MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F30.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F30.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	66.0	null		0.04	66.0	2	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	65.0	null		0.15	65.0	2	2	2
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.30	59.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.04	57.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	57.0	null	14-UNIMOD:35,1096-UNIMOD:35	0.04	57.0	5	2	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	218-UNIMOD:35	0.11	55.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.07	55.0	2	2	2
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	54-UNIMOD:35	0.06	54.0	4	1	0
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.22	53.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52.0	null	134-UNIMOD:4	0.47	52.0	2	2	2
PRT	sp|Q9BUP0|EFHD1_HUMAN	EF-hand domain-containing protein D1 OS=Homo sapiens OX=9606 GN=EFHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.13	51.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51.0	null		0.03	51.0	1	1	1
PRT	sp|Q7Z7F0-2|KHDC4_HUMAN	Isoform 2 of KH homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KHDC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.05	50.0	1	1	1
PRT	sp|P20290-2|BTF3_HUMAN	Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.19	48.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.11	48.0	1	1	1
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.04	47.0	1	1	1
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.06	47.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.12	47.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	691-UNIMOD:4	0.02	45.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	1	1	1
PRT	sp|Q14919|NC2A_HUMAN	Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	93-UNIMOD:35,102-UNIMOD:35	0.11	44.0	1	1	1
PRT	sp|Q70E73|RAPH1_HUMAN	Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.02	42.0	1	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	20-UNIMOD:35	0.06	41.0	1	1	1
PRT	sp|Q9HC07|TM165_HUMAN	Transmembrane protein 165 OS=Homo sapiens OX=9606 GN=TMEM165 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	1	1	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.07	39.0	3	1	0
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q9HCG8|CWC22_HUMAN	Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens OX=9606 GN=CWC22 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	124-UNIMOD:35	0.22	36.0	1	1	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	375-UNIMOD:35	0.04	33.0	2	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q4VCS5-2|AMOT_HUMAN	Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	3	3	3
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:35	0.08	30.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	2	2	2
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	61-UNIMOD:35,62-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	330-UNIMOD:35	0.10	29.0	3	3	2
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	60-UNIMOD:35,63-UNIMOD:35	0.37	28.0	5	4	3
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.19	28.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.28	28.0	2	2	2
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	549-UNIMOD:35	0.09	28.0	8	5	4
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	6	4	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	105-UNIMOD:4	0.12	28.0	3	3	3
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	630-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	325-UNIMOD:35	0.06	26.0	5	2	0
PRT	sp|P09651-2|ROA1_HUMAN	Isoform A1-A of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	2	2	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	247-UNIMOD:4	0.09	26.0	2	2	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	3	2	1
PRT	sp|Q9H300-2|PARL_HUMAN	Isoform 2 of Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens OX=9606 GN=PARL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	3	3	3
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	218-UNIMOD:35	0.14	23.0	3	3	3
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|Q15361|TTF1_HUMAN	Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	250-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	21-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96DT7-2|ZBT10_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P35813-2|PPM1A_HUMAN	Isoform Alpha-2 of Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	29-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	147-UNIMOD:4	0.18	21.0	2	2	2
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	330-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1293-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q9NZ72-2|STMN3_HUMAN	Isoform 2 of Stathmin-3 OS=Homo sapiens OX=9606 GN=STMN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	591-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.28	20.0	3	3	3
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BTL3|RAMAC_HUMAN	RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	87-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	0
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|Q9NUD5-2|ZCHC3_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	328-UNIMOD:35,330-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H9A6|LRC40_HUMAN	Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	313-UNIMOD:35,315-UNIMOD:4,316-UNIMOD:4	0.04	19.0	2	2	2
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	13-UNIMOD:4,16-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P07738|PMGE_HUMAN	Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	23-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	54-UNIMOD:4,308-UNIMOD:35	0.06	18.0	2	2	2
PRT	sp|Q9H920-2|RN121_HUMAN	Isoform 2 of RING finger protein 121 OS=Homo sapiens OX=9606 GN=RNF121	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	203-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	551-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q9UNP9-2|PPIE_HUMAN	Isoform B of Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens OX=9606 GN=PPIE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	348-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P08236-3|BGLR_HUMAN	Isoform 3 of Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O75319|DUS11_HUMAN	RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|P43304|GPDM_HUMAN	Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q71UI9-2|H2AV_HUMAN	Isoform 2 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|Q14674-2|ESPL1_HUMAN	Isoform 2 of Separin OS=Homo sapiens OX=9606 GN=ESPL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	121-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P61204-2|ARF3_HUMAN	Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	85-UNIMOD:4	0.10	17.0	1	1	1
PRT	sp|P78332-3|RBM6_HUMAN	Isoform 3 of RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q13356|PPIL2_HUMAN	RING-type E3 ubiquitin-protein ligase PPIL2 OS=Homo sapiens OX=9606 GN=PPIL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	471-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P02788-2|TRFL_HUMAN	Isoform DeltaLf of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|Q9H1H9|KI13A_HUMAN	Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=4551	20.037	3	3493.5466	3493.5466	Q	K	798	833
PSM	KEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVE	2	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	65		ms_run[2]:scan=4756	20.943	3	3203.5218	3203.5218	D	K	69	105
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	3	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=5097	22.385	3	2901.5196	2901.5196	G	K	61	95
PSM	REPSAPSIPTPAYQSSPAGGHAPTPPTPAP	4	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=5404	23.528	3	2935.4464	2935.4464	A	R	715	745
PSM	RSPGEGPSPSPMDQPSAPSDPTDQPPAAHA	5	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	12-UNIMOD:35	ms_run[2]:scan=4544	20.006	3	2996.3206	2996.3206	E	K	3	33
PSM	RSPGEGPSPSPMDQPSAPSDPTDQPPAAHA	6	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57		ms_run[1]:scan=4830	21.25629746346667	3	2980.332830	2980.325728	E	K	3	33
PSM	RDYEDGMEVDTTPTVAGQFEDADVDH	7	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	7-UNIMOD:35	ms_run[2]:scan=5610	24.313	3	2927.2039	2927.2039	I	-	212	238
PSM	RESAAPAAAPTAEAPPPSVVTRPEPQALPSPAI	8	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=5788	25.049	3	3245.7044	3245.7044	E	R	35	68
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	9	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	42-UNIMOD:35	ms_run[2]:scan=4447	19.585	4	3718.7129	3718.7129	S	K	13	55
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIK	10	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5342	23.334	3	2777.4963	2777.4963	K	K	69	99
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	11	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4620	20.347	3	3493.5466	3493.5466	Q	K	798	833
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	12	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	42-UNIMOD:35	ms_run[2]:scan=4542	19.995	4	3718.7129	3718.7129	S	K	13	55
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQA	13	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52	25-UNIMOD:4	ms_run[1]:scan=4834	21.275380514400002	4	4721.003467	4720.991449	R	K	110	157
PSM	REEAEESGPQLAPLGAPAPEPKPEPEPPA	14	sp|Q9BUP0|EFHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5442	23.678	3	2989.4669	2989.4669	R	R	16	45
PSM	KEEAEAPVEDGSQPPPPEPKGDATPEGE	15	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=4488	19.749640589600002	3	2886.309924	2886.304307	L	K	623	651
PSM	KTALPAGPQPQPQPQPPLPSQPQAQK	16	sp|Q7Z7F0-2|KHDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5029	22.098	3	2728.466	2728.4660	V	R	436	462
PSM	KAPLATGEDDDDEVPDLVENFDEASKNEAN	17	sp|P20290-2|BTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6456	28.105	3	3246.4324	3246.4324	G	-	133	163
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	18	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5003	21.991	3	3054.5298	3054.5298	K	R	178	209
PSM	KEDEEEDDDVVAPKPPIEPEEE	19	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5223	22.906	3	2537.1181	2537.1181	P	K	143	165
PSM	KGPVAVTGASTPEGTAPPPPAAPAPPKGE	20	sp|Q9H0W8-2|SMG9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4893	21.525	3	2648.381	2648.3810	G	K	108	137
PSM	RNLSPTPASPNQGPPPQVPVSPGPPKDSSAPGGPPE	21	sp|Q9C0E8-3|LNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5155	22.634	4	3509.7539	3509.7539	Q	R	51	87
PSM	KDPSSGQEVATPPVPQLQVCEPKE	22	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	20-UNIMOD:4	ms_run[2]:scan=5572	24.168	3	2619.285	2619.2850	T	R	672	696
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	23	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4777	21.031	4	3702.718	3702.7180	S	K	13	55
PSM	KTVEEPSNPEASSSTSVTPDVSDNEPDHY	24	sp|P60484|PTEN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5011	22.016	3	3117.3534	3117.3534	T	R	349	378
PSM	RPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGP	25	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4899	21.546	4	3877.7515	3877.7515	P	R	545	585
PSM	KDLVASVPDMQGDGEDNHMDGD	26	sp|Q14919|NC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	10-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=4727	20.826	3	2375.9482	2375.9482	L	K	84	106
PSM	KTVAPVVTQAAPPTPTPPVPPAK	27	sp|Q70E73|RAPH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5143	22.595	3	2263.294	2263.2940	T	K	792	815
PSM	RAAAAAAAAAAAAAAAGAGAGA	28	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=5885	25.457066852266667	2	1623.845465	1623.844115	G	K	92	114
PSM	KATESGAQSAPLPMEGVDISPKQDEGVL	29	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	14-UNIMOD:35	ms_run[2]:scan=5657	24.499	3	2869.4015	2869.4015	M	K	7	35
PSM	KEPPAPAQQLQPQPVAVQGPEPARVE	30	sp|Q9HC07|TM165_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5208	22.837	3	2760.4559	2760.4559	N	K	44	70
PSM	RSPGEGPSPSPMDQPSAPSDPTDQPPAAHA	31	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	12-UNIMOD:35	ms_run[2]:scan=4630	20.393	3	2996.3206	2996.3206	E	K	3	33
PSM	RGSGGGGGGGGQGSTNYG	32	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3401	14.931	2	1481.6243	1481.6243	N	K	253	271
PSM	KSSQQPSTPQQAPPGQPQQGTFVAH	33	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4594	20.225	3	2630.2837	2630.2837	G	K	789	814
PSM	KVAVPTGPTPLDSTPPGGAPHPLTGQEEA	34	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5505	23.913	3	2820.4294	2820.4294	A	R	480	509
PSM	MKSSVAQIKPSSGHD	35	sp|Q9HCG8|CWC22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=3978	17.514999308266667	3	1628.785066	1628.782821	-	R	1	16
PSM	KAQETEAAPSQAPADEPEPESAAAQSQENQDTRP	36	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4615	20.326	4	3577.6041	3577.6041	T	K	119	153
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	37	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	25-UNIMOD:35	ms_run[2]:scan=5078	22.306	3	2814.3759	2814.3759	R	-	100	127
PSM	KSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAM	38	sp|Q14444-2|CAPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	42-UNIMOD:35	ms_run[2]:scan=4634	20.414	4	3718.7129	3718.7129	S	K	13	55
PSM	KEASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTL	39	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4601	20.259	4	3685.5736	3685.5736	P	R	141	178
PSM	KIPMTPTSSFVSPPPPTASPHSN	40	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35	ms_run[2]:scan=5190	22.776	3	2392.1733	2392.1733	L	R	372	395
PSM	KEALQDVEDENQ	41	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4563	20.094	2	1416.6369	1416.6369	N	-	222	234
PSM	RAEYVPSTPSPVPPSTPLLSAHS	42	sp|Q4VCS5-2|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5762	24.933	3	2389.2278	2389.2278	Y	K	424	447
PSM	KEELQANGSAPAADKEEPAAAGSGAASPSAAE	43	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4505	19.829064976533335	3	2982.375107	2981.385017	A	K	55	87
PSM	KSPSSSQPLPQVPAPAQSQTQFHVQPQPQP	44	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5503	23.903	4	3220.6265	3220.6265	W	K	44	74
PSM	RGGGGNFGPGPGSNF	45	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5245	23.005	2	1376.6222	1376.6222	S	R	201	216
PSM	KDGDSVMVLPTIPEEEAK	46	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=5603	24.288	3	1972.9663	1972.9663	W	K	182	200
PSM	KDLAAAAAQGPQLPPPQAQPQPSGTGGGVSGQDRYD	47	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5256	23.044	4	3529.7186	3529.7186	T	R	78	114
PSM	KSVTEQGAELSNEE	48	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4416	19.439	2	1519.7002	1519.7002	M	R	27	41
PSM	KTIGGGDDSFNTFFSETGAG	49	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6479	28.204	2	2006.8858	2006.8858	D	K	5	25
PSM	RIIPGFMCQGGDFT	50	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=5912	25.582	2	1613.733	1613.7330	H	R	55	69
PSM	RPDNFVFGQSGAGNNWA	51	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6212	26.943	2	1835.8339	1835.8339	F	K	86	103
PSM	KAMGIMNSFVNDIFE	52	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6885	29.89	2	1746.7957	1746.7957	S	R	58	73
PSM	KPVPAAPVPSPVAPAPVPSR	53	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5071	22.269	3	1933.1149	1933.1149	E	R	76	96
PSM	KTAFQEALDAAGD	54	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6167	26.727	2	1335.6307	1335.6307	S	K	8	21
PSM	KTPETLVPTAPKLEPSTSTDQPVTPEPTSQAT	55	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5535	24.023	3	3347.6984	3347.6984	G	R	1138	1170
PSM	KVEIIANDQGN	56	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4530	19.943	2	1199.6146	1199.6146	G	R	25	36
PSM	RNPDDITNEEYGEFY	57	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5977	25.857	2	1860.7802	1860.7802	T	K	299	314
PSM	RNPDDITQEEYGEFY	58	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6008	25.995	2	1874.7959	1874.7959	T	K	291	306
PSM	RVIGSGCNLDSA	59	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4	ms_run[2]:scan=4602	20.262	2	1247.5928	1247.5928	N	R	99	111
PSM	KAMGIMNSFVNDIFE	60	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=6651	28.915	2	1746.7957	1746.7957	S	R	58	73
PSM	KEAMEDGEIDGN	61	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=3648	15.995	2	1322.5296	1322.5296	A	K	627	639
PSM	KEVDEQMLNVQN	62	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=4360	19.189	2	1461.677	1461.6770	M	K	324	336
PSM	KIPMTPTSSFVSPPPPTASPHSN	63	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=5211	22.853	3	2392.1733	2392.1733	L	R	372	395
PSM	KEITALAPSTM	64	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=4819	21.208	2	1176.606	1176.6060	Q	K	315	326
PSM	RGVVDSEDLPLNIS	65	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6085	26.357	2	1512.7784	1512.7784	I	R	386	400
PSM	RSSGPYGGGGQYFA	66	sp|P09651-2|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5233	22.957	2	1402.6266	1402.6266	G	K	284	298
PSM	RVPTANVSVVDLTC	67	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:4	ms_run[2]:scan=5780	25.022	2	1529.7872	1529.7872	F	R	234	248
PSM	KSNVSDAVAQST	68	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3929	17.286	2	1205.5888	1205.5888	L	R	194	206
PSM	KWWNNLSDGQ	69	sp|Q9H300-2|PARL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5836	25.236	2	1246.5731	1246.5731	N	R	157	167
PSM	RELISNSSDALD	70	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5017	22.042	2	1318.6365	1318.6365	L	K	46	58
PSM	RTTPSYVAFTDTE	71	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5506	23.919	2	1486.694	1486.6940	N	R	36	49
PSM	RYYGGGSEGG	72	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3654	16.02	2	1001.4203	1001.4203	G	R	46	56
PSM	RPDNFVFGQSGAGNNWA	73	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7203	31.0651314688	2	1836.835179	1835.833945	F	K	86	103
PSM	KDLFDPIIED	74	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6410	27.883	2	1203.6023	1203.6023	F	R	86	96
PSM	REPPPAYEPPAPAPLPPPSAPSLQPSR	75	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5627	24.388	3	2815.4657	2815.4657	T	K	47	74
PSM	RGALQNIIPASTGAA	76	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5726	24.791	2	1438.7892	1438.7892	G	K	200	215
PSM	RGGGGGFGYQ	77	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4425	19.483	2	954.43078	954.4308	K	K	635	645
PSM	RNPDDITNEEYGEFY	78	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7069	30.615409389066667	2	1860.789524	1860.780237	T	K	299	314
PSM	KDSTLIMQLL	79	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=6598	28.7	2	1176.6424	1176.6424	Y	R	212	222
PSM	KDSYVGDEAQS	80	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3834	16.855	2	1197.515	1197.5150	Q	K	50	61
PSM	KEITALAPSTM	81	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=6987	30.318	2	1176.606	1176.6060	Q	K	315	326
PSM	KNLQTVNVDEN	82	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4283	18.874	2	1272.631	1272.6310	F	-	115	126
PSM	REAGTDMQESQPTVGLDDETPQLLGPTH	83	sp|Q15361|TTF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=5778	25.011	3	3037.3935	3037.3935	G	K	244	272
PSM	RGYISPYFINTS	84	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6081	26.336	2	1416.7038	1416.7038	D	K	221	233
PSM	RNENSGNSWN	85	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3805	16.728	2	1176.4908	1176.4908	N	K	736	746
PSM	RPQNYLFGCEL	86	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4	ms_run[2]:scan=6291	27.327	2	1395.6605	1395.6605	L	K	13	24
PSM	RTTPSYVAFTDTE	87	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5518	23.97	2	1486.694	1486.6940	N	R	36	49
PSM	KEITALAPSTM	88	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=7136	30.843	2	1176.606	1176.6060	Q	K	315	326
PSM	RADGYEPPVQESV	89	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5022	22.069	2	1445.6787	1445.6787	E	-	252	265
PSM	RETLLNSATTSLNS	90	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5421	23.599	2	1505.7686	1505.7686	D	K	130	144
PSM	RGGGGGGLGNNGSS	91	sp|Q96DT7-2|ZBT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3368	14.796	2	1145.5174	1145.5174	F	R	126	140
PSM	RSSQSSSQQFSGIG	92	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4722	20.799	2	1454.675	1454.6750	G	R	670	684
PSM	RYGLSSMQGW	93	sp|P35813-2|PPM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=5474	23.799	2	1199.5393	1199.5393	L	R	23	33
PSM	KGDGPVQGIINFEQ	94	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6140	26.6	2	1500.7573	1500.7573	L	K	10	24
PSM	KNVLIVEDIIDTG	95	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6705	29.133	2	1427.7872	1427.7872	G	K	128	141
PSM	KVTLTSEEEA	96	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4340	19.129	2	1105.5503	1105.5503	V	R	247	257
PSM	PEPAKSAPAP	97	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3665	16.068	2	963.50255	963.5025	M	K	2	12
PSM	PFSNSHNAL	98	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4633	20.409	2	985.46174	985.4617	M	K	2	11
PSM	RAAAAAAAAAAAAAAAGAGAGA	99	sp|P55011-3|S12A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5864	25.361	3	1623.8441	1623.8441	G	K	92	114
PSM	RFFGNSWAETY	100	sp|O43488|ARK72_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6203	26.899	2	1376.6149	1376.6149	G	R	250	261
PSM	RGGGFGGNDNFG	101	sp|P09651-2|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4921	21.64	2	1153.4901	1153.4901	G	R	206	218
PSM	RISVYYNEATGG	102	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5118	22.472	2	1328.6361	1328.6361	D	K	46	58
PSM	RLLLPGELA	103	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6110	26.474	2	980.60187	980.6019	V	K	100	109
PSM	RWCSWSLSQA	104	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:4	ms_run[2]:scan=6011	26.011	2	1279.5768	1279.5768	N	R	328	338
PSM	RYSGSYNDYL	105	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5459	23.753	2	1236.5411	1236.5411	A	R	647	657
PSM	RYWCDAEYDAY	106	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=5712	24.728	2	1510.5823	1510.5823	R	R	1290	1301
PSM	RNPDDITQEEYGEFY	107	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7172	30.96545080026667	2	1875.797947	1874.795888	T	K	291	306
PSM	KADLINNLGTIA	108	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6016	26.029	2	1241.698	1241.6980	T	K	100	112
PSM	KALEENNNFS	109	sp|Q9NZ72-2|STMN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4192	18.467	2	1164.5411	1164.5411	H	R	109	119
PSM	KDQLIYNLL	110	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6627	28.816	2	1118.6336	1118.6336	L	K	5	14
PSM	KDSYVGDEAQS	111	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3670	16.095	2	1197.515	1197.5150	Q	K	50	61
PSM	KESYSVYVY	112	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5490	23.855	2	1136.539	1136.5390	R	K	35	44
PSM	KSAVEDEGL	113	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4533	19.956	2	946.46074	946.4607	M	K	550	559
PSM	RETVSEESNVLCLS	114	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=5635	24.409	2	1621.7618	1621.7618	Y	K	580	594
PSM	RFNPNLYNDG	115	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5106	22.419	2	1208.5574	1208.5574	V	K	4654	4664
PSM	RGGNFGGGGGNFG	116	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4708	20.747	2	1152.5061	1152.5061	G	R	204	217
PSM	RGGSFENNWNIY	117	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6122	26.521	2	1455.6531	1455.6531	L	K	374	386
PSM	RISGLIYEET	118	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5566	24.141	2	1179.6136	1179.6136	K	R	46	56
PSM	RLAPDYDALDVAN	119	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5692	24.646	2	1431.6994	1431.6994	V	K	139	152
PSM	RLQAALDDEEAGG	120	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4758	20.954	2	1343.6317	1343.6317	E	R	37	50
PSM	RQFWFQGN	121	sp|Q9C0B1|FTO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6020	26.051	2	1081.5094	1081.5094	L	R	380	388
PSM	RTTPSYVAFTDTE	122	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7010	30.404	2	1486.694	1486.6940	N	R	36	49
PSM	RTTPSYVAFTDTE	123	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7119	30.782	2	1486.694	1486.6940	N	R	36	49
PSM	RWGWPSDN	124	sp|Q9BTL3|RAMAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5709	24.716	2	1016.4464	1016.4464	N	R	70	78
PSM	RWIDFDNDY	125	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6252	27.138	2	1242.5306	1242.5306	G	K	140	149
PSM	RFDDAVVQSDM	126	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	11-UNIMOD:35	ms_run[1]:scan=4811	21.173014316266666	2	1297.5633	1297.5603	R	K	77	88
PSM	RSSGPYGGGGQYFA	127	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7078	30.643671764533334	2	1403.633382	1402.626578	G	K	284	298
PSM	KAVTEQGAELSNEE	128	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4298	18.949	2	1503.7053	1503.7053	M	R	27	41
PSM	KESYSIYVY	129	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5754	24.903	2	1150.5546	1150.5546	R	K	35	44
PSM	KLLQDFFNG	130	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6401	27.841	2	1080.5604	1080.5604	Q	R	348	357
PSM	KPEFVDIINA	131	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6166	26.722	2	1144.6128	1144.6128	L	K	238	248
PSM	KTAVVVGTITDDV	132	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5603	24.288	2	1316.7187	1316.7187	N	R	49	62
PSM	KVLLPEYGGT	133	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5172	22.692	2	1075.5914	1075.5914	D	K	70	80
PSM	KVLTPELYAEL	134	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6327	27.497	2	1274.7122	1274.7122	A	R	32	43
PSM	RFGIWTGEY	135	sp|Q9NUD5-2|ZCHC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6336	27.542	2	1127.54	1127.5400	D	K	125	134
PSM	RFGSGMNMG	136	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=3526	15.488	2	987.39024	987.3902	G	R	323	332
PSM	RGGNFGFGDS	137	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5164	22.66	2	1012.4363	1012.4363	G	R	191	201
PSM	RLDIDSPPITA	138	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5647	24.462	2	1196.6401	1196.6401	C	R	32	43
PSM	RLSYNTASN	139	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3951	17.387	2	1024.4938	1024.4938	R	K	10	19
PSM	RNLLSVAY	140	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5834	25.225	2	934.52362	934.5236	E	K	41	49
PSM	RNYYGYQGY	141	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5151	22.623	2	1182.5094	1182.5094	Y	R	738	747
PSM	RPVIDNPNY	142	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4791	21.093	2	1086.5458	1086.5458	Q	K	263	272
PSM	RQINWTVLY	143	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6417	27.917	2	1191.64	1191.6400	P	R	47	56
PSM	RQQYESVAA	144	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4079	17.958	2	1050.5094	1050.5094	V	K	273	282
PSM	RVFSWGFGGYG	145	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6592	28.675	2	1231.5774	1231.5774	K	R	350	361
PSM	RWWEQTDLT	146	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5937	25.68	2	1233.5778	1233.5778	E	K	77	86
PSM	RYWSQFDENI	147	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6073	26.303	2	1356.6099	1356.6099	N	R	95	105
PSM	KEIIDLVLD	148	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6562	28.547275349866666	2	1056.610199	1056.606677	G	R	112	121
PSM	KYMACCLLY	149	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35,5-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=5648	24.467271510933333	2	1236.537250	1236.534123	G	R	311	320
PSM	KSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	150	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5177	22.7169227576	3	3975.805342	3974.825357	V	K	35	77
PSM	KPEFVDIINA	151	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6151	26.65244437013333	2	1144.613372	1144.612825	L	K	238	248
PSM	KNALESYAFNM	152	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:35	ms_run[2]:scan=5690	24.635	2	1302.5914	1302.5914	A	K	539	550
PSM	KPWCWYCN	153	sp|O43670-3|ZN207_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5964	25.793	2	1212.4845	1212.4845	L	R	10	18
PSM	KVGEFSGAN	154	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4101	18.055	2	907.43995	907.4399	Q	K	65	74
PSM	RFCSWVDQ	155	sp|P07738|PMGE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:4	ms_run[2]:scan=5439	23.662	2	1096.476	1096.4760	N	K	21	29
PSM	RFGGSYGG	156	sp|Q5BKZ1|ZN326_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4219	18.586	2	799.3613	799.3613	S	R	102	110
PSM	RGGLGWESSL	157	sp|Q9Y6K1|DNM3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5906	25.55	2	1060.5302	1060.5302	L	R	171	181
PSM	RINISEGNCPE	158	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	9-UNIMOD:4	ms_run[2]:scan=4564	20.1	2	1287.5877	1287.5877	A	R	46	57
PSM	RMFSNPWE	159	sp|Q9H920-2|RN121_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=5544	24.059	2	1081.4651	1081.4651	K	R	202	210
PSM	RNIPGITLLNVS	160	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6352	27.615	2	1295.7561	1295.7561	F	K	222	234
PSM	RNYYEQWG	161	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5383	23.449	2	1114.4832	1114.4832	L	K	26	34
PSM	RPEYSASQL	162	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4825	21.237	2	1049.5142	1049.5142	F	K	173	182
PSM	RPMSAYMLWLNAS	163	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:35	ms_run[2]:scan=6628	28.823	2	1554.7323	1554.7323	K	R	549	562
PSM	RPVWSDDDWL	164	sp|Q9UNP9-2|PPIE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6644	28.887	2	1287.5884	1287.5884	S	K	93	103
PSM	RSFMNNWEVY	165	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:35	ms_run[2]:scan=5887	25.466	2	1360.587	1360.5870	G	K	345	355
PSM	RTLSDYNIQ	166	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4955	21.793	2	1108.5513	1108.5513	G	K	54	63
PSM	RTLYGFGG	167	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5468	23.788	2	869.43955	869.4396	G	-	96	104
PSM	RWLGANAF	168	sp|P08236-3|BGLR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5929	25.649	2	933.48209	933.4821	L	R	228	236
PSM	RWYDLMDN	169	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:35	ms_run[2]:scan=5577	24.185	2	1127.4706	1127.4706	A	K	1091	1099
PSM	RWYDLMDN	170	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6148	26.636	2	1111.4757	1111.4757	A	K	1091	1099
PSM	RWYPYNYS	171	sp|O75319|DUS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5550	24.087	2	1147.5087	1147.5087	R	R	358	366
PSM	RYVWLVYEQD	172	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6507	28.318	2	1369.6667	1369.6667	H	R	119	129
PSM	RTTPSYVAFTDTE	173	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=7232	31.168345355733333	2	1487.703709	1486.693989	N	R	36	49
PSM	RGSGGGGGGGGQGSTNYG	174	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=3435	15.0797991016	2	1482.610677	1481.624346	N	K	253	271
PSM	RGSGGGGGGGGQGSTNYG	175	sp|Q99729-3|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=3424	15.031313894666665	2	1481.624630	1481.624346	N	K	253	271
PSM	RELNWDDY	176	sp|P43304|GPDM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5737	24.842021132533333	2	1109.478798	1109.477788	G	K	579	587
PSM	KMIWWAN	177	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6343	27.573	2	947.46874	947.4687	E	K	2572	2579
PSM	KVFLENVI	178	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6296	27.354	2	960.56442	960.5644	L	R	60	68
PSM	RAGLQFPVG	179	sp|Q71UI9-2|H2AV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5710	24.72	2	943.52395	943.5240	Q	R	23	32
PSM	RANFSSEAGW	180	sp|Q14674-2|ESPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5388	23.464	2	1123.5047	1123.5047	F	R	1641	1651
PSM	RCSWQDL	181	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:4	ms_run[2]:scan=5471	23.792	2	963.42325	963.4233	S	K	120	127
PSM	RDAVLLVFAN	182	sp|P61204-2|ARF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6471	28.172	2	1116.6291	1116.6291	L	K	80	90
PSM	REWCDAFL	183	sp|O75531|BAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=6367	27.685	2	1095.4808	1095.4808	L	-	82	90
PSM	RFAPGWN	184	sp|P78332-3|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5264	23.062	2	846.41367	846.4137	E	R	21	28
PSM	RFLNAENAQ	185	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4572	20.134	2	1061.5254	1061.5254	I	K	141	150
PSM	RGFGDFSSW	186	sp|Q13356|PPIL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6451	28.082	2	1057.4617	1057.4617	S	-	512	521
PSM	RGLTSVINQ	187	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4998	21.964	2	986.55089	986.5509	A	K	299	308
PSM	RGVVDSEDLPLNIS	188	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7150	30.888	2	1512.7784	1512.7784	I	R	386	400
PSM	RIWQYVYS	189	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5823	25.187	2	1113.5607	1113.5607	E	K	88	96
PSM	RLACGVIGIAQ	190	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=5484	23.83	2	1156.6387	1156.6387	S	-	144	155
PSM	RLNEQASEEIL	191	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5354	23.37	2	1300.6623	1300.6623	D	K	32	43
PSM	RNYQFDFL	192	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6498	28.283	2	1101.5243	1101.5243	Q	R	126	134
PSM	RPTYTNLN	193	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4270	18.813	2	977.49304	977.4930	E	R	186	194
PSM	RQMSGAQI	194	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	3-UNIMOD:35	ms_run[2]:scan=3738	16.422	2	905.4389	905.4389	I	K	306	314
PSM	RQSSGASSSSFSSS	195	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3603	15.804	2	1360.5855	1360.5855	Y	R	587	601
PSM	RSEGFDTY	196	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4822	21.222	2	973.41412	973.4141	L	R	53	61
PSM	RSFMNNWEVY	197	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6360	27.652	2	1344.5921	1344.5921	G	K	345	355
PSM	RWWIETC	198	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	7-UNIMOD:4	ms_run[2]:scan=6254	27.145	2	1049.4753	1049.4753	H	K	465	472
PSM	RYYGYTGAF	199	sp|P02788-2|TRFL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5640	24.432	2	1096.4978	1096.4978	E	R	499	508
PSM	RWYNGTNN	200	sp|P17174|AATC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4480	19.724486516000002	2	1023.452726	1023.452242	A	K	122	130
PSM	RLNSVQSSE	201	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=3572	15.677157240266666	2	1018.505739	1018.504337	M	R	2233	2242
PSM	KELTVTWEEKL	202	sp|Q9H1H9|KI13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6025	26.072227581066667	2	1377.739726	1374.739482	I	R	404	415