUMAN	DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9BVA0|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9Y2V7-2|COG6_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 6 OS=Homo sapiens OX=9606 GN=COG6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	234-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	194-UNIMOD:4	0.01	16.0	3	2	1
PRT	sp|Q7Z4G4-3|TRM11_HUMAN	Isoform 3 of tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens OX=9606 GN=TRMT11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q9HAD4-2|WDR41_HUMAN	Isoform 2 of WD repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=WDR41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q9H4A5-2|GLP3L_HUMAN	Isoform 2 of Golgi phosphoprotein 3-like OS=Homo sapiens OX=9606 GN=GOLPH3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P20674|COX5A_HUMAN	Cytochrome c oxidase subunit 5A, mitochondrial OS=Homo sapiens OX=9606 GN=COX5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	88-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q13595-4|TRA2A_HUMAN	Isoform 4 of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	42-UNIMOD:4,44-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NUQ2|PLCE_HUMAN	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens OX=9606 GN=AGPAT5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P07320|CRGD_HUMAN	Gamma-crystallin D OS=Homo sapiens OX=9606 GN=CRYGD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|O95433|AHSA1_HUMAN	Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P22830|HEMH_HUMAN	Ferrochelatase, mitochondrial OS=Homo sapiens OX=9606 GN=FECH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|O00754|MA2B1_HUMAN	Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9HB07|MYG1_HUMAN	MYG1 exonuclease OS=Homo sapiens OX=9606 GN=MYG1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	361-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	0
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	173-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|O43924|PDE6D_HUMAN	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	20-UNIMOD:35	0.05	15.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|O75376-3|NCOR1_HUMAN	Isoform 3 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.11	15.0	1	1	1
PRT	sp|Q96BP3-2|PPWD1_HUMAN	Isoform 2 of Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q8WYQ5-3|DGCR8_HUMAN	Isoform 3 of Microprocessor complex subunit DGCR8 OS=Homo sapiens OX=9606 GN=DGCR8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q96BN2|TADA1_HUMAN	Transcriptional adapter 1 OS=Homo sapiens OX=9606 GN=TADA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P53365-3|ARFP2_HUMAN	Isoform 3 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9P289-3|STK26_HUMAN	Isoform 3 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|Q9NX00|TM160_HUMAN	Transmembrane protein 160 OS=Homo sapiens OX=9606 GN=TMEM160 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q71UI9-5|H2AV_HUMAN	Isoform 5 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.15	15.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	91-UNIMOD:35	0.06	15.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	317-UNIMOD:4	0.01	15.0	1	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q6ZRP7|QSOX2_HUMAN	Sulfhydryl oxidase 2 OS=Homo sapiens OX=9606 GN=QSOX2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P38432|COIL_HUMAN	Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q71DI3|H32_HUMAN	Histone H3.2 OS=Homo sapiens OX=9606 GN=H3C15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.06	15.0	4	1	0
PRT	sp|P16885|PLCG2_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q96MN5-2|TEAN2_HUMAN	Isoform 2 of Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCEANC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	0
PRT	sp|Q53R41|FAKD1_HUMAN	FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	686-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|O14594|NCAN_HUMAN	Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	355-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q9H1Y0-2|ATG5_HUMAN	Isoform Short of Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q9Y376|CAB39_HUMAN	Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9Y2U9|KLDC2_HUMAN	Kelch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KLHDC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q5W0B1|OBI1_HUMAN	ORC ubiquitin ligase 1 OS=Homo sapiens OX=9606 GN=OBI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O00462|MANBA_HUMAN	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q15048|LRC14_HUMAN	Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9BVC3|DCC1_HUMAN	Sister chromatid cohesion protein DCC1 OS=Homo sapiens OX=9606 GN=DSCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NY74|ETAA1_HUMAN	Ewing's tumor-associated antigen 1 OS=Homo sapiens OX=9606 GN=ETAA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9NSY2|STAR5_HUMAN	StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q68D91-2|MBLC2_HUMAN	Isoform 2 of Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MBLAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NVS9-4|PNPO_HUMAN	Isoform 4 of Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q12756|KIF1A_HUMAN	Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|O00763-3|ACACB_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	1962-UNIMOD:35	0.00	15.0	1	1	1
PRT	sp|Q7L0J3-2|SV2A_HUMAN	Isoform 2 of Synaptic vesicle glycoprotein 2A OS=Homo sapiens OX=9606 GN=SV2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O15541|R113A_HUMAN	E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q6NUK1-2|SCMC1_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q8NCM8|DYHC2_HUMAN	Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P52657|T2AG_HUMAN	Transcription initiation factor IIA subunit 2 OS=Homo sapiens OX=9606 GN=GTF2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q9NWQ9|CN119_HUMAN	Uncharacterized protein C14orf119 OS=Homo sapiens OX=9606 GN=C14orf119 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P27544-2|CERS1_HUMAN	Isoform 2 of Ceramide synthase 1 OS=Homo sapiens OX=9606 GN=CERS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|O15504-2|NUP42_HUMAN	Isoform 2 of Nucleoporin NUP42 OS=Homo sapiens OX=9606 GN=NUP42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q96RT7-2|GCP6_HUMAN	Isoform 2 of Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q8N5C6-2|SRBD1_HUMAN	Isoform 2 of S1 RNA-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SRBD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	412-UNIMOD:35	0.02	15.0	2	1	0
PRT	sp|Q9H0W5|CCDC8_HUMAN	Coiled-coil domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CCDC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9H0A8|COMD4_HUMAN	COMM domain-containing protein 4 OS=Homo sapiens OX=9606 GN=COMMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|O75718|CRTAP_HUMAN	Cartilage-associated protein OS=Homo sapiens OX=9606 GN=CRTAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P11171-7|EPB41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P08174-4|DAF_HUMAN	Isoform 4 of Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	564-UNIMOD:35	0.01	15.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	769-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9H0M0-6|WWP1_HUMAN	Isoform 6 of NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9Y512|SAM50_HUMAN	Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q8WVE0|EFMT1_HUMAN	EEF1A lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EEF1AKMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UG56-2|PISD_HUMAN	Isoform 2 of Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Homo sapiens OX=9606 GN=PISD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q6NUM9|RETST_HUMAN	All-trans-retinol 13,14-reductase OS=Homo sapiens OX=9606 GN=RETSAT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	2	1	0
PRT	sp|Q8IYI6|EXOC8_HUMAN	Exocyst complex component 8 OS=Homo sapiens OX=9606 GN=EXOC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	574-UNIMOD:35	0.02	15.0	2	2	2
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	521-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q05397-4|FAK1_HUMAN	Isoform 4 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q96GC9|VMP1_HUMAN	Vacuole membrane protein 1 OS=Homo sapiens OX=9606 GN=VMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P49593-2|PPM1F_HUMAN	Isoform 2 of Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P10619-2|PPGB_HUMAN	Isoform 2 of Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	2	2	2
PRT	sp|Q96SI9|STRBP_HUMAN	Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	192-UNIMOD:35	0.02	15.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|O14647-2|CHD2_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UN81|LORF1_HUMAN	LINE-1 retrotransposable element ORF1 protein OS=Homo sapiens OX=9606 GN=L1RE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O95248|MTMR5_HUMAN	Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|P42785|PCP_HUMAN	Lysosomal Pro-X carboxypeptidase OS=Homo sapiens OX=9606 GN=PRCP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q14493-2|SLBP_HUMAN	Isoform 2 of Histone RNA hairpin-binding protein OS=Homo sapiens OX=9606 GN=SLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q7Z7A4-3|PXK_HUMAN	Isoform 3 of PX domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=PXK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9HBF4-2|ZFYV1_HUMAN	Isoform 2 of Zinc finger FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZFYVE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	352-UNIMOD:4,355-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q16656-3|NRF1_HUMAN	Isoform 3 of Nuclear respiratory factor 1 OS=Homo sapiens OX=9606 GN=NRF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P49750-1|YLPM1_HUMAN	Isoform 1 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|Q8NCN5|PDPR_HUMAN	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9BTL3|RAMAC_HUMAN	RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NRG7|D39U1_HUMAN	Epimerase family protein SDR39U1 OS=Homo sapiens OX=9606 GN=SDR39U1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NVU0-3|RPC5_HUMAN	Isoform 3 of DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P62820-2|RAB1A_HUMAN	Isoform 2 of Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q6UWI4|SHSA2_HUMAN	Protein shisa-2 homolog OS=Homo sapiens OX=9606 GN=SHISA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null	75-UNIMOD:4,76-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.00	15.0	1	1	1
PRT	sp|Q15120|PDK3_HUMAN	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q9H8Y5|ANKZ1_HUMAN	Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKZF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	2	1	0
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	0
PRT	sp|P52788|SPSY_HUMAN	Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	0
PRT	sp|P28331|NDUS1_HUMAN	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	0
PRT	sp|Q6ZU35|CRACD_HUMAN	Capping protein inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	1010-UNIMOD:35	0.01	15.0	2	2	2
PRT	sp|Q53F19|NCBP3_HUMAN	Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q8TD31|CCHCR_HUMAN	Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P49916|DNLI3_HUMAN	DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null	404-UNIMOD:4	0.01	15.0	1	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q8IXB1|DJC10_HUMAN	DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q96L93|KI16B_HUMAN	Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9NW81|DMAC2_HUMAN	Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P28290|ITPI2_HUMAN	Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	1	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	76	42-UNIMOD:35	ms_run[1]:scan=4698	19.637231322133335	3	3718.716510	3718.712910	S	K	13	55
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	2	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	42-UNIMOD:35	ms_run[2]:scan=4804	20.024	4	3718.7129	3718.7129	S	K	13	55
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	3	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	42-UNIMOD:35	ms_run[2]:scan=4692	19.618	4	3718.7129	3718.7129	S	K	13	55
PSM	RGGSGGSYGGGGSGGGYGGGSGS	4	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=3818	16.555	2	1790.7204	1790.7204	S	R	490	513
PSM	RSSGSPYGGGYGSGGGSGGYGS	5	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4879	20.304	2	1909.7827	1909.7827	G	R	332	354
PSM	KSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQ	6	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	29-UNIMOD:35	ms_run[2]:scan=5131	21.166	4	4488.1351	4488.1351	E	K	431	477
PSM	RGGGGSGGYYGQGGMSGGGW	7	sp|P31942-4|HNRH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	15-UNIMOD:35	ms_run[2]:scan=5571	22.585	2	1819.7332	1819.7332	G	R	192	212
PSM	RSPGEGPSPSPMDQPSAPSDPTDQPPAAHA	8	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	12-UNIMOD:35	ms_run[2]:scan=4845	20.171	3	2996.3206	2996.3206	E	K	3	33
PSM	RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGG	9	sp|P04264|K2C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=4398	18.593050754666667	2	2383.954995	2382.944571	S	R	518	549
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	10	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	42-UNIMOD:35	ms_run[1]:scan=4815	20.0646701104	3	3718.716510	3718.712910	S	K	13	55
PSM	RGSGGGGGGGGQGSTNYG	11	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3473	15.078	2	1481.6243	1481.6243	N	K	253	271
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	12	sp|Q14444|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41	42-UNIMOD:35	ms_run[1]:scan=4836	20.13618423626667	3	3718.716510	3718.712910	S	K	13	55
PSM	RGGGSGGGGGSSSSSSSSQQQL	13	sp|O60293-4|ZC3H1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3699	16.081	2	1910.8314	1910.8314	A	R	62	84
PSM	RALSQAAVEEEEEEEEEEEPAQG	14	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5699	22.964	3	2587.1045	2587.1045	H	K	946	969
PSM	RNQGGYGGSSSSSSYGSG	15	sp|P09651-2|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3866	16.747	2	1693.6928	1693.6928	P	R	300	318
PSM	RGGGGNFGPGPGSNF	16	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5720	23.041	2	1376.6222	1376.6222	S	R	201	216
PSM	RNYQQNYQNSESGE	17	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4003	17.249	2	1715.7136	1715.7136	P	K	156	170
PSM	RPDNFVFGQSGAGNNWA	18	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6966	27.07	2	1835.8339	1835.8339	F	K	86	103
PSM	KAMGIMNSFVNDIFE	19	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7395	29.024	2	1746.7957	1746.7957	S	R	58	73
PSM	KEALQDVEDENQ	20	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4857	20.208	2	1416.6369	1416.6369	N	-	222	234
PSM	KSVTEQGAELSNEE	21	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4669	19.527	2	1519.7002	1519.7002	M	R	27	41
PSM	RGSGGGGGGGGQGSTNYG	22	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3510	15.217631718933335	2	1482.608482	1481.624346	N	K	253	271
PSM	KSVTEQGAELSNEE	23	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4679	19.56	2	1519.7002	1519.7002	M	R	27	41
PSM	RNPDDITNEEYGEFY	24	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6683	25.956	2	1860.7802	1860.7802	T	K	299	314
PSM	RVIGSGCNLDSA	25	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4	ms_run[2]:scan=4884	20.32	2	1247.5928	1247.5928	N	R	157	169
PSM	KAMGIMNSFVNDIFE	26	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7628	30.013	2	1746.7957	1746.7957	S	R	58	73
PSM	KEAMEDGEIDGN	27	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=3722	16.161	2	1322.5296	1322.5296	A	K	627	639
PSM	RIIPGFMCQGGDFT	28	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6615	25.72	2	1613.733	1613.7330	H	R	55	69
PSM	RNNNQQLAQLQ	29	sp|Q9Y2A7|NCKP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4865	20.242	2	1325.68	1325.6800	T	K	70	81
PSM	RATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHND	30	sp|Q8WXF1|PSPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:35,15-UNIMOD:35,23-UNIMOD:35,27-UNIMOD:35,28-UNIMOD:35	ms_run[1]:scan=5485	22.3147384672	4	3692.579511	3692.578609	N	R	429	466
PSM	KEVDEQMLNVQN	31	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=4611	19.311	2	1461.677	1461.6770	M	K	324	336
PSM	KVEIIANDQGN	32	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4802	20.018	2	1199.6146	1199.6146	G	R	25	36
PSM	RFSGFGSGAGG	33	sp|Q9UKX7-2|NUP50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5270	21.645	2	998.45699	998.4570	G	K	44	55
PSM	RGSGGGGGGGGQGSTNYG	34	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3499	15.1743526944	2	1482.608482	1481.624346	N	K	253	271
PSM	KTIGGGDDSFNTFFSETGAG	35	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7246	28.36	2	2006.8858	2006.8858	D	K	5	25
PSM	RLQAALDDEEAGG	36	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5097	21.04	2	1343.6317	1343.6317	E	R	37	50
PSM	RNGNQAFNEDNL	37	sp|Q9Y2Q5-3|LTOR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5457	22.236	2	1390.6226	1390.6226	D	K	58	70
PSM	RNPDDITQEEYGEFY	38	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6732	26.134	2	1874.7959	1874.7959	T	K	291	306
PSM	RSSGPYGGGGQYFA	39	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5709	23.004	2	1402.6266	1402.6266	G	K	284	298
PSM	RFGFGFGNGM	40	sp|Q9ULX6-2|AKP8L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=6760	26.25	2	1104.4811	1104.4811	S	K	186	196
PSM	RFGFGFGNGM	41	sp|Q9ULX6-2|AKP8L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=6775	26.303	2	1104.4811	1104.4811	S	K	186	196
PSM	RFGNCGFSGNEY	42	sp|Q13443-2|ADAM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4	ms_run[2]:scan=5745	23.106	2	1406.5673	1406.5673	D	K	549	561
PSM	RGAGGFGGGGGT	43	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3954	17.073	2	949.43659	949.4366	N	R	204	216
PSM	RGNNNVMSNYEAY	44	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=4955	20.572	2	1546.6471	1546.6471	D	K	554	567
PSM	RGVVDSEDLPLNIS	45	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6820	26.477	2	1512.7784	1512.7784	I	R	386	400
PSM	RNPDDITQEEYGEFY	46	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7761	30.568	2	1874.7959	1874.7959	T	K	291	306
PSM	RNPNNEFWEAN	47	sp|Q15695|U2AFL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6038	23.882	2	1389.6062	1389.6062	F	R	338	349
PSM	RQWNNCAFLESSA	48	sp|P61224-2|RAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4	ms_run[2]:scan=6375	24.921	2	1581.6994	1581.6994	A	K	89	102
PSM	RNYGFQGGQN	49	sp|Q9UHN6|CEIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4548	19.1235346864	2	1139.515409	1139.510819	S	K	836	846
PSM	KDLFDPIIED	50	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7169	27.995	2	1203.6023	1203.6023	F	R	86	96
PSM	KTAFQEALDAAGD	51	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6922	26.879	2	1335.6307	1335.6307	S	K	8	21
PSM	KWNGWGYNDS	52	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6207	24.37	2	1225.5152	1225.5152	M	K	92	102
PSM	KWYYNAAGFN	53	sp|P14927|QCR7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6470	25.236	2	1232.5615	1232.5615	R	K	19	29
PSM	RFSASSGGGGS	54	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3528	15.292	2	968.43117	968.4312	S	R	12	23
PSM	RGALQNIIPASTGAA	55	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6382	24.941	2	1438.7892	1438.7892	G	K	200	215
PSM	RGGGFGGNDNFG	56	sp|P09651-2|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5290	21.686	2	1153.4901	1153.4901	G	R	206	218
PSM	RGSAVWCQNV	57	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=5722	23.045	2	1175.5506	1175.5506	T	K	27	37
PSM	RISVYYNEATGG	58	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5568	22.578	2	1328.6361	1328.6361	D	K	46	58
PSM	RNFSDNQLQEG	59	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4878	20.298	2	1306.5902	1306.5902	P	K	160	171
PSM	RNPDDITNEEYGEFY	60	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7763	30.579	2	1860.7802	1860.7802	T	K	299	314
PSM	RNPDDITNEEYGEFY	61	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7900	31.051	2	1860.7802	1860.7802	T	K	299	314
PSM	RNPDDITNEEYGEFY	62	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8091	31.714	2	1860.7802	1860.7802	T	K	299	314
PSM	RNPDDITQEEYGEFY	63	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7864	30.932	2	1874.7959	1874.7959	T	K	291	306
PSM	RNPDDITQEEYGEFY	64	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7986	31.343	2	1874.7959	1874.7959	T	K	291	306
PSM	RNWYVDDPYQ	65	sp|Q9NZE8|RM35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6351	24.832	2	1354.5942	1354.5942	R	K	169	179
PSM	RNYFLEEDNY	66	sp|Q53GS9-2|SNUT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6531	25.436	2	1361.5888	1361.5888	L	K	147	157
PSM	RPQNYLFGCEL	67	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4	ms_run[2]:scan=7047	27.432	2	1395.6605	1395.6605	L	K	13	24
PSM	RTDYNASVSVPDSSGPE	68	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5317	21.771	2	1779.7911	1779.7911	L	R	69	86
PSM	RTTPSYVAFTDTE	69	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6108	24.08	2	1486.694	1486.6940	N	R	36	49
PSM	KADLINNLGTIA	70	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6731	26.128	2	1241.698	1241.6980	T	K	100	112
PSM	KEITALAPSTM	71	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=7736	30.474	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	72	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=7941	31.184	2	1176.606	1176.6060	Q	K	315	326
PSM	RELISNSSDALD	73	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5428	22.131	2	1318.6365	1318.6365	L	K	46	58
PSM	RGGGGGQDNGLEGLGNDS	74	sp|P08621-4|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5232	21.503	2	1658.7245	1658.7245	A	R	297	315
PSM	RGLQQQNSDWYL	75	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6779	26.316	2	1506.7215	1506.7215	L	K	336	348
PSM	RGNNNVMSNYEAY	76	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5768	23.157	2	1530.6521	1530.6521	D	K	554	567
PSM	RLWQCGEGF	77	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=6482	25.275	2	1151.5182	1151.5182	V	R	401	410
PSM	RNLAMGVNLTSMS	78	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5441	22.18	2	1424.6752	1424.6752	D	K	64	77
PSM	RNWGGPDFE	79	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6004	23.804	2	1076.4676	1076.4676	G	R	221	230
PSM	RSWLSYSYQS	80	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6588	25.611	2	1275.5884	1275.5884	S	R	718	728
PSM	RWYFNQDSAC	81	sp|Q9BT25-2|HAUS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=6272	24.57	2	1345.551	1345.5510	S	R	284	294
PSM	RYYGGGSEGG	82	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3734	16.207	2	1001.4203	1001.4203	G	R	46	56
PSM	KDSTLIMQLL	83	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:35	ms_run[1]:scan=7391	29.00573968213333	2	1176.645831	1176.642411	Y	R	214	224
PSM	KAMGIMNSFVNDIFE	84	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7766	30.591	2	1746.7957	1746.7957	S	R	58	73
PSM	KEITALAPSTM	85	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=8170	31.994	2	1176.606	1176.6060	Q	K	315	326
PSM	KNALESYAFNM	86	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=6327	24.756	2	1302.5914	1302.5914	A	K	484	495
PSM	KYIDQEELN	87	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5018	20.789	2	1150.5506	1150.5506	E	K	283	292
PSM	RGSSWLQDGSA	88	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5657	22.84	2	1162.5367	1162.5367	L	R	663	674
PSM	RLFNPNDDG	89	sp|Q9BXJ9-4|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5118	21.119	2	1046.4781	1046.4781	C	K	357	366
PSM	RNDSWGSFDL	90	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7184	28.067	2	1195.5258	1195.5258	E	R	649	659
PSM	RNNQNPWTFE	91	sp|Q9NX20|RM16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6462	25.211	2	1304.5898	1304.5898	E	R	207	217
PSM	RPGGYGYGYG	92	sp|P98179|RBM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5059	20.928	2	1045.4617	1045.4617	S	R	121	131
PSM	RQYSLQNWEA	93	sp|P48637-2|GSHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6312	24.71	2	1293.6102	1293.6102	P	R	162	172
PSM	RSFDWGYEE	94	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6434	25.119	2	1187.4884	1187.4884	P	R	164	173
PSM	RVYWNDGLDQY	95	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6681	25.945	2	1427.647	1427.6470	D	R	386	397
PSM	RWNQDTMEQ	96	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=3976	17.149	2	1222.5037	1222.5037	S	K	21	30
PSM	RWSQLLANSAA	97	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6291	24.633	2	1215.636	1215.6360	K	R	2044	2055
PSM	RWVWDQEEE	98	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6645	25.825	2	1275.552	1275.5520	S	R	888	897
PSM	RPDNFVFGQSGAGNNWA	99	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7842	30.853423194666668	2	1836.842742	1835.833945	F	K	86	103
PSM	RNPDDITQEEYGEFY	100	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8146	31.907987062933334	2	1875.794529	1874.795888	T	K	291	306
PSM	RYSGSYNDYL	101	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6208	24.374062166133335	2	1237.529503	1236.541117	A	R	647	657
PSM	KDQLIYNLL	102	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7371	28.923	2	1118.6336	1118.6336	L	K	5	14
PSM	KEITALAPSTM	103	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:35	ms_run[2]:scan=7502	29.484	2	1176.606	1176.6060	Q	K	315	326
PSM	KEITALAPSTM	104	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:35	ms_run[2]:scan=8071	31.644	2	1176.606	1176.6060	Q	K	315	326
PSM	KEVFEDAAEI	105	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6220	24.4	2	1149.5554	1149.5554	L	R	410	420
PSM	KPWCWYCN	106	sp|O43670-3|ZN207_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=6646	25.83	2	1212.4845	1212.4845	L	R	10	18
PSM	RADTQTYQPYN	107	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4517	19.004	2	1355.6106	1355.6106	Y	K	73	84
PSM	RCAWCGGQS	108	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4489	18.895	2	1080.4229	1080.4229	Y	R	778	787
PSM	RFAGSGNEEN	109	sp|Q8NBF2-2|NHLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3522	15.265	2	1079.4632	1079.4632	L	R	30	40
PSM	RFYPWTIDN	110	sp|Q6PD74|AAGAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6965	27.065	2	1210.5771	1210.5771	V	K	43	52
PSM	RGGNFGGGGGNFG	111	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5031	20.834	2	1152.5061	1152.5061	G	R	204	217
PSM	RGNWDEQFD	112	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5819	23.31	2	1165.4789	1165.4789	F	K	170	179
PSM	RGQPCSQNY	113	sp|Q9H2U2-4|IPYR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4	ms_run[2]:scan=3732	16.2	2	1108.472	1108.4720	E	R	40	49
PSM	RGQPCSQNY	114	sp|Q9H2U2-4|IPYR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4	ms_run[2]:scan=3828	16.597	2	1108.472	1108.4720	E	R	40	49
PSM	RINISEGNCPE	115	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:4	ms_run[2]:scan=4843	20.161	2	1287.5877	1287.5877	A	R	46	57
PSM	RLLLPGELA	116	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6840	26.558	2	980.60187	980.6019	V	K	100	109
PSM	RLWCATTYDY	117	sp|Q9UBV2-2|SE1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=6483	25.278	2	1347.5918	1347.5918	G	K	150	160
PSM	RNFADIDDSW	118	sp|P06280|AGAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6864	26.635	2	1237.5364	1237.5364	W	K	227	237
PSM	RNQDNLQGWN	119	sp|P30085-2|KCY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5286	21.679	2	1243.5694	1243.5694	P	K	47	57
PSM	RNWMNSLGVNP	120	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=6078	23.991	2	1302.6139	1302.6139	F	R	401	412
PSM	RNYYGYQGY	121	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5616	22.706	2	1182.5094	1182.5094	Y	R	738	747
PSM	RTATESFASDPILY	122	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6870	26.662	2	1569.7675	1569.7675	V	R	77	91
PSM	RTLSDYNIQ	123	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5352	21.881	2	1108.5513	1108.5513	G	K	54	63
PSM	RTTPSYVAFTDTE	124	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7744	30.506	2	1486.694	1486.6940	N	R	36	49
PSM	RWNQDTMEQ	125	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4838	20.143	2	1206.5088	1206.5088	S	K	21	30
PSM	RWYCQMCQ	126	sp|O60870-2|KIN17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4,6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=4839	20.145	2	1246.4682	1246.4682	L	K	25	33
PSM	RYGLSSMQGW	127	sp|P35813-2|PPM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35	ms_run[2]:scan=6029	23.861	2	1199.5393	1199.5393	L	R	23	33
PSM	RYNLYTAEG	128	sp|Q8N9N2-2|ASCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5347	21.869	2	1085.5142	1085.5142	G	K	294	303
PSM	RYSGSYNDYL	129	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6015	23.835	2	1236.5411	1236.5411	A	R	647	657
PSM	RTTPSYVAFTDTE	130	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7960	31.2491955504	2	1487.702678	1486.693989	N	R	36	49
PSM	RADGYEPPVQESV	131	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5437	22.160841592266667	2	1445.676281	1445.678673	E	-	252	265
PSM	RYALYDATYET	132	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6098	24.046666485066666	2	1364.619412	1364.624846	C	K	81	92
PSM	KEITALAPSTM	133	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35	ms_run[2]:scan=7832	30.819	2	1176.606	1176.6060	Q	K	315	326
PSM	KESYSVYVY	134	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6074	23.984	2	1136.539	1136.5390	R	K	35	44
PSM	KEVDEQMLNVQN	135	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5437	22.161	2	1445.682	1445.6820	M	K	324	336
PSM	KEVVEEAENG	136	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3920	16.916	2	1102.5142	1102.5142	K	R	21	31
PSM	KWWNPPQE	137	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6306	24.687	2	1083.5138	1083.5138	A	K	240	248
PSM	RAILVDLEPGTMDSV	138	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:35	ms_run[2]:scan=6880	26.701	2	1630.8236	1630.8236	P	R	62	77
PSM	RALANSLACQG	139	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:4	ms_run[2]:scan=4849	20.183	2	1159.5768	1159.5768	K	K	331	342
PSM	RATSWYSPY	140	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6271	24.566	2	1129.5193	1129.5193	A	-	298	307
PSM	RAYSSFGGG	141	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4606	19.293	2	900.40898	900.4090	D	R	10	19
PSM	RCASSNWSE	142	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=4259	18.128	2	1095.4404	1095.4404	N	R	661	670
PSM	RFGSGMNMG	143	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=3598	15.624	2	987.39024	987.3902	G	R	323	332
PSM	RFGSGMNMG	144	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=3604	15.65	2	987.39024	987.3902	G	R	323	332
PSM	RFYAGGSE	145	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4354	18.439	2	885.39808	885.3981	Q	R	93	101
PSM	RFYPESSY	146	sp|Q16625-5|OCLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5482	22.3	2	1047.4662	1047.4662	K	K	13	21
PSM	RGCPGAAAAALW	147	sp|Q96EB6-2|SIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4	ms_run[2]:scan=6524	25.404	2	1199.587	1199.5870	A	R	65	77
PSM	RGEAWWGAEAA	148	sp|Q8N8L6|ARL10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6580	25.593	2	1202.5469	1202.5469	D	R	42	53
PSM	RGGAEQFMEETE	149	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35	ms_run[2]:scan=4702	19.657	2	1398.5722	1398.5722	L	R	171	183
PSM	RGGNFGFGDS	150	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5744	23.105	2	1012.4363	1012.4363	G	R	191	201
PSM	RIGGGWGNSDA	151	sp|Q8NDV7-2|TNR6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5152	21.23	2	1088.4999	1088.4999	L	R	1500	1511
PSM	RIYWSDLSQ	152	sp|P01130-2|LDLR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6484	25.282	2	1166.572	1166.5720	N	R	313	322
PSM	RNYEQWQLQ	153	sp|Q96J02-3|ITCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6031	23.864	2	1263.5996	1263.5996	V	R	244	253
PSM	RQFWSNVE	154	sp|Q6ZRS2-3|SRCAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6115	24.106	2	1064.5039	1064.5039	V	K	203	211
PSM	RQGWACCPY	155	sp|P28799-3|GRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5637	22.778	2	1196.4855	1196.4855	N	R	358	367
PSM	RQQWEDDQ	156	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4270	18.17	2	1103.4632	1103.4632	E	R	312	320
PSM	RQSIWTNFSS	157	sp|Q6P1M0|S27A4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6540	25.465	2	1224.5887	1224.5887	L	R	364	374
PSM	RSSGPYGGGGQYFA	158	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7603	29.909	2	1402.6266	1402.6266	G	K	284	298
PSM	RTFNNSSNF	159	sp|Q8NCA9|ZN784_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4998	20.715	2	1085.489	1085.4890	D	R	259	268
PSM	RVWETANN	160	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4341	18.393	2	988.47264	988.4726	L	R	39	47
PSM	RWLAIDANA	161	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6440	25.136	2	1028.5403	1028.5403	Q	R	79	88
PSM	RWLPEEDF	162	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6928	26.902	2	1090.5084	1090.5084	L	R	660	668
PSM	RWQQEQEQ	163	sp|Q96SI1-2|KCD15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3859	16.714	2	1130.5105	1130.5105	E	R	152	160
PSM	RWVIYNDQ	164	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6126	24.13	2	1092.5352	1092.5352	G	K	805	813
PSM	RWWEQTDLT	165	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6633	25.777	2	1233.5778	1233.5778	E	K	77	86
PSM	RWYDLMDN	166	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=6173	24.266	2	1127.4706	1127.4706	A	K	1091	1099
PSM	RYNYLSLDSA	167	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6402	25.01	2	1200.5775	1200.5775	S	K	231	241
PSM	RYWPTADG	168	sp|P52788-2|SPSY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5389	22.013	2	964.44028	964.4403	D	R	69	77
PSM	RTTPSYVAFTDTE	169	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7840	30.84674216026667	2	1487.701062	1486.693989	N	R	36	49
PSM	RGWFPSSYT	170	sp|Q9UHR4|BI2L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6690	25.97312029733333	2	1099.509554	1099.508694	A	K	389	398
PSM	REYQDLLNV	171	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6638	25.799536160266666	2	1148.575792	1148.582588	L	K	377	386
PSM	KCSGNWMWAA	172	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:4	ms_run[2]:scan=6823	26.491	2	1209.5059	1209.5059	V	K	763	773
PSM	KESYSIYVY	173	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6400	25.004	2	1150.5546	1150.5546	R	K	35	44
PSM	KFFVGGNW	174	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7035	27.378	2	953.47594	953.4759	R	K	6	14
PSM	KPEFVDIINA	175	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6906	26.807	2	1144.6128	1144.6128	L	K	238	248
PSM	KPIPYWLY	176	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7196	28.125	2	1078.5852	1078.5852	G	K	390	398
PSM	KQWGWTQG	177	sp|P18621-2|RL17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5856	23.405	2	989.47191	989.4719	A	R	36	44
PSM	KYGNANVW	178	sp|P67775|PP2AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5573	22.591	2	950.46102	950.4610	R	K	136	144
PSM	PFSNSHNAL	179	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4920	20.442	2	985.46174	985.4617	M	K	2	11
PSM	REFGSVDYWE	180	sp|Q8N6R0-1|EFNMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6724	26.099	2	1286.5568	1286.5568	S	K	9	19
PSM	RFCIWTESAF	181	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=7443	29.229	2	1315.6019	1315.6019	G	R	248	258
PSM	RFGSGMNMG	182	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=4275	18.187	2	987.39024	987.3902	G	R	323	332
PSM	RFGSGMNMG	183	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:35	ms_run[2]:scan=4267	18.165	2	971.39532	971.3953	G	R	323	332
PSM	RFNCGTWMD	184	sp|P35573-2|GDE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=5512	22.411	2	1201.4645	1201.4645	N	K	1236	1245
PSM	RFPGQLNADL	185	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6383	24.946	2	1129.588	1129.5880	L	R	241	251
PSM	RGGGFFSGLGG	186	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6866	26.643	2	1010.4934	1010.4934	G	K	1870	1881
PSM	RGGNFGFGDS	187	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5620	22.721	2	1012.4363	1012.4363	G	R	191	201
PSM	RGYFEYIEEN	188	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6632	25.774	2	1318.583	1318.5830	G	K	236	246
PSM	RIWQNFDSA	189	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6176	24.276	2	1135.5411	1135.5411	G	R	583	592
PSM	RLAQYDNLW	190	sp|Q9NQG6|MID51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6857	26.611	2	1177.588	1177.5880	H	R	329	338
PSM	RLFPYSQYY	191	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6952	27.003	2	1235.5975	1235.5975	R	R	19	28
PSM	RNIEWFSIE	192	sp|Q8IU60-2|DCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7294	28.574	2	1192.5877	1192.5877	I	K	195	204
PSM	RNNFAVGY	193	sp|P45880-2|VDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5556	22.541	2	939.45626	939.4563	T	R	166	174
PSM	RNNGNGLV	194	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4155	17.759	2	842.43586	842.4359	G	K	341	349
PSM	RNNIFEESY	195	sp|Q96PU5-9|NED4L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6149	24.187	2	1170.5306	1170.5306	H	R	483	492
PSM	RNNPEPWN	196	sp|O00483|NDUA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5027	20.825	2	1025.4679	1025.4679	D	K	47	55
PSM	RNNSDWLLA	197	sp|Q9BQG2-2|NUD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6795	26.379	2	1087.5411	1087.5411	K	K	115	124
PSM	RNSQFDFL	198	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6961	27.044	2	1025.493	1025.4930	A	R	236	244
PSM	RNYQFDFL	199	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7255	28.403	2	1101.5243	1101.5243	Q	R	126	134
PSM	RPEYSASQL	200	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5164	21.265	2	1049.5142	1049.5142	F	K	173	182
PSM	RQGYGEGF	201	sp|Q9NR31-2|SAR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5082	20.988	2	912.40898	912.4090	K	R	140	148
PSM	RQINWTVLY	202	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7175	28.023	2	1191.64	1191.6400	P	R	47	56
PSM	RQNALEAEW	203	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6205	24.363	2	1115.536	1115.5360	D	R	2434	2443
PSM	RQSIWTNFSS	204	sp|Q6P1M0|S27A4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6543	25.473	2	1224.5887	1224.5887	L	R	364	374
PSM	RSCFQQNNN	205	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=3585	15.559	2	1166.4887	1166.4887	V	K	3021	3030
PSM	RSGWTSASSWAV	206	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6711	26.05	2	1293.6102	1293.6102	D	R	824	836
PSM	RSQGCNDEY	207	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4	ms_run[2]:scan=3688	16.029	2	1127.4302	1127.4302	L	K	335	344
PSM	RSSGPYGGGGQYFA	208	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8101	31.754	2	1402.6266	1402.6266	G	K	284	298
PSM	RTSIFWNDV	209	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7026	27.342	2	1136.5615	1136.5615	D	K	315	324
PSM	RWASMSEEQ	210	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35	ms_run[2]:scan=3983	17.169	2	1138.4713	1138.4713	K	R	534	543
PSM	RWCLQGAQ	211	sp|Q8N2G8-3|GHDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=5558	22.546	2	1017.4814	1017.4814	L	R	71	79
PSM	RWGGGYEGQNLA	212	sp|P23743|DGKA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5691	22.941	2	1306.6054	1306.6054	L	K	472	484
PSM	RWNPTQNV	213	sp|P49427|UB2R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5369	21.946	2	1013.5043	1013.5043	E	R	113	121
PSM	RWQQTQQN	214	sp|Q6GQQ9-2|OTU7B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3633	15.78	2	1087.5159	1087.5159	W	K	235	243
PSM	RYNYTSEE	215	sp|Q96F07-2|CYFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4237	18.057	2	1060.4462	1060.4462	T	K	439	447
PSM	RYSGSYNDYL	216	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6284	24.609	2	1236.5411	1236.5411	A	R	647	657
PSM	RYYSYGLE	217	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5752	23.12	2	1049.4818	1049.4818	F	K	879	887
PSM	KAMGIMNSFVNDIFE	218	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7922	31.1201672104	2	1747.798200	1746.795694	S	R	58	73
PSM	KAMGIMNSFVNDIFE	219	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7821	30.782254892799997	2	1747.805027	1746.795694	S	R	58	73
PSM	RGGGGNFGPGPGSNF	220	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7292	28.563038522133336	2	1377.624948	1376.622161	S	R	213	228
PSM	KDLFDPIIED	221	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8105	31.764260813866667	2	1204.606785	1203.602320	F	R	86	96
PSM	RFGSGMNMG	222	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3695	16.0632321728	2	987.389300	987.390236	G	R	362	371
PSM	RNQDNLQGWN	223	sp|P30085|KCY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5260	21.604422311466667	2	1243.567788	1243.569397	P	K	96	106
PSM	KEQGVLSFW	224	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7449	29.253	2	1092.5604	1092.5604	P	R	63	72
PSM	KIGGIGTVPVG	225	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5760	23.137	2	996.59678	996.5968	Y	R	255	266
PSM	KLWNLNNY	226	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6697	25.996	2	1063.5451	1063.5451	G	R	1463	1471
PSM	KNWMFSNA	227	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6432	25.114	2	996.44874	996.4487	G	K	177	185
PSM	RAGELTEDEVE	228	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4839	20.145	2	1246.5677	1246.5677	K	R	55	66
PSM	RCDNFTSSW	229	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:4	ms_run[2]:scan=6194	24.33	2	1171.4717	1171.4717	L	R	147	156
PSM	RCVGNYDN	230	sp|P31323|KAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:4	ms_run[2]:scan=3639	15.804	2	996.40833	996.4083	G	R	210	218
PSM	RCYQSEFG	231	sp|P20073-2|ANXA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:4	ms_run[2]:scan=4964	20.601	2	1045.4287	1045.4287	V	R	275	283
PSM	RDWVLNEF	232	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7226	28.262	2	1077.5243	1077.5243	E	K	301	309
PSM	REAFWLGNL	233	sp|Q9BXW9|FACD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7579	29.81	2	1104.5716	1104.5716	C	K	1381	1390
PSM	REWCDAFL	234	sp|O75531|BAF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:4	ms_run[2]:scan=7109	27.722	2	1095.4808	1095.4808	L	-	82	90
PSM	RFCPFAE	235	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:4	ms_run[2]:scan=6075	23.986	2	925.41162	925.4116	M	R	30	37
PSM	RFGNAFLN	236	sp|Q9H223|EHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6235	24.455	2	937.477	937.4770	S	R	130	138
PSM	RFNENAAD	237	sp|Q96GY0|ZC21A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3750	16.27	2	935.40971	935.4097	R	R	128	136
PSM	RFNNYVDCM	238	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=5170	21.288	2	1233.4907	1233.4907	P	K	1735	1744
PSM	RFPPYYM	239	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	7-UNIMOD:35	ms_run[2]:scan=5693	22.947	2	988.44767	988.4477	R	R	192	199
PSM	RFSNISAA	240	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4807	20.036	2	864.44537	864.4454	I	K	34	42
PSM	RFSNSSSSNEFS	241	sp|Q5D862|FILA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4697	19.632	2	1347.5691	1347.5691	G	K	403	415
PSM	RGGNFGFGDS	242	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5843	23.37	2	1012.4363	1012.4363	G	R	191	201
PSM	RGIYAYGFE	243	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6443	25.145	2	1074.5134	1074.5134	L	K	45	54
PSM	RGPSWDPF	244	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7027	27.344	2	960.44537	960.4454	L	R	12	20
PSM	RGVSAFSTWE	245	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6493	25.299	2	1138.5407	1138.5407	E	K	652	662
PSM	RGWDDLFN	246	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7249	28.372	2	1021.4617	1021.4617	I	K	1488	1496
PSM	RGYISPYFINTS	247	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6821	26.481	2	1416.7038	1416.7038	D	K	221	233
PSM	RIIPGFMCQGGDFT	248	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7752	30.539	2	1613.733	1613.7330	H	R	55	69
PSM	RIIPGFMCQGGDFT	249	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7849	30.884	2	1613.733	1613.7330	H	R	55	69
PSM	RIWQYVYS	250	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6488	25.291	2	1113.5607	1113.5607	E	K	88	96
PSM	RLNVWDLS	251	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6918	26.859	2	1001.5294	1001.5294	R	K	306	314
PSM	RLPLQDVY	252	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6466	25.224	2	1002.5498	1002.5498	L	K	247	255
PSM	RNGYGFIN	253	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5707	22.999	2	939.45626	939.4563	V	R	69	77
PSM	RNTNPNFV	254	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4871	20.27	2	960.47773	960.4777	L	R	526	534
PSM	RNWGGPDFE	255	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5972	23.711	2	1076.4676	1076.4676	G	R	221	230
PSM	RNYAQVFN	256	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5504	22.385	2	1010.4934	1010.4934	I	K	109	117
PSM	RPQNVTSW	257	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5353	21.883	2	986.49338	986.4934	L	R	202	210
PSM	RQGWLAALQD	258	sp|Q8IXM6-2|NRM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6972	27.092	2	1156.5989	1156.5989	A	R	47	57
PSM	RQSFESYL	259	sp|Q9UL03-3|INT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6513	25.362	2	1028.4927	1028.4927	W	K	396	404
PSM	RQSSGASSSSFSSS	260	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3680	15.997	2	1360.5855	1360.5855	Y	R	587	601
PSM	RQWELLLE	261	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7259	28.421	2	1085.5869	1085.5869	H	K	129	137
PSM	RSLASYGL	262	sp|Q5TDH0-2|DDI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6168	24.254	2	865.46577	865.4658	H	K	59	67
PSM	RSVSSSSY	263	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3787	16.424	2	871.40356	871.4036	T	R	4	12
PSM	RTSIWDETLY	264	sp|Q7L523|RRAGA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7085	27.609	2	1282.6194	1282.6194	F	K	161	171
PSM	RTTPSYVAFTDTE	265	sp|P0DMV8-2|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=8079	31.671	2	1486.694	1486.6940	N	R	36	49
PSM	RWGAGSIC	266	sp|Q9BTY2|FUCO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:4	ms_run[2]:scan=5380	21.979	2	905.41777	905.4178	D	K	262	270
PSM	RWGQASSD	267	sp|Q96MX3|ZNF48_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4034	17.335	2	905.39914	905.3991	P	R	102	110
PSM	RWIYEDVE	268	sp|O43852-13|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6476	25.261	2	1108.5189	1108.5189	K	R	103	111
PSM	RWMAQYID	269	sp|Q9Y6B6|SAR1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:35	ms_run[2]:scan=5747	23.11	2	1097.4964	1097.4964	F	-	191	199
PSM	RWMAQYID	270	sp|Q9Y6B6|SAR1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6425	25.093	2	1081.5015	1081.5015	F	-	191	199
PSM	RWQNAVQGV	271	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5560	22.555	2	1056.5465	1056.5465	D	R	5680	5689
PSM	RWYDLMDN	272	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:35	ms_run[2]:scan=6166	24.249	2	1127.4706	1127.4706	A	K	1091	1099
PSM	RYDNGSGY	273	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=3999	17.237	2	930.38316	930.3832	A	R	1166	1174
PSM	RYDVYLYD	274	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6323	24.746	2	1105.508	1105.5080	G	R	318	326
PSM	RYMWGTDTY	275	sp|Q14139|UBE4A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:35	ms_run[2]:scan=5984	23.744	2	1207.4968	1207.4968	L	R	753	762
PSM	RYSSQYEE	276	sp|P39880-9|CUX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4011	17.271	2	1060.4462	1060.4462	L	R	524	532
PSM	RQQYESVAA	277	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=4233	18.042300248533333	2	1050.511016	1050.509423	V	K	273	282
PSM	KPEFVDIINA	278	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6901	26.787346127466666	2	1144.613452	1144.612825	L	K	238	248
PSM	RDNWSSSDG	279	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=3974	17.1415270392	2	1022.406172	1022.405351	Q	K	1080	1089
PSM	RSFMNNWEVY	280	sp|P08237|PFKAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:35	ms_run[1]:scan=6564	25.547027374933336	2	1361.589242	1360.587021	G	K	376	386
PSM	RGDVTAEEAAGASPA	281	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=4396	18.581877910933333	2	1400.642051	1400.653186	P	K	10	25
PSM	RYYGYTGAF	282	sp|P02788|TRFL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6245	24.4889365416	2	1096.498077	1096.497795	E	R	543	552
PSM	KAGFAGDDAP	283	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4547	19.118	2	947.43486	947.4349	C	R	18	28
PSM	KAMGIMNSFVNDIFE	284	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8046	31.552	2	1746.7957	1746.7957	S	R	58	73
PSM	KEITALAPSTM	285	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	11-UNIMOD:35	ms_run[2]:scan=7284	28.529	2	1176.606	1176.6060	Q	K	315	326
PSM	KGTIQVITQGTSL	286	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6272	24.57	2	1344.7613	1344.7613	P	K	351	364
PSM	KWQNSYSI	287	sp|Q13404-6|UB2V1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5883	23.477	2	1024.4978	1024.4978	A	K	66	74
PSM	KYGNANAW	288	sp|O00743-2|PPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5141	21.199	2	922.42972	922.4297	T	R	110	118
PSM	RASLWAQEA	289	sp|Q9BV73-2|CP250_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5791	23.227	2	1030.5196	1030.5196	L	K	1083	1092
PSM	RCSYCNFN	290	sp|Q9HA92|RSAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4777	19.924	2	1119.4226	1119.4226	K	K	52	60
PSM	RDYYYDTF	291	sp|Q06481-4|APLP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6438	25.129	2	1141.4716	1141.4716	D	K	271	279
PSM	REWCDAFL	292	sp|O75531|BAF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=7197	28.13	2	1095.4808	1095.4808	L	-	82	90
PSM	RFCQCEQ	293	sp|Q96DU7|IP3KC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=3692	16.047	2	1026.4011	1026.4011	K	R	432	439
PSM	RFGITGYG	294	sp|Q8NDD1-6|CA131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5945	23.631	2	869.43955	869.4396	H	K	176	184
PSM	RFLNAENAQ	295	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4856	20.205	2	1061.5254	1061.5254	I	K	141	150
PSM	RFSAASNL	296	sp|Q7L3S4|ZN771_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5213	21.442	2	864.44537	864.4454	K	R	127	135
PSM	RFTEYSSLY	297	sp|P36508-2|ZNF76_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6294	24.644	2	1164.5451	1164.5451	K	K	325	334
PSM	RFWGSVGPA	298	sp|Q8N2G8-3|GHDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6305	24.683	2	975.49265	975.4926	L	R	435	444
PSM	RGFSGYNT	299	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4733	19.766	2	900.40898	900.4090	N	R	52	60
PSM	RGGAGNISL	300	sp|Q14181|DPOA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5246	21.551	2	843.45626	843.4563	G	K	185	194
PSM	RGGGGGAWELGSDA	301	sp|Q8NEL9-2|DDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5917	23.58	2	1288.5796	1288.5796	G	R	17	31
PSM	RGGNFGFGDS	302	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6320	24.737	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGPGGGF	303	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4338	18.384	2	703.34017	703.3402	S	R	16	24
PSM	RGPIAFWA	304	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7100	27.681	2	916.49192	916.4919	S	R	201	209
PSM	RGSNGAFY	305	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4965	20.604	2	870.39842	870.3984	V	K	19	27
PSM	RGWGTQDS	306	sp|Q9UPQ9-2|TNR6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4260	18.132	2	905.39914	905.3991	V	R	819	827
PSM	RGYSFTTTAE	307	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7201	28.152	2	1131.5197	1131.5197	E	R	196	206
PSM	RISYGPDW	308	sp|P06865|HEXA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6300	24.669	2	992.47158	992.4716	N	K	424	432
PSM	RLNPNLYDNG	309	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5284	21.677	2	1174.5731	1174.5731	G	K	1028	1038
PSM	RLNQYFQ	310	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5685	22.929	2	967.48756	967.4876	A	K	184	191
PSM	RLQSWLYSS	311	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6565	25.549	2	1138.5771	1138.5771	Y	R	130	139
PSM	RLQWFCD	312	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	6-UNIMOD:4	ms_run[2]:scan=6808	26.43	2	1023.4596	1023.4596	A	R	922	929
PSM	RLWNPQE	313	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5459	22.239	2	941.47191	941.4719	V	K	527	534
PSM	RMCWQYNP	314	sp|P08069|IGF1R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=5541	22.497	2	1169.4746	1169.4746	M	K	1246	1254
PSM	RNCFASVFE	315	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	3-UNIMOD:4	ms_run[2]:scan=6619	25.736	2	1128.5022	1128.5022	K	K	118	127
PSM	RNGQYAEASALYG	316	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5565	22.572	2	1398.6528	1398.6528	F	R	21	34
PSM	RNNCLADS	317	sp|Q07866-7|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=3609	15.674	2	948.40833	948.4083	E	R	565	573
PSM	RNNFAAEME	318	sp|Q7L7X3-2|TAOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5312	21.749	2	1080.4658	1080.4658	Q	K	330	339
PSM	RNPENWAYY	319	sp|Q9BXJ9-4|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6249	24.5	2	1211.536	1211.5360	E	K	253	262
PSM	RNPQNSSQSADGL	320	sp|Q01081|U2AF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4169	17.808	2	1372.6331	1372.6331	Y	R	53	66
PSM	RNQGNLYD	321	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4157	17.764	2	978.45191	978.4519	K	K	505	513
PSM	RNSCNQCNEP	322	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3440	14.942	2	1277.4877	1277.4877	R	R	370	380
PSM	RNYDYYAS	323	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4891	20.341	2	1050.4407	1050.4407	L	R	234	242
PSM	RNYYEQWG	324	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5930	23.608	2	1114.4832	1114.4832	L	K	26	34
PSM	RPIPQWI	325	sp|Q59GN2|R39L5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6765	26.264	2	908.52322	908.5232	N	R	21	28
PSM	RPQNSTTW	326	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4664	19.508	2	988.47264	988.4726	L	R	200	208
PSM	RPTYTNLN	327	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4486	18.888	2	977.49304	977.4930	E	R	186	194
PSM	RPWNTQNT	328	sp|Q5SRI9|MANEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4254	18.108	2	1015.4835	1015.4835	I	R	366	374
PSM	RPWNTQNT	329	sp|Q5SRI9|MANEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4262	18.142	2	1015.4835	1015.4835	I	R	366	374
PSM	RPWQSSET	330	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4193	17.9	2	989.45666	989.4567	L	R	263	271
PSM	RQAASSLQQASL	331	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5189	21.37	2	1258.663	1258.6630	I	K	634	646
PSM	RQFWFQGN	332	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6736	26.155	2	1081.5094	1081.5094	L	R	380	388
PSM	RQITVNDLPVG	333	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6177	24.281	2	1210.667	1210.6670	L	R	139	150
PSM	RSENGETW	334	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4666	19.513	2	977.42027	977.4203	L	K	215	223
PSM	RSSGPYGGGGQYFA	335	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=8213	32.148	2	1402.6266	1402.6266	G	K	284	298
PSM	RSSQTGDWTWL	336	sp|Q3B7T1-4|EDRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7307	28.633	2	1335.6208	1335.6208	M	K	167	178
PSM	RSWSEESL	337	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5718	23.038	2	992.45632	992.4563	N	K	1216	1224
PSM	RTSIFWNDV	338	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7021	27.325	2	1136.5615	1136.5615	D	K	315	324
PSM	RWEEFYQG	339	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6283	24.605	2	1113.488	1113.4880	S	K	1866	1874
PSM	RWQPSASE	340	sp|Q8NFI3|ENASE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4512	18.979	2	959.44609	959.4461	I	R	628	636
PSM	RWVCSSL	341	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=5830	23.345	2	906.43817	906.4382	I	R	1545	1552
PSM	RWWAASPAPA	342	sp|Q8NC56|LEMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6253	24.512	2	1111.5563	1111.5563	R	R	161	171
PSM	RYANNSNY	343	sp|P61326-2|MGN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3873	16.776	2	1000.4363	1000.4363	L	K	33	41
PSM	RYCPYQNI	344	sp|Q4J6C6-4|PPCEL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	3-UNIMOD:4	ms_run[2]:scan=5446	22.197	2	1112.5073	1112.5073	K	K	533	541
PSM	RYFGGTED	345	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4656	19.483	2	943.40356	943.4036	R	R	110	118
PSM	RYLGSYSG	346	sp|Q969P0-3|IGSF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4803	20.021	2	901.42938	901.4294	T	K	135	143
PSM	RYLSNAYA	347	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5037	20.854	2	956.47158	956.4716	H	R	208	216
PSM	RYNFFTGCP	348	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	8-UNIMOD:4	ms_run[2]:scan=6609	25.699	2	1160.5073	1160.5073	E	K	153	162
PSM	RYQQWME	349	sp|Q9BQ52-2|RNZ2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	6-UNIMOD:35	ms_run[2]:scan=4953	20.569	2	1055.4495	1055.4495	S	R	259	266
PSM	RYYSSENT	350	sp|Q96SB8|SMC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3785	16.415	2	1018.4356	1018.4356	G	R	648	656
PSM	RDYFEQYG	351	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5972	23.711293864	2	1076.465396	1076.456324	L	K	122	130
PSM	RSSGPYGGGGQYFA	352	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7906	31.0714175712	2	1402.631011	1402.626578	G	K	284	298
PSM	RSSGPYGGGGQYFA	353	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7714	30.3935074496	2	1402.629726	1402.626578	G	K	284	298
PSM	RGNWDEQFD	354	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5803	23.258528156533334	2	1165.479256	1165.478851	F	K	170	179
PSM	RVLVWDL	355	sp|O43684|BUB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7302	28.609640220533333	2	899.522689	899.522888	R	R	158	165
PSM	REAGDVCYADVY	356	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	7-UNIMOD:4	ms_run[1]:scan=5870	23.446083217333335	2	1416.5899	1416.5975	M	R	142	154
PSM	RAQSADTSW	357	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4796	19.9984018248	2	1021.462067	1020.462472	L	R	44	53
PSM	RNFNQEGT	358	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=3727	16.180252396	2	964.436790	964.436258	L	K	784	792
PSM	RYEEDMYW	359	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	6-UNIMOD:35	ms_run[1]:scan=6162	24.230686102133333	2	1206.464964	1206.465175	R	R	661	669
PSM	KFWAYEQY	360	sp|Q6NUK1|SCMC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6661	25.873348050133334	2	1134.525754	1133.518196	V	K	268	276
PSM	KDQIYDIFQ	361	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7115	27.75	2	1168.5764	1168.5764	F	K	193	202
PSM	KEDPDWW	362	sp|Q15811-12|ITSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6767	26.272	2	974.4134	974.4134	N	K	1074	1081
PSM	KEDQTEYLEE	363	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5086	21	2	1282.5565	1282.5565	L	R	191	201
PSM	KFEDENFIL	364	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7128	27.81	2	1153.5655	1153.5655	E	K	82	91
PSM	KFEDENFIL	365	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7133	27.83	2	1153.5655	1153.5655	E	K	82	91
PSM	KLLQDFFNG	366	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7161	27.957	2	1080.5604	1080.5604	Q	R	293	302
PSM	KMIWWAN	367	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:35	ms_run[2]:scan=6503	25.327	2	963.46366	963.4637	E	K	2572	2579
PSM	KMIWWAN	368	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7101	27.683	2	947.46874	947.4687	E	K	2572	2579
PSM	KQYWCTF	369	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	5-UNIMOD:4	ms_run[2]:scan=6578	25.588	2	1031.4535	1031.4535	Y	K	393	400
PSM	KSSWFGL	370	sp|Q9BXF6|RFIP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7170	28	2	823.42284	823.4228	A	R	506	513
PSM	KVSQWWE	371	sp|Q9P035|HACD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6441	25.141	2	961.46577	961.4658	K	R	85	92
PSM	KWYENFQ	372	sp|Q53FT3|HIKES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6071	23.98	2	1013.4607	1013.4607	L	R	179	186
PSM	RAFGSGY	373	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4810	20.043	2	756.35549	756.3555	R	R	240	247
PSM	RAIQEWL	374	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6659	25.868	2	914.4974	914.4974	A	K	413	420
PSM	RASWTLV	375	sp|Q9H6U6-6|BCAS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6490	25.293	2	831.46029	831.4603	P	R	407	414
PSM	RCAAAESWA	376	sp|Q86XA9-2|HTR5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:4	ms_run[2]:scan=5078	20.973	2	1020.4447	1020.4447	L	R	867	876
PSM	RCQTCGY	377	sp|P10398-2|ARAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=3769	16.346	2	943.36402	943.3640	F	K	124	131
PSM	RELNWDDY	378	sp|P43304-2|GPDM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6396	24.992	2	1109.4778	1109.4778	G	K	453	461
PSM	RESWISDI	379	sp|P57737-2|CORO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6852	26.598	2	1004.4927	1004.4927	R	R	19	27
PSM	REVWTYM	380	sp|Q8IWR0|Z3H7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	7-UNIMOD:35	ms_run[2]:scan=5802	23.255	2	999.4484	999.4484	E	K	799	806
PSM	REWDFDL	381	sp|Q96EY4|TMA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7219	28.229	2	979.43995	979.4399	F	K	144	151
PSM	REWEMQF	382	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6902	26.793	2	1024.4437	1024.4437	V	K	184	191
PSM	RFGAGTL	383	sp|Q5HYI8|RABL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5392	22.018	2	720.39187	720.3919	K	K	224	231
PSM	RFIVYSY	384	sp|P60983|GMFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6444	25.147	2	946.49125	946.4913	P	K	67	74
PSM	RFNFIYN	385	sp|O43809|CPSF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6608	25.696	2	972.48175	972.4818	S	-	221	228
PSM	RFNPGEL	386	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5741	23.102	2	831.4239	831.4239	E	R	13	20
PSM	RFQWDMA	387	sp|P21283|VATC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	6-UNIMOD:35	ms_run[2]:scan=6037	23.88	2	968.41744	968.4174	T	K	104	111
PSM	RFSAGQWEA	388	sp|Q9Y4W2-3|LAS1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5886	23.482	2	1050.4883	1050.4883	R	R	380	389
PSM	RFWCPECG	389	sp|Q8NAF0|ZN579_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5922	23.589	2	1110.4375	1110.4375	P	K	383	391
PSM	RFWETLD	390	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6584	25.602	2	965.46068	965.4607	L	R	513	520
PSM	RFWETLD	391	sp|Q6P1J9|CDC73_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6598	25.647	2	965.46068	965.4607	L	R	513	520
PSM	RFYSGFNS	392	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5613	22.699	2	976.44028	976.4403	S	R	279	287
PSM	RGFLSDL	393	sp|Q9GZT8-2|NIF3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6937	26.942	2	806.42865	806.4287	E	R	317	324
PSM	RGGGGNFGPGPGSNF	394	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7765	30.586	2	1376.6222	1376.6222	S	R	201	216
PSM	RGGGGNFGPGPGSNF	395	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7869	30.95	2	1376.6222	1376.6222	S	R	201	216
PSM	RGGLGLSGA	396	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4973	20.637	2	786.4348	786.4348	M	K	241	250
PSM	RGGNFGFGDS	397	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5304	21.721	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	398	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6043	23.899	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	399	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6186	24.304	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	400	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6594	25.633	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	401	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6714	26.063	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	402	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6943	26.965	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	403	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7039	27.394	2	1012.4363	1012.4363	G	R	191	201
PSM	RGIPDEW	404	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6128	24.133	2	871.41882	871.4188	P	R	138	145
PSM	RGPLGPNW	405	sp|Q00169|PIPNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6157	24.219	2	895.46644	895.4664	G	K	170	178
PSM	RGPPPSWG	406	sp|P84103-2|SRSF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4853	20.195	2	852.42424	852.4242	N	R	90	98
PSM	RGVVDSEDLPLNIS	407	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7846	30.874	2	1512.7784	1512.7784	I	R	386	400
PSM	RGWVTFD	408	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6602	25.671	2	879.4239	879.4239	R	R	427	434
PSM	RGYSFTTTAE	409	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7274	28.489	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSFTTTAE	410	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7297	28.59	2	1131.5197	1131.5197	E	R	196	206
PSM	RIIPGFMCQGGDFT	411	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8059	31.601	2	1613.733	1613.7330	H	R	55	69
PSM	RISGLIYEET	412	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6165	24.243	2	1179.6136	1179.6136	K	R	46	56
PSM	RIWASEDG	413	sp|Q9H1Z4-2|WDR13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4969	20.622	2	932.43519	932.4352	M	R	150	158
PSM	RLCQENQWL	414	sp|Q07866-7|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:4	ms_run[2]:scan=6349	24.828	2	1245.5924	1245.5924	R	R	112	121
PSM	RLGVAGQW	415	sp|P09936|UCHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6061	23.961	2	885.48209	885.4821	S	R	19	27
PSM	RLNNDPGW	416	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5373	21.955	2	970.46208	970.4621	D	K	105	113
PSM	RLQGSDLFW	417	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7236	28.311	2	1120.5665	1120.5665	E	R	1054	1063
PSM	RLSPNAW	418	sp|Q16698-2|DECR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5688	22.936	2	842.43989	842.4399	E	K	146	153
PSM	RLSYYGL	419	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6412	25.048	2	870.45995	870.4600	L	R	1042	1049
PSM	RLWDSGQ	420	sp|Q96RE7|NACC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5162	21.259	2	860.41407	860.4141	K	K	184	191
PSM	RMLQAMGW	421	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=5530	22.469	2	1023.463	1023.4630	S	K	786	794
PSM	RNAAYFLSNL	422	sp|Q71F23-2|CENPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7181	28.055	2	1167.6037	1167.6037	L	K	110	120
PSM	RNFNLEN	423	sp|Q9P032|NDUF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4939	20.529	2	905.43553	905.4355	I	R	10	17
PSM	RNNPFQF	424	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6500	25.317	2	921.4457	921.4457	K	R	299	306
PSM	RNSNANGYV	425	sp|Q9C0C4|SEM4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4069	17.469	2	993.46281	993.4628	G	R	782	791
PSM	RNWQPTL	426	sp|Q9Y4B4|ARIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6010	23.819	2	913.477	913.4770	Q	K	1007	1014
PSM	RNWSQCVELA	427	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	6-UNIMOD:4	ms_run[2]:scan=6150	24.19	2	1261.5874	1261.5874	P	R	220	230
PSM	RNWVLQQ	428	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5799	23.248	2	942.50355	942.5035	T	K	3428	3435
PSM	RNYSSDLG	429	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4320	18.33	2	910.41446	910.4145	L	K	304	312
PSM	RPNGGNFG	430	sp|Q86WP2-3|GPBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3860	16.716	2	817.3831	817.3831	G	R	66	74
PSM	RPQNYLFGCEL	431	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	9-UNIMOD:4	ms_run[2]:scan=7745	30.512	2	1395.6605	1395.6605	L	K	13	24
PSM	RPQNYLFGCEL	432	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	9-UNIMOD:4	ms_run[2]:scan=7862	30.926	2	1395.6605	1395.6605	L	K	13	24
PSM	RQCYSMY	433	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=4348	18.417	2	1022.395	1022.3950	L	K	139	146
PSM	RQEWENN	434	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4100	17.574	2	974.42061	974.4206	L	R	116	123
PSM	RQQQSQTAY	435	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3659	15.901	2	1108.5261	1108.5261	Y	-	895	904
PSM	RQVCWGA	436	sp|Q5JTJ3-3|COA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	4-UNIMOD:4	ms_run[2]:scan=5107	21.08	2	875.40721	875.4072	E	R	9	16
PSM	RQYLYCL	437	sp|A5PLN9-7|TPC13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	6-UNIMOD:4	ms_run[2]:scan=6512	25.358	2	1014.4957	1014.4957	T	K	243	250
PSM	RSCEESW	438	sp|O43896|KIF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:4	ms_run[2]:scan=4832	20.119	2	952.37088	952.3709	K	R	683	690
PSM	RSGQGAFGNMC	439	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	10-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=4091	17.541	2	1199.4812	1199.4812	H	R	86	97
PSM	RSNPFYD	440	sp|O75586-3|MED6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5403	22.048	2	897.39808	897.3981	E	R	36	43
PSM	RSQWLNE	441	sp|Q03013-3|GSTM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5400	22.041	2	931.45118	931.4512	D	K	43	50
PSM	RSSGAWGVN	442	sp|O43683-2|BUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4914	20.425	2	932.44643	932.4464	V	K	509	518
PSM	RSSGGGGWADP	443	sp|Q70UQ0-3|IKIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4943	20.538	2	1045.4577	1045.4577	A	R	33	44
PSM	RSSGPYGGGGQYFA	444	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7350	28.836	2	1402.6266	1402.6266	G	K	284	298
PSM	RSSGPYGGGGQYFA	445	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7440	29.216	2	1402.6266	1402.6266	G	K	284	298
PSM	RSSGPYGGGGQYFA	446	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7523	29.57	2	1402.6266	1402.6266	G	K	284	298
PSM	RSSGPYGGGGQYFA	447	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7807	30.735	2	1402.6266	1402.6266	G	K	284	298
PSM	RSSGPYGGGGQYFA	448	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=8005	31.41	2	1402.6266	1402.6266	G	K	284	298
PSM	RSVPTWL	449	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6586	25.606	2	857.47594	857.4759	R	K	20	27
PSM	RSWLNSDSL	450	sp|Q68CQ7-2|GL8D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6544	25.474	2	1076.5251	1076.5251	L	K	110	119
PSM	RSWLSDIS	451	sp|Q8N543|OGFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6773	26.297	2	962.48214	962.4821	F	K	124	132
PSM	RTSGGEGIW	452	sp|Q03468|ERCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5704	22.99	2	961.46174	961.4617	H	K	1478	1487
PSM	RTYGGSYGG	453	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3977	17.152	2	916.40389	916.4039	T	R	423	432
PSM	RVNLWSIN	454	sp|Q9BVA0|KTNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6753	26.221	2	1000.5454	1000.5454	C	K	44	52
PSM	RVQYWIENY	455	sp|Q9NXC5|MIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6903	26.798	2	1269.6142	1269.6142	E	R	692	701
PSM	RWAQSEC	456	sp|Q9Y2V7-2|COG6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	7-UNIMOD:4	ms_run[2]:scan=4026	17.31	2	935.39195	935.3920	Y	R	228	235
PSM	RWFVTCV	457	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	6-UNIMOD:4	ms_run[2]:scan=6874	26.674	2	966.47456	966.4746	T	R	189	196
PSM	RWIADGQ	458	sp|Q7Z4G4-3|TRM11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4987	20.676	2	844.41915	844.4192	G	R	173	180
PSM	RWIVNLI	459	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7500	29.473	2	912.55452	912.5545	E	R	369	376
PSM	RWLIGGG	460	sp|Q9HAD4-2|WDR41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6410	25.043	2	757.42351	757.4235	L	R	3	10
PSM	RWTETYV	461	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5797	23.245	2	953.46068	953.4607	A	R	334	341
PSM	RWVNDPQ	462	sp|Q9H4A5-2|GLP3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4658	19.488	2	913.44061	913.4406	E	R	166	173
PSM	RWVTYFN	463	sp|P20674|COX5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6630	25.766	2	984.48175	984.4818	A	K	55	62
PSM	RYCANAF	464	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:4	ms_run[2]:scan=5061	20.931	2	900.39122	900.3912	H	K	86	93
PSM	RYEDYDY	465	sp|Q13595-4|TRA2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5125	21.149	2	1022.3981	1022.3981	D	R	147	154
PSM	RYFACLM	466	sp|Q9Y6M9|NDUB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	5-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=5934	23.614	2	975.43064	975.4306	Y	R	38	45
PSM	RYFSPNF	467	sp|P60484|PTEN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6326	24.751	2	929.43955	929.4396	N	K	335	342
PSM	RYGNPSEN	468	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3460	15.026	2	935.40971	935.4097	L	R	24	32
PSM	RYISSSY	469	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4788	19.968	2	874.41848	874.4185	G	K	757	764
PSM	RYMWGTDTY	470	sp|Q14139|UBE4A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6428	25.101	2	1191.5019	1191.5019	L	R	753	762
PSM	RYNPEQT	471	sp|Q9NUQ2|PLCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=3641	15.815	2	906.41954	906.4195	T	K	176	183
PSM	RYQDWGATNA	472	sp|P07320|CRGD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5196	21.384	2	1180.5261	1180.5261	R	R	153	163
PSM	RYYFEGI	473	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6774	26.3	2	946.45487	946.4549	Q	K	321	328
PSM	RYYNQVG	474	sp|P22830|HEMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4269	18.169	2	898.42972	898.4297	Y	R	208	215
PSM	RYYTVFD	475	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6256	24.521	2	962.44978	962.4498	G	R	392	399
PSM	RGGNFGFGDS	476	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7457	29.288785706666665	2	1012.436400	1012.436258	G	R	203	213
PSM	KDLFDPIIED	477	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7859	30.91658745013333	2	1204.608969	1203.602320	F	R	86	96
PSM	RYVWLVYEQD	478	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7273	28.483770261333333	2	1370.671296	1369.666652	H	R	119	129
PSM	RFYTDSNG	479	sp|O00754|MA2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=4265	18.1581806704	2	958.415545	958.414459	G	R	742	750
PSM	REGALSMA	480	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:35	ms_run[1]:scan=4476	18.85631147253333	2	849.398361	849.401452	T	R	355	363
PSM	RYLSNAYA	481	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=5022	20.8056276952	2	956.471803	956.471580	H	R	208	216
PSM	RGGNFGFGDS	482	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=5873	23.4548019952	2	1013.419889	1012.436258	G	R	203	213
PSM	KYIDQEELN	483	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7881	30.992688942133334	2	1150.552350	1150.550619	E	K	197	206
PSM	KAFGNEW	484	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5821	23.313	2	850.39735	850.3974	R	K	387	394
PSM	KAWEDYY	485	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6193	24.326	2	973.41815	973.4181	S	K	518	525
PSM	KAWEEYY	486	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6050	23.924	2	987.4338	987.4338	T	K	584	591
PSM	KCYYFDY	487	sp|P48556|PSMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	2-UNIMOD:4	ms_run[2]:scan=6393	24.98	2	1057.4215	1057.4215	L	K	172	179
PSM	KDLFDPIIED	488	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7655	30.129	2	1203.6023	1203.6023	F	R	86	96
PSM	KDVIEEYF	489	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7164	27.97	2	1041.5019	1041.5019	A	K	121	129
PSM	KGWNWGTV	490	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6806	26.425	2	946.4661	946.4661	V	K	105	113
PSM	KIPDWFLN	491	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7396	29.03	2	1031.544	1031.5440	Y	R	78	86
PSM	KISWEEY	492	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6203	24.359	2	953.44945	953.4494	D	K	83	90
PSM	KLNWMNL	493	sp|O43924|PDE6D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	5-UNIMOD:35	ms_run[2]:scan=6628	25.76	2	933.47422	933.4742	F	R	16	23
PSM	KNFGIWL	494	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7379	28.956	2	876.48577	876.4858	V	R	76	83
PSM	KNFYFNY	495	sp|O75376-3|NCOR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6625	25.747	2	994.45487	994.4549	C	K	554	561
PSM	KNIEDVIAQGIG	496	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7061	27.498	2	1255.6772	1255.6772	G	K	49	61
PSM	KNVNWEY	497	sp|Q96BP3-2|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5676	22.913	2	951.44503	951.4450	P	K	105	112
PSM	KNWGSLL	498	sp|Q8WYQ5-3|DGCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6703	26.021	2	816.44939	816.4494	V	R	656	663
PSM	KQYWANL	499	sp|Q96BN2|TADA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6388	24.966	2	921.47085	921.4709	V	K	24	31
PSM	KWGINTY	500	sp|P53365-3|ARFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6023	23.85	2	880.4443	880.4443	K	K	60	67
PSM	KYLDWAY	501	sp|Q9NYH9|UTP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6854	26.6	2	957.45962	957.4596	N	R	479	486
PSM	KYNDTFW	502	sp|Q58FF3|ENPLL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6652	25.858	2	972.43413	972.4341	E	K	136	143
PSM	KYYGSYL	503	sp|Q9P289-3|STK26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5885	23.481	2	892.43307	892.4331	T	K	84	91
PSM	PEPAKSAPAP	504	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3710	16.119	2	963.50255	963.5025	M	K	2	12
PSM	RAALQELLS	505	sp|P62851|RS25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6604	25.68	2	999.57129	999.5713	A	K	85	94
PSM	RADAWLL	506	sp|Q9NX00|TM160_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7029	27.351	2	843.46029	843.4603	D	R	57	64
PSM	RAGLQFPVG	507	sp|Q71UI9-5|H2AV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6347	24.824	2	943.52395	943.5240	Q	R	23	32
PSM	RANEYDF	508	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5468	22.262	2	913.393	913.3930	R	K	1042	1049
PSM	RANMDGL	509	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	4-UNIMOD:35	ms_run[2]:scan=3957	17.087	2	791.35959	791.3596	L	K	88	95
PSM	RAQGWQGL	510	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5905	23.536	2	914.47225	914.4722	R	K	313	321
PSM	RAWAGSP	511	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4496	18.922	2	743.37147	743.3715	M	K	344	351
PSM	RAWYPLG	512	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6463	25.217	2	861.44972	861.4497	E	R	129	136
PSM	RCTANDL	513	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	2-UNIMOD:4	ms_run[2]:scan=3960	17.096	2	848.38105	848.3811	S	K	316	323
PSM	RDGAWGAF	514	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6520	25.393	2	878.4035	878.4035	Y	R	1507	1515
PSM	RDSEGTW	515	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4657	19.486	2	849.3617	849.3617	D	R	859	866
PSM	RDWASAI	516	sp|Q6ZRP7|QSOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6217	24.393	2	817.40825	817.4083	V	R	109	116
PSM	REAGLSW	517	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5993	23.77	2	817.40825	817.4083	W	K	1201	1208
PSM	REENLFSW	518	sp|P38432|COIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7276	28.496	2	1079.5036	1079.5036	G	K	397	405
PSM	REGSPANW	519	sp|O96019-2|ACL6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4985	20.671	2	915.41988	915.4199	V	K	188	196
PSM	REIAQDF	520	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5500	22.378	2	877.42938	877.4294	V	K	73	80
PSM	REIAQDF	521	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7129	27.816	2	877.42938	877.4294	V	K	73	80
PSM	REIAQDF	522	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7233	28.299	2	877.42938	877.4294	V	K	73	80
PSM	REIAQDF	523	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7314	28.668	2	877.42938	877.4294	V	K	73	80
PSM	RENFQNWL	524	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6973	27.094	2	1105.5305	1105.5305	G	K	49	57
PSM	RENSIWDE	525	sp|P16885|PLCG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5788	23.216	2	1047.4621	1047.4621	S	K	297	305
PSM	REVYTEW	526	sp|Q96MN5-2|TEAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6082	23.999	2	981.4556	981.4556	A	K	14	21
PSM	RFANYID	527	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5648	22.806	2	897.43447	897.4345	D	K	113	120
PSM	RFAYDGL	528	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6234	24.453	2	840.413	840.4130	T	K	180	187
PSM	RFCQQYN	529	sp|Q53R41|FAKD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	3-UNIMOD:4	ms_run[2]:scan=4184	17.875	2	1014.4341	1014.4341	D	K	684	691
PSM	RFDAYCF	530	sp|O14594|NCAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	6-UNIMOD:4	ms_run[2]:scan=6558	25.521	2	977.40654	977.4065	E	R	350	357
PSM	RFDQFWAIN	531	sp|Q9H1Y0-2|ATG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7334	28.761	2	1195.5774	1195.5774	D	R	83	92
PSM	RFFSEYE	532	sp|Q9Y376|CAB39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6028	23.859	2	976.42905	976.4290	D	K	209	216
PSM	RFGSNNTSGS	533	sp|Q9Y2U9|KLDC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3530	15.298	2	1025.4526	1025.4526	Q	-	397	407
PSM	RFGSSLF	534	sp|Q5W0B1|OBI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6656	25.863	2	812.41809	812.4181	Q	K	667	674
PSM	RFNALFV	535	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6970	27.088	2	865.48102	865.4810	S	R	587	594
PSM	RFNCGTWMD	536	sp|P35573-2|GDE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	4-UNIMOD:4	ms_run[2]:scan=6133	24.152	2	1185.4695	1185.4695	N	K	1236	1245
PSM	RFNDLNY	537	sp|O00462|MANBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5686	22.931	2	940.44028	940.4403	Y	R	64	71
PSM	RFNFFVN	538	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7025	27.34	2	942.47119	942.4712	A	K	594	601
PSM	RFNNLGL	539	sp|Q15048|LRC14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6175	24.272	2	832.45554	832.4555	L	R	228	235
PSM	RFNSLFSL	540	sp|Q9BVC3|DCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7399	29.041	2	982.52362	982.5236	E	R	337	345
PSM	RFPPYYM	541	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	7-UNIMOD:35	ms_run[2]:scan=6225	24.418	2	988.44767	988.4477	R	R	192	199
PSM	RFQAWVD	542	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6159	24.224	2	920.45045	920.4505	Q	K	1209	1216
PSM	RFSPNSN	543	sp|Q9NY74|ETAA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3643	15.826	2	820.38277	820.3828	Y	K	462	469
PSM	RFVNDYD	544	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4966	20.608	2	927.40865	927.4086	D	K	234	241
PSM	RFYANLQ	545	sp|Q9NSY2|STAR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5460	22.242	2	910.4661	910.4661	T	K	199	206
PSM	RFYESGN	546	sp|Q68D91-2|MBLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4186	17.881	2	871.38243	871.3824	E	R	22	29
PSM	RGAAGDWGE	547	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4719	19.721	2	917.39914	917.3991	K	R	648	657
PSM	RGALQNIIPASTGAA	548	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=8040	31.53	2	1438.7892	1438.7892	G	K	200	215
PSM	RGDLGIEIPAE	549	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6527	25.419	2	1168.6088	1168.6088	A	K	279	290
PSM	RGEEDWLYE	550	sp|Q9NVS9-4|PNPO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6555	25.506	2	1195.5146	1195.5146	H	R	206	215
PSM	RGEENLAGW	551	sp|Q12756|KIF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6066	23.969	2	1030.4832	1030.4832	V	R	1356	1365
PSM	RGFFNLN	552	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6819	26.473	2	866.43989	866.4399	R	R	43	50
PSM	RGFSGGM	553	sp|O00763-3|ACACB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	7-UNIMOD:35	ms_run[2]:scan=3665	15.925	2	726.31191	726.3119	W	K	1956	1963
PSM	RGGNFGFGDS	554	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5896	23.504	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	555	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6450	25.172	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	556	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6834	26.533	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	557	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7123	27.784	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGNFGFGDS	558	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7208	28.18	2	1012.4363	1012.4363	G	R	191	201
PSM	RGGQYFND	559	sp|Q7L0J3-2|SV2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4809	20.041	2	955.41479	955.4148	H	K	507	515
PSM	RGGYDGY	560	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4461	18.81	2	786.32967	786.3297	F	R	633	640
PSM	RGGYDGY	561	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4465	18.823	2	786.32967	786.3297	F	R	633	640
PSM	RGINNYQ	562	sp|O15541|R113A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3959	17.093	2	863.42496	863.4250	Y	K	154	161
PSM	RGLTSVINQ	563	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5402	22.046	2	986.55089	986.5509	A	K	299	308
PSM	RGNGTNVI	564	sp|Q6NUK1-2|SCMC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4268	18.167	2	829.44061	829.4406	W	K	233	241
PSM	RGNLANVI	565	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5740	23.099	2	855.49265	855.4926	W	R	72	80
PSM	RGNYDAF	566	sp|Q9BXP5-5|SRRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5238	21.523	2	841.37187	841.3719	G	R	796	803
PSM	RGPPPSWG	567	sp|P84103-2|SRSF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4954	20.57	2	852.42424	852.4242	N	R	90	98
PSM	RGQQQVF	568	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4751	19.847	2	861.4457	861.4457	D	K	399	406
PSM	RGSGNLL	569	sp|Q8NCM8|DYHC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4888	20.33	2	715.39769	715.3977	L	R	1874	1881
PSM	RGSLNTY	570	sp|P52657|T2AG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4251	18.1	2	809.40317	809.4032	F	R	59	66
PSM	RGSNMDF	571	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5092	21.024	2	825.34394	825.3439	L	R	171	178
PSM	RGVVDSEDLPLNIS	572	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7747	30.518	2	1512.7784	1512.7784	I	R	386	400
PSM	RGVVDSEDLPLNIS	573	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7962	31.259	2	1512.7784	1512.7784	I	R	386	400
PSM	RGWAEQE	574	sp|Q9NWQ9|CN119_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4473	18.849	2	874.39333	874.3933	F	R	104	111
PSM	RGWAQLTD	575	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5855	23.4	2	945.46683	945.4668	N	K	1102	1110
PSM	RGWGSALAAA	576	sp|P27544-2|CERS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6017	23.839	2	958.49846	958.4985	Q	R	25	35
PSM	RGWNTTSQ	577	sp|O15504-2|NUP42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4165	17.792	2	948.44134	948.4413	R	R	45	53
PSM	RGYSFTTTAE	578	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7240	28.332	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSFTTTAE	579	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7373	28.93	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSFTTTAE	580	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7455	29.282	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSFTTTAE	581	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7537	29.63	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSFTTTAE	582	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7619	29.975	2	1131.5197	1131.5197	E	R	196	206
PSM	RGYSSLL	583	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5961	23.675	2	794.42865	794.4287	D	K	437	444
PSM	RGYYNGT	584	sp|Q9Y3C6|PPIL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3982	17.168	2	829.37187	829.3719	R	K	45	52
PSM	RIAAYLF	585	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6959	27.037	2	852.48577	852.4858	R	K	1509	1516
PSM	RIASNAGSIA	586	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4265	18.158	2	958.51959	958.5196	P	-	131	141
PSM	RIGNSYF	587	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5839	23.364	2	855.4239	855.4239	A	K	281	288
PSM	RIINEPTAAAIAYGLD	588	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7018	27.309	2	1686.8941	1686.8941	L	R	116	132
PSM	RIIPGFMCQGGDFT	589	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8155	31.937	2	1613.733	1613.7330	H	R	55	69
PSM	RIIQSWE	590	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5708	23.001	2	930.49232	930.4923	S	K	736	743
PSM	RINEWLT	591	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6250	24.503	2	930.49232	930.4923	S	K	484	491
PSM	RINFNNYYQDA	592	sp|Q96RT7-2|GCP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6242	24.477	2	1416.6422	1416.6422	L	-	1775	1786
PSM	RINQDYI	593	sp|Q8N5C6-2|SRBD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5358	21.902	2	920.47158	920.4716	I	R	392	399
PSM	RISYGPDW	594	sp|P06865|HEXA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6280	24.595	2	992.47158	992.4716	N	K	424	432
PSM	RIWNLTQ	595	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6125	24.128	2	929.5083	929.5083	V	R	92	99
PSM	RIWNNVT	596	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5348	21.871	2	901.477	901.4770	R	R	182	189
PSM	RIYANMF	597	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	6-UNIMOD:35	ms_run[2]:scan=5526	22.454	2	929.44292	929.4429	R	K	407	414
PSM	RIYANMF	598	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6422	25.088	2	913.44801	913.4480	R	K	407	414
PSM	RLAGGVW	599	sp|Q9H0W5|CCDC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5943	23.627	2	757.42351	757.4235	V	R	18	25
PSM	RLAGVGW	600	sp|Q9H0A8|COMD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6140	24.165	2	757.42351	757.4235	N	R	130	137
PSM	RLFGGLL	601	sp|O75718|CRTAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7265	28.445	2	774.47521	774.4752	L	R	107	114
PSM	RLFSSFL	602	sp|P11171-7|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7290	28.552	2	868.48069	868.4807	S	K	81	88
PSM	RLFYNFD	603	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6839	26.555	2	973.46577	973.4658	R	K	733	740
PSM	RLNIWGEA	604	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6536	25.449	2	957.50321	957.5032	S	R	1174	1182
PSM	RLNLYEL	605	sp|P49720|PSB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6853	26.599	2	919.51272	919.5127	F	K	70	77
PSM	RLNSASL	606	sp|P08174-4|DAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4632	19.385	2	759.4239	759.4239	T	K	103	110
PSM	RLQANWN	607	sp|Q8N0X7|SPART_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5032	20.836	2	900.4566	900.4566	L	R	334	341
PSM	RLWVYSG	608	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6336	24.788	2	879.46029	879.4603	H	R	155	162
PSM	RMQAQWE	609	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	2-UNIMOD:35	ms_run[2]:scan=4402	18.605	2	963.42325	963.4233	Q	R	563	570
PSM	RNAYVWTL	610	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7046	27.428	2	1021.5345	1021.5345	D	K	74	82
PSM	RNCAAYL	611	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	3-UNIMOD:4	ms_run[2]:scan=5043	20.867	2	866.40687	866.4069	Q	K	678	685
PSM	RNCGSFT	612	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	3-UNIMOD:4	ms_run[2]:scan=3916	16.905	2	840.35484	840.3548	L	R	767	774
PSM	RNDWLDL	613	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7192	28.107	2	930.45593	930.4559	V	R	174	181
PSM	RNFEQWQSQ	614	sp|Q9H0M0-6|WWP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5513	22.414	2	1221.5527	1221.5527	V	R	200	209
PSM	RNFNAFQ	615	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5350	21.877	2	895.43005	895.4300	R	K	1093	1100
PSM	RNFQANT	616	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3741	16.234	2	849.40931	849.4093	W	K	224	231
PSM	RNFSVNLY	617	sp|Q9Y512|SAM50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6333	24.783	2	1011.5138	1011.5138	E	K	186	194
PSM	RNGTLPWL	618	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7135	27.837	2	955.52395	955.5240	R	R	106	114
PSM	RNLANEF	619	sp|Q8WVE0|EFMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5554	22.537	2	862.42972	862.4297	T	R	194	201
PSM	RNLGALY	620	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5602	22.677	2	805.44464	805.4446	L	R	468	475
PSM	RNLGLYV	621	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6202	24.357	2	833.47594	833.4759	L	K	484	491
PSM	RNLSEFF	622	sp|Q9UG56-2|PISD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6898	26.771	2	911.45012	911.4501	Y	R	129	136
PSM	RNLYSDL	623	sp|Q6NUM9|RETST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5952	23.645	2	879.44503	879.4450	K	K	590	597
PSM	RNMAQYF	624	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6137	24.161	2	928.42252	928.4225	Q	K	423	430
PSM	RNSEEMW	625	sp|Q8IYI6|EXOC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	6-UNIMOD:35	ms_run[2]:scan=4858	20.213	2	966.38653	966.3865	H	R	569	576
PSM	RNVYQNY	626	sp|Q8IYI6|EXOC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4762	19.872	2	955.45118	955.4512	K	R	61	68
PSM	RPQASAW	627	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4864	20.238	2	814.40859	814.4086	N	K	511	518
PSM	RPWEEDF	628	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6507	25.344	2	977.4243	977.4243	R	R	597	604
PSM	RPYWCIS	629	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	5-UNIMOD:4	ms_run[2]:scan=6364	24.877	2	980.45382	980.4538	R	R	517	524
PSM	RQFANLN	630	sp|Q05397-4|FAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4852	20.193	2	861.4457	861.4457	F	R	48	55
PSM	RQNIVLW	631	sp|Q96GC9|VMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6876	26.681	2	927.52904	927.5290	E	R	41	48
PSM	RQQGSGL	632	sp|P49593-2|PPM1F_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3625	15.741	2	744.38785	744.3879	T	R	277	284
PSM	RQYSGYL	633	sp|P10619-2|PPGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5455	22.233	2	885.43447	885.4345	F	K	48	55
PSM	RSELVNWYL	634	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7339	28.784	2	1178.6084	1178.6084	K	K	745	754
PSM	RSESENW	635	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4609	19.304	2	906.38316	906.3832	I	R	198	205
PSM	RSFANDD	636	sp|Q96SI9|STRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3775	16.374	2	823.34605	823.3460	I	R	5	12
PSM	RSGWALNM	637	sp|P41240|CSK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	8-UNIMOD:35	ms_run[2]:scan=5527	22.457	2	949.44399	949.4440	Y	K	185	193
PSM	RSINYDE	638	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4122	17.634	2	895.40356	895.4036	C	K	3664	3671
PSM	RSNSNPFN	639	sp|O14647-2|CHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4484	18.882	2	934.42569	934.4257	G	K	957	965
PSM	RSNYSEL	640	sp|Q9UN81|LORF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4773	19.911	2	867.40865	867.4086	R	R	49	56
PSM	RSPNLWL	641	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6828	26.514	2	884.48684	884.4868	N	K	1202	1209
PSM	RSQSWEE	642	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4302	18.276	2	920.39881	920.3988	H	R	157	164
PSM	RSVWEYVD	643	sp|O95248|MTMR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6600	25.658	2	1052.4927	1052.4927	C	R	1552	1560
PSM	RSWDAIN	644	sp|P42785|PCP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5411	22.082	2	860.41407	860.4141	H	R	239	246
PSM	RSWDQQI	645	sp|Q14493-2|SLBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5617	22.71	2	931.45118	931.4512	R	K	142	149
PSM	RSYFSQF	646	sp|Q7Z7A4-3|PXK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6465	25.221	2	933.43447	933.4345	Y	R	92	99
PSM	RTATESFASDPILY	647	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7939	31.178	2	1569.7675	1569.7675	V	R	77	91
PSM	RTWSELY	648	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6329	24.765	2	953.46068	953.4607	L	R	706	713
PSM	RTWTQVY	649	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5829	23.344	2	952.47667	952.4767	V	K	945	952
PSM	RVAQDWL	650	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6322	24.743	2	886.4661	886.4661	R	K	687	694
PSM	RVCFNCN	651	sp|Q9HBF4-2|ZFYV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4407	18.625	2	968.39565	968.3957	V	K	350	357
PSM	RVSWTQAL	652	sp|Q16656-3|NRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6418	25.074	2	959.51886	959.5189	Q	R	94	102
PSM	RVWVNGN	653	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4610	19.31	2	843.43514	843.4351	E	K	63	70
PSM	RWADLEE	654	sp|P49750-1|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5764	23.146	2	917.4243	917.4243	V	K	1905	1912
PSM	RWDFQTG	655	sp|Q8NCN5|PDPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5974	23.716	2	908.41407	908.4141	P	R	448	455
PSM	RWDQDYD	656	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5105	21.072	2	996.39372	996.3937	G	R	48	55
PSM	RWDQGLE	657	sp|Q13045-2|FLII_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5458	22.237	2	902.42463	902.4246	R	K	420	427
PSM	RWGWPSDN	658	sp|Q9BTL3|RAMAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6370	24.896	2	1016.4464	1016.4464	N	R	70	78
PSM	RWLENSL	659	sp|Q9Y5L0-5|TNPO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6346	24.823	2	916.47667	916.4767	C	K	806	813
PSM	RWLGEQL	660	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6357	24.848	2	900.48175	900.4818	N	K	339	346
PSM	RWNETFQ	661	sp|Q9NRG7|D39U1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5547	22.511	2	979.45118	979.4512	R	K	69	76
PSM	RWNSIEE	662	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5216	21.449	2	932.43519	932.4352	K	R	74	81
PSM	RWSLEALN	663	sp|Q5HYI8|RABL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6707	26.037	2	987.51378	987.5138	R	R	108	116
PSM	RWTAQGA	664	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4247	18.091	2	788.39294	788.3929	P	R	436	443
PSM	RYAAALY	665	sp|Q9NVU0-3|RPC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5444	22.191	2	826.43374	826.4337	S	R	113	120
PSM	RYAPLGWS	666	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6296	24.653	2	948.48175	948.4818	L	K	4195	4203
PSM	RYASENVN	667	sp|P62820-2|RAB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3550	15.394	2	951.44101	951.4410	D	K	47	55
PSM	RYCCSSAEA	668	sp|Q6UWI4|SHSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=3575	15.51	2	1102.4172	1102.4172	L	R	73	82
PSM	RYDAEFF	669	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=6667	25.888	2	946.41848	946.4185	Q	K	711	718
PSM	RYFQGDL	670	sp|Q15120|PDK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5846	23.376	2	897.43447	897.4345	A	K	336	343
PSM	RYGDFFI	671	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7229	28.277	2	916.4443	916.4443	R	R	490	497
PSM	RYGEEGL	672	sp|P25685|DNJB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4823	20.089	2	822.38718	822.3872	D	K	66	73
PSM	RYGQLSE	673	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4294	18.248	2	851.41373	851.4137	A	K	79	86
PSM	RYISPDQLADLY	674	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7118	27.766	2	1452.7249	1452.7249	S	K	176	188
PSM	RYLNFFT	675	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=7078	27.578	2	959.4865	959.4865	L	K	210	217
PSM	RYNEATLY	676	sp|Q9H8Y5|ANKZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5382	21.988	2	1028.4927	1028.4927	R	K	265	273
PSM	RYNELSY	677	sp|Q9BT78-2|CSN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5345	21.866	2	943.43995	943.4399	Q	K	207	214
PSM	RYNGGVG	678	sp|P18621-2|RL17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=3552	15.399	2	721.35074	721.3507	R	R	24	31
PSM	RYNPYTT	679	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4322	18.335	2	913.42938	913.4294	V	R	71	78
PSM	RYNPYTT	680	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=4363	18.468	2	913.42938	913.4294	V	R	71	78
PSM	RYSQYLD	681	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	15		ms_run[2]:scan=5192	21.378	2	943.43995	943.4399	I	R	349	356
PSM	RGGNFGFGDS	682	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5921	23.587434207733335	2	1013.440772	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	683	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7709	30.371734960266668	2	1012.435619	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	684	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7376	28.943146943466665	2	1012.436400	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	685	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7797	30.7082657936	2	1012.435619	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	686	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=8096	31.736527706133334	2	1012.435619	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	687	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7536	29.6243563936	2	1012.436400	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	688	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7616	29.96165205786667	2	1012.436400	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	689	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7996	31.379384283733334	2	1012.435619	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	690	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7299	28.59687617066667	2	1012.436400	1012.436258	G	R	203	213
PSM	RGGNFGFGDS	691	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7896	31.042907328000002	2	1012.435619	1012.436258	G	R	203	213
PSM	KDLFDPIIED	692	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=7974	31.304318092000003	2	1204.603123	1203.602320	F	R	86	96
PSM	RIWNNVT	693	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5342	21.853610289866666	2	901.477251	901.477000	R	R	182	189
PSM	RFSGFGSGAGG	694	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5249	21.5562352064	2	998.458247	998.456993	G	K	72	83
PSM	RQFWFQGN	695	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6780	26.321253384	2	1082.511316	1081.509363	L	R	380	388
PSM	RYWPTADG	696	sp|P52788|SPSY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5514	22.4167357424	2	964.446629	964.440280	D	R	122	130
PSM	RNMAQYF	697	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6125	24.128376602133336	2	928.421808	928.422522	Q	K	423	430
PSM	RFAYDGL	698	sp|P28331|NDUS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6219	24.397468361866668	2	840.412650	840.413003	T	K	291	298
PSM	RWQEVDE	699	sp|Q6ZU35|CRACD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4826	20.096536610666664	2	960.434743	960.430110	L	R	523	530
PSM	RYGEQGL	700	sp|O60884|DNJA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4574	19.2069737208	2	821.404471	821.403166	D	R	68	75
PSM	RGGTNII	701	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4822	20.086769951733334	2	729.413361	729.413337	L	K	90	97
PSM	RWVPSL	702	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6478	25.265881502133333	2	756.428788	756.428259	K	R	253	259
PSM	RAWGALI	703	sp|Q53F19|NCBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6730	26.123779826666667	2	785.455288	785.454808	Q	K	579	586
PSM	REQGEAE	704	sp|Q8TD31|CCHCR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=4455	18.792936926933333	2	817.371923	817.356610	A	R	534	541
PSM	RGDSFFI	705	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6894	26.758146255733333	2	840.412554	840.413003	G	R	603	610
PSM	RCTANDL	706	sp|P49916|DNLI3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	2-UNIMOD:4	ms_run[1]:scan=3943	17.023915377866665	2	850.393231	848.381051	S	K	403	410
PSM	KFQNWM	707	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6290	24.631258570666667	2	852.395170	852.395244	A	K	113	119
PSM	KFYFYE	708	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6601	25.668403866133335	2	895.411554	895.411606	V	R	747	753
PSM	RTAMEFQ	709	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15	4-UNIMOD:35	ms_run[1]:scan=5775	23.18131602	2	897.398445	897.401452	S	R	1007	1014
PSM	RWDEASF	710	sp|Q96L93|KI16B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6131	24.14126791973333	2	910.395682	909.398081	T	R	138	145
PSM	RSYTWLE	711	sp|Q9NW81|DMAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6329	24.7654431696	2	953.460863	953.460681	N	K	72	79
PSM	RNLSADQW	712	sp|Q9Y2A7|NCKP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5098	21.0453575312	2	990.471416	988.472643	R	R	217	225
PSM	RDNYSPGW	713	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=5663	22.865724324	2	994.429037	993.430444	L	K	1346	1354
PSM	RFFNSSSFA	714	sp|P28290|ITPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	15		ms_run[1]:scan=6341	24.810053059999998	2	1061.485449	1061.493044	S	K	203	212