MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000422-1 -- main MTD ms_run[1]-location D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F31.maxq.txt MTD ms_run[2]-location D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F31.maxqFin.txt MTD software[1] [MS, MS:1001583, MaxQuant, 1.6.2.10] MTD software[1]-setting Taxon=userFasta.sprot_human_20201019 MTD software[1]-setting enzymes=TrypN MTD software[1]-setting enzymeMode=0 MTD software[1]-setting fixedModifications=Carbamidomethyl (C) MTD software[1]-setting variableModifications=Acetyl (Protein N-term),Oxidation (M) MTD software[1]-setting maxMissedCleavages=1 MTD software[1]-setting lcmsRunType=Standard MTD software[1]-setting firstSearchTol=40 MTD software[1]-setting mainSearchTol=4.5 MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20201019 MTD software[2]-setting CLE=[X]|[RK] MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Acetyl (Protein N-term) MTD software[2]-setting TOL(-)=20 MTD software[2]-setting TOL(+)=20 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=50 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=1 MTD software[3] [MS, MS:1002251, Comet, 2019.01 rev. 5] MTD software[3]-setting Taxon=userFasta.sprot_human_20201019 MTD software[3]-setting search_enzyme_number=11 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Acetyl (Protein N-term),Oxidation (M) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=1 MTD software[3]-setting peptide_mass_tolerance=20 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=1.0005 MTD software[3]-setting fragment_bin_offset=0.4 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:1, Acetyl,] MTD variable_mod[1]-site N-term MTD variable_mod[1]-position Protein N-term MTD variable_mod[2] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[2]-site M MTD variable_mod[2]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P29966|MARCS_HUMAN Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 72.0 null 0.15 72.0 4 2 0 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 64.0 null 0.04 64.0 2 1 0 PRT sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 64.0 null 0.07 64.0 2 1 0 PRT sp|P33240-2|CSTF2_HUMAN Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56.0 null 487-UNIMOD:35,492-UNIMOD:35 0.07 56.0 1 1 1 PRT sp|Q14657|LAGE3_HUMAN EKC/KEOPS complex subunit LAGE3 OS=Homo sapiens OX=9606 GN=LAGE3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 56.0 null 1-UNIMOD:1,1-UNIMOD:35,23-UNIMOD:4 0.17 56.0 2 1 0 PRT sp|Q96T58|MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55.0 null 0.01 55.0 1 1 1 PRT sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55.0 null 20-UNIMOD:35 0.06 55.0 2 1 0 PRT sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55.0 null 0.08 55.0 2 2 2 PRT sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55.0 null 0.11 55.0 2 1 0 PRT sp|O43823|AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 555-UNIMOD:35 0.04 53.0 1 1 1 PRT sp|Q7Z6Z7-2|HUWE1_HUMAN Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 3794-UNIMOD:35 0.01 53.0 1 1 1 PRT sp|Q8WUM4|PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 0.04 53.0 1 1 1 PRT sp|Q15020-4|SART3_HUMAN Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53.0 null 915-UNIMOD:35 0.04 53.0 1 1 1 PRT sp|Q9BXF6|RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51.0 null 579-UNIMOD:35 0.04 51.0 1 1 1 PRT sp|Q92598-3|HS105_HUMAN Isoform 3 of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51.0 null 467-UNIMOD:35,473-UNIMOD:35,475-UNIMOD:4 0.04 51.0 2 1 0 PRT sp|Q14684-2|RRP1B_HUMAN Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51.0 null 468-UNIMOD:35,479-UNIMOD:35 0.04 51.0 1 1 1 PRT sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51.0 null 468-UNIMOD:35,480-UNIMOD:35 0.01 51.0 1 1 1 PRT sp|P80723|BASP1_HUMAN Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.13 50.0 1 1 1 PRT sp|P41227-2|NAA10_HUMAN Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.12 50.0 2 1 0 PRT sp|Q8NFQ8|TOIP2_HUMAN Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.08 50.0 1 1 1 PRT sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 14-UNIMOD:35 0.03 50.0 1 1 1 PRT sp|Q9UKN8|TF3C4_HUMAN General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50.0 null 0.05 50.0 1 1 1 PRT sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49.0 null 358-UNIMOD:35 0.06 49.0 1 1 1 PRT sp|Q9UNF1-2|MAGD2_HUMAN Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48.0 null 0.06 48.0 1 1 1 PRT sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 263-UNIMOD:35,266-UNIMOD:4 0.06 47.0 1 1 1 PRT sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47.0 null 0.03 47.0 1 1 1 PRT sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 827-UNIMOD:4,831-UNIMOD:4 0.02 46.0 1 1 1 PRT sp|Q8NFD5|ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46.0 null 1571-UNIMOD:35 0.02 46.0 2 2 2 PRT sp|Q8IWZ8-2|SUGP1_HUMAN Isoform 2 of SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.12 45.0 1 1 1 PRT sp|Q14919|NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 45.0 null 93-UNIMOD:35,102-UNIMOD:35 0.11 45.0 4 1 0 PRT sp|Q9NZN5-2|ARHGC_HUMAN Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.02 45.0 1 1 1 PRT sp|Q9BZE9-3|ASPC1_HUMAN Isoform 3 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45.0 null 0.05 45.0 1 1 1 PRT sp|Q9NPH2|INO1_HUMAN Inositol-3-phosphate synthase 1 OS=Homo sapiens OX=9606 GN=ISYNA1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 45.0 null 541-UNIMOD:4,555-UNIMOD:35 0.05 45.0 2 1 0 PRT sp|Q5JTH9-2|RRP12_HUMAN Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.02 44.0 1 1 1 PRT sp|Q13409-6|DC1I2_HUMAN Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.04 44.0 2 1 0 PRT sp|Q6PKG0|LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.02 44.0 3 1 0 PRT sp|Q9UK76-3|JUPI1_HUMAN Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.19 44.0 1 1 1 PRT sp|Q9UN86-2|G3BP2_HUMAN Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44.0 null 0.05 44.0 1 1 1 PRT sp|Q8WXI9|P66B_HUMAN Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43.0 null 0.04 43.0 1 1 1 PRT sp|Q14686|NCOA6_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 1292-UNIMOD:35 0.01 42.0 1 1 1 PRT sp|Q9Y2H6-2|FND3A_HUMAN Isoform 2 of Fibronectin type-III domain-containing protein 3A OS=Homo sapiens OX=9606 GN=FNDC3A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 694-UNIMOD:4,706-UNIMOD:4,713-UNIMOD:4 0.02 42.0 1 1 1 PRT sp|Q14746-2|COG2_HUMAN Isoform 2 of Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.04 42.0 1 1 1 PRT sp|Q86VM9|ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.03 42.0 2 1 0 PRT sp|Q6IAA8|LTOR1_HUMAN Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 76-UNIMOD:35,82-UNIMOD:35 0.16 42.0 1 1 1 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 42.0 null 293-UNIMOD:35 0.04 42.0 2 2 2 PRT sp|Q13459-2|MYO9B_HUMAN Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42.0 null 0.02 42.0 1 1 1 PRT sp|Q9Y320-2|TMX2_HUMAN Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.10 41.0 1 1 1 PRT sp|Q08357|S20A2_HUMAN Sodium-dependent phosphate transporter 2 OS=Homo sapiens OX=9606 GN=SLC20A2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.05 41.0 1 1 1 PRT sp|P07814|SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41.0 null 0.02 41.0 1 1 1 PRT sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 0.03 40.0 1 1 1 PRT sp|Q9BYW2-3|SETD2_HUMAN Isoform 3 of Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 116-UNIMOD:35 0.01 40.0 1 1 1 PRT sp|Q05048|CSTF1_HUMAN Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40.0 null 146-UNIMOD:35,151-UNIMOD:35,152-UNIMOD:35,160-UNIMOD:35 0.06 40.0 1 1 1 PRT sp|Q9H307|PININ_HUMAN Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 429-UNIMOD:35,439-UNIMOD:4 0.05 39.0 3 2 1 PRT sp|Q92618|ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.02 39.0 1 1 1 PRT sp|B7ZAP0|RBG10_HUMAN Rab GTPase-activating protein 1-like, isoform 10 OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.09 39.0 1 1 1 PRT sp|Q4VCS5-2|AMOT_HUMAN Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 0.04 39.0 2 1 0 PRT sp|Q86W50|MET16_HUMAN RNA N6-adenosine-methyltransferase METTL16 OS=Homo sapiens OX=9606 GN=METTL16 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39.0 null 448-UNIMOD:4 0.06 39.0 1 1 1 PRT sp|Q9UQ84-4|EXO1_HUMAN Isoform 2 of Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 347-UNIMOD:35 0.03 38.0 1 1 1 PRT sp|O95628-3|CNOT4_HUMAN Isoform 3 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 0.05 38.0 1 1 1 PRT sp|Q7Z5L9-2|I2BP2_HUMAN Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38.0 null 375-UNIMOD:35 0.04 38.0 2 1 0 PRT sp|Q9BRJ6|CG050_HUMAN Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.15 37.0 1 1 1 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 188-UNIMOD:35 0.08 37.0 2 1 0 PRT sp|Q08379-2|GOGA2_HUMAN Isoform 2 of Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 412-UNIMOD:4 0.04 37.0 2 1 0 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 120-UNIMOD:35 0.07 37.0 1 1 1 PRT sp|A0MZ66-7|SHOT1_HUMAN Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37.0 null 0.09 37.0 1 1 1 PRT sp|Q99460-2|PSMD1_HUMAN Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36.0 null 297-UNIMOD:35 0.04 36.0 2 1 0 PRT sp|O00401|WASL_HUMAN Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35.0 null 0.05 35.0 1 1 1 PRT sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 963-UNIMOD:4 0.01 34.0 2 1 0 PRT sp|Q96EK5|KBP_HUMAN KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34.0 null 0.04 34.0 1 1 1 PRT sp|Q14118|DAG1_HUMAN Dystroglycan OS=Homo sapiens OX=9606 GN=DAG1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 34.0 null 873-UNIMOD:35 0.03 34.0 2 1 0 PRT sp|Q9HCG8|CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens OX=9606 GN=CWC22 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34.0 null 1-UNIMOD:1,1-UNIMOD:35 0.02 34.0 1 1 1 PRT sp|Q9BYC8|RM32_HUMAN 39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.13 33.0 1 1 1 PRT sp|Q5PRF9|SMAG2_HUMAN Protein Smaug homolog 2 OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 1 1 1 PRT sp|Q15811-13|ITSN1_HUMAN Isoform 13 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.03 33.0 1 1 1 PRT sp|P51858-2|HDGF_HUMAN Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 101-UNIMOD:4 0.09 33.0 1 1 1 PRT sp|Q9Y520-3|PRC2C_HUMAN Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33.0 null 0.01 33.0 2 1 0 PRT sp|Q6W2J9-4|BCOR_HUMAN Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.01 32.0 1 1 1 PRT sp|Q6P6B1|ERIC5_HUMAN Glutamate-rich protein 5 OS=Homo sapiens OX=9606 GN=ERICH5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 296-UNIMOD:35,308-UNIMOD:35 0.07 32.0 1 1 1 PRT sp|Q8NEN9|PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|Q9H1I8-3|ASCC2_HUMAN Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 0.02 32.0 1 1 1 PRT sp|Q7Z4H8-2|PLGT3_HUMAN Isoform 2 of Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32.0 null 426-UNIMOD:35,439-UNIMOD:4,441-UNIMOD:4 0.05 32.0 1 1 1 PRT sp|Q9BXV9|GON7_HUMAN EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 43-UNIMOD:35 0.19 31.0 1 1 1 PRT sp|Q14331|FRG1_HUMAN Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31.0 null 0.09 31.0 1 1 1 PRT sp|Q8IX15|HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 31.0 null 191-UNIMOD:35 0.03 31.0 2 1 0 PRT sp|P14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31.0 null 0.05 31.0 1 1 1 PRT sp|O00264-2|PGRC1_HUMAN Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.15 30.0 1 1 1 PRT sp|Q9ULJ8|NEB1_HUMAN Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9A PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 325-UNIMOD:4 0.03 30.0 1 1 1 PRT sp|P68363-2|TBA1B_HUMAN Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30.0 null 0.06 30.0 1 1 1 PRT sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29.0 null 80-UNIMOD:35,81-UNIMOD:35 0.05 29.0 1 1 1 PRT sp|O75381|PEX14_HUMAN Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 342-UNIMOD:4 0.07 29.0 1 1 1 PRT sp|P05114|HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29.0 null 0.25 29.0 1 1 1 PRT sp|P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 60-UNIMOD:35,63-UNIMOD:35 0.21 28.0 4 2 1 PRT sp|P10599-2|THIO_HUMAN Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.16 28.0 1 1 1 PRT sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 330-UNIMOD:35,73-UNIMOD:35 0.13 28.0 4 4 4 PRT sp|P09651-3|ROA1_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28.0 null 0.06 28.0 2 1 0 PRT sp|P27816-5|MAP4_HUMAN Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 292-UNIMOD:35,296-UNIMOD:35,300-UNIMOD:35,306-UNIMOD:35 0.03 27.0 1 1 1 PRT sp|P62258-2|1433E_HUMAN Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.06 27.0 1 1 1 PRT sp|O75182-2|SIN3B_HUMAN Isoform 2 of Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.02 27.0 1 1 1 PRT sp|P49321-2|NASP_HUMAN Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.06 27.0 1 1 1 PRT sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.10 27.0 1 1 1 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 218-UNIMOD:35 0.14 27.0 3 3 3 PRT sp|P22626-2|ROA2_HUMAN Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 0.13 27.0 5 4 3 PRT sp|P34896-3|GLYC_HUMAN Isoform 3 of Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27.0 null 2-UNIMOD:1,3-UNIMOD:35 0.05 27.0 1 1 1 PRT sp|Q8N4Q1|MIA40_HUMAN Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.18 26.0 1 1 1 PRT sp|Q9UGU0-2|TCF20_HUMAN Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.01 26.0 1 1 1 PRT sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.04 26.0 3 2 1 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26.0 null 0.06 26.0 3 3 2 PRT sp|Q9BVJ6|UT14A_HUMAN U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 94-UNIMOD:35,97-UNIMOD:35 0.07 25.0 2 2 2 PRT sp|P04406-2|G3P_HUMAN Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.05 25.0 1 1 1 PRT sp|Q92734-4|TFG_HUMAN Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25.0 null 0.11 25.0 1 1 1 PRT sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25.0 null 0.02 25.0 1 1 0 PRT sp|P12277|KCRB_HUMAN Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 207-UNIMOD:35 0.15 24.0 4 4 4 PRT sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 325-UNIMOD:35 0.09 24.0 5 3 1 PRT sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 630-UNIMOD:35 0.04 24.0 2 2 2 PRT sp|P14618-2|KPYM_HUMAN Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24.0 null 0.03 24.0 1 1 1 PRT sp|Q9HC07|TM165_HUMAN Transmembrane protein 165 OS=Homo sapiens OX=9606 GN=TMEM165 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.08 23.0 1 1 1 PRT sp|P00441|SODC_HUMAN Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.10 23.0 1 1 1 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.02 23.0 1 1 1 PRT sp|Q9Y536|PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 61-UNIMOD:35,62-UNIMOD:4 0.09 23.0 1 1 1 PRT sp|P0DMV8-2|HS71A_HUMAN Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23.0 null 494-UNIMOD:35 0.09 23.0 5 4 3 PRT sp|P52272-2|HNRPM_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.02 22.0 1 1 1 PRT sp|P00338-4|LDHA_HUMAN Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 105-UNIMOD:4 0.16 22.0 4 4 3 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|P06748-3|NPM_HUMAN Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22.0 null 21-UNIMOD:4 0.05 22.0 1 1 1 PRT sp|Q8TB52|FBX30_HUMAN F-box only protein 30 OS=Homo sapiens OX=9606 GN=FBXO30 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22.0 null 1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4 0.02 22.0 1 1 1 PRT sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 404-UNIMOD:35,410-UNIMOD:35,411-UNIMOD:4 0.09 21.0 2 2 2 PRT sp|P05387|RLA2_HUMAN 60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.11 21.0 1 1 1 PRT sp|Q09028-4|RBBP4_HUMAN Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|P08195-2|4F2_HUMAN Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21.0 null 330-UNIMOD:4 0.02 21.0 1 1 1 PRT sp|Q96A08|H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.08 21.0 1 1 1 PRT sp|O76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21.0 null 0.04 21.0 1 1 1 PRT sp|P11142-2|HSP7C_HUMAN Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|P14174|MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 81-UNIMOD:4 0.09 20.0 1 1 1 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.03 20.0 1 1 1 PRT sp|Q71UI9-5|H2AV_HUMAN Isoform 5 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.15 20.0 1 1 1 PRT sp|Q92896|GSLG1_HUMAN Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20.0 null 0.01 20.0 1 1 1 PRT sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 20.0 null 0.28 20.0 3 3 3 PRT sp|Q9NW68|BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1 PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 99-UNIMOD:4,105-UNIMOD:35 0.06 20.0 1 1 1 PRT sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20.0 null 43-UNIMOD:35 0.03 20.0 1 1 1 PRT sp|P14314-2|GLU2B_HUMAN Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 70-UNIMOD:4,77-UNIMOD:4 0.05 19.0 1 1 1 PRT sp|Q16778|H2B2E_HUMAN Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|P58876|H2B1D_HUMAN Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|P62750|RL23A_HUMAN 60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|Q9BTL3|RAMAC_HUMAN RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19.0 null 0.08 19.0 1 1 1 PRT sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 0.03 19.0 1 1 0 PRT sp|Q6ZMR3|LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 163-UNIMOD:4 0.04 19.0 1 1 0 PRT sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19.0 null 367-UNIMOD:35,369-UNIMOD:35 0.01 19.0 1 1 1 PRT sp|P43487-2|RANG_HUMAN Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 0.06 18.0 1 1 1 PRT sp|Q15366-7|PCBP2_HUMAN Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18.0 null 269-UNIMOD:35 0.03 18.0 1 1 1 PRT sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 327-UNIMOD:35 0.10 18.0 2 2 1 PRT sp|Q96T23|RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 680-UNIMOD:35,701-UNIMOD:35 0.02 18.0 1 1 1 PRT sp|P08670|VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|P06454-2|PTMA_HUMAN Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.10 17.0 1 1 1 PRT sp|Q9H832-2|UBE2Z_HUMAN Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|Q9NZT2-2|OGFR_HUMAN Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|Q15013|MD2BP_HUMAN MAD2L1-binding protein OS=Homo sapiens OX=9606 GN=MAD2L1BP PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 221-UNIMOD:4 0.03 17.0 1 1 1 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|P61313-2|RL15_HUMAN Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.07 17.0 1 1 1 PRT sp|Q7KZ85-3|SPT6H_HUMAN Isoform 3 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|P17174-2|AATC_HUMAN Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|P61326-2|MGN_HUMAN Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.08 17.0 1 1 1 PRT sp|P47895|AL1A3_HUMAN Aldehyde dehydrogenase family 1 member A3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17.0 null 0.02 17.0 1 1 1 PRT sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17.0 null 38-UNIMOD:35 0.03 17.0 1 1 1 PRT sp|P49006|MRP_HUMAN MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2 null null userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17.0 null 0.22 17.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM KEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVE 1 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 72 ms_run[2]:scan=4667 20.842 3 3203.5218 3203.5218 D K 69 105 PSM KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK 2 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 64 ms_run[2]:scan=4482 19.96 4 3493.5466 3493.5466 Q K 798 833 PSM KSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTA 3 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 64 ms_run[1]:scan=4544 20.257065585866666 3 3585.567575 3584.573499 S K 172 209 PSM KEELQANGSAPAADKEEPAAAGSGAASPSAAE 4 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 58 ms_run[2]:scan=4357 19.372 3 2981.385 2981.3850 A K 55 87 PSM KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK 5 sp|P34932|HSP74_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 58 ms_run[2]:scan=4568 20.369 3 3493.5466 3493.5466 Q K 798 833 PSM RQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHE 6 sp|P33240-2|CSTF2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 56 6-UNIMOD:35,11-UNIMOD:35 ms_run[2]:scan=4898 21.93 4 3923.7915 3923.7915 S K 482 520 PSM MRDADADAGGGADGGDGRGGHSC 7 sp|Q14657|LAGE3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 56 1-UNIMOD:1,1-UNIMOD:35,23-UNIMOD:4 ms_run[1]:scan=3387 14.9173116008 3 2218.837641 2218.835221 - R 1 24 PSM KAEAAPESQPPASEDLEVDPPVAAKD 8 sp|Q96T58|MINT_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55 ms_run[2]:scan=5044 22.591 3 2660.2817 2660.2817 Q K 1790 1816 PSM KATESGAQSAPLPMEGVDISPKQDEGVL 9 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55 14-UNIMOD:35 ms_run[2]:scan=5453 24.409 3 2869.4015 2869.4015 M K 7 35 PSM KGGAAPEGPNEAEVTSGKPEQEVPDAEEE 10 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55 ms_run[2]:scan=4767 21.328 3 2950.3316 2950.3316 A K 214 243 PSM KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK 11 sp|Q04323|UBXN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 55 ms_run[2]:scan=4892 21.906 3 3054.5298 3054.5298 K R 178 209 PSM KGEDPFTSETVDPEMEGDDNLGGEDK 12 sp|O43823|AKAP8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 15-UNIMOD:35 ms_run[2]:scan=5292 23.671 3 2826.1662 2826.1662 L K 541 567 PSM REESPMDVDQPSPSAQDTQSIASDGTPQGEKE 13 sp|Q7Z6Z7-2|HUWE1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 6-UNIMOD:35 ms_run[2]:scan=4670 20.858 3 3431.4907 3431.4907 R K 3789 3821 PSM REPSAPSIPTPAYQSSPAGGHAPTPPTPAP 14 sp|Q8WUM4|PDC6I_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 ms_run[2]:scan=5272 23.576 3 2935.4464 2935.4464 A R 715 745 PSM RPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFA 15 sp|Q15020-4|SART3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 53 30-UNIMOD:35 ms_run[2]:scan=5061 22.673 4 3404.6419 3404.6419 Q K 886 922 PSM KTVTSGSIQPVTQAPQAGQMVDTK 16 sp|Q9BXF6|RFIP5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51 20-UNIMOD:35 ms_run[2]:scan=4591 20.478 3 2487.2639 2487.2639 L R 560 584 PSM KVPTEENEMSSEADMECLNQRPPENPDTD 17 sp|Q92598-3|HS105_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51 9-UNIMOD:35,15-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=4631 20.665 3 3393.3919 3393.3919 E K 459 488 PSM REMLESAVLPPEDMSQSGPSGSHPQGP 18 sp|Q14684-2|RRP1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51 3-UNIMOD:35,14-UNIMOD:35 ms_run[2]:scan=5065 22.695 3 2851.2753 2851.2753 H R 466 493 PSM RSGASGPENFQVGSMPPAQQQITSGQMH 19 sp|Q9Y490|TLN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 51 15-UNIMOD:35,27-UNIMOD:35 ms_run[2]:scan=4911 21.986 3 2958.3349 2958.3349 M R 454 482 PSM KAAEAAAAPAESAAPAAGEEPSKEEGEP 20 sp|P80723|BASP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=4331 19.249 3 2635.2249 2635.2249 P K 121 149 PSM KDLSEVSETTESTDVKDSSEASDSAS 21 sp|P41227-2|NAA10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=4457 19.846 3 2703.173 2703.1730 S - 195 221 PSM KEASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTL 22 sp|Q8NFQ8|TOIP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=4548 20.274 3 3685.5736 3685.5736 P R 141 178 PSM KVPTEENEMSSEADMECLNQRPPENPDTD 23 sp|Q92598-3|HS105_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 15-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=4936 22.099 3 3377.397 3377.3970 E K 459 488 PSM RSPGEGPSPSPMDQPSAPSDPTDQPPAAHA 24 sp|Q9BSJ8|ESYT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 12-UNIMOD:35 ms_run[2]:scan=4506 20.07 3 2996.3206 2996.3206 E K 3 33 PSM RVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAF 25 sp|Q9UKN8|TF3C4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 50 ms_run[2]:scan=5130 22.975 4 3633.6092 3633.6092 A R 8 48 PSM MRDADADAGGGADGGDGRGGHSC 26 sp|Q14657|LAGE3_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 50 1-UNIMOD:1,23-UNIMOD:4 ms_run[1]:scan=3998 17.649620656266666 3 2202.842396 2202.840306 - R 1 24 PSM KEVEETDEMDQVELVDFDPNQER 27 sp|P31689|DNJA1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 49 9-UNIMOD:35 ms_run[2]:scan=5660 25.415 3 2809.2236 2809.2236 R R 350 373 PSM KAQETEAAPSQAPADEPEPESAAAQSQENQDTRP 28 sp|Q9UNF1-2|MAGD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 48 ms_run[2]:scan=4554 20.306 4 3577.6041 3577.6041 T K 119 153 PSM KAAAPAPEEEMDECEQALAAEPKA 29 sp|P26641|EF1G_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 11-UNIMOD:35,14-UNIMOD:4 ms_run[2]:scan=4923 22.042 3 2571.1469 2571.1469 K K 253 277 PSM KATESGAQSAPLPMEGVDISPKQDEGVL 30 sp|Q02790|FKBP4_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=5831 26.249 3 2853.4066 2853.4066 M K 7 35 PSM KEEAEAPVEDGSQPPPPEPKGDATPEGE 31 sp|Q9Y4L1|HYOU1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 47 ms_run[2]:scan=4431 19.719 3 2886.3043 2886.3043 L K 623 651 PSM KAADPVPSFDESSQDTSEKSQDCDVQC 32 sp|Q96QE3|ATAD5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 23-UNIMOD:4,27-UNIMOD:4 ms_run[2]:scan=4921 22.032 3 3029.2502 3029.2502 Q K 805 832 PSM KDSAAGGQADPPGPPLLSKPGDEDDAPP 33 sp|Q8NFD5|ARI1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 46 ms_run[2]:scan=5189 23.235 3 2698.2722 2698.2722 A K 163 191 PSM KAQTSTDAPTSAPSAPPSTPTPSAGK 34 sp|Q8IWZ8-2|SUGP1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=4182 18.526 3 2452.2082 2452.2082 Q R 98 124 PSM KDLVASVPDMQGDGEDNHMDGD 35 sp|Q14919|NC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 10-UNIMOD:35,19-UNIMOD:35 ms_run[2]:scan=4654 20.781 3 2375.9482 2375.9482 L K 84 106 PSM KPIPLPQSTPGEGDNDEEDPSKL 36 sp|Q9NZN5-2|ARHGC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=5161 23.103 3 2462.1813 2462.1813 T K 1121 1144 PSM KSEPAAEEGALVPPEPIPGTAQPVK 37 sp|Q9BZE9-3|ASPC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 45 ms_run[2]:scan=5368 24.004 3 2511.3221 2511.3221 P R 460 485 PSM KGPVPAATNGCTGDANGHLQEEPPMPTT 38 sp|Q9NPH2|INO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 45 11-UNIMOD:4,25-UNIMOD:35 ms_run[1]:scan=4662 20.819951466133332 3 2863.284843 2862.291257 K - 531 559 PSM KDLVASVPDMQGDGEDNHMDGD 39 sp|Q14919|NC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 19-UNIMOD:35 ms_run[2]:scan=5122 22.945 3 2359.9533 2359.9533 L K 84 106 PSM KEAEEEELEIPPQYQAGGSGIH 40 sp|Q5JTH9-2|RRP12_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5403 24.164 3 2410.1288 2410.1288 Q R 1099 1121 PSM KEDEEEDDDVVAPKPPIEPEEE 41 sp|Q13409-6|DC1I2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5046 22.602 3 2537.1181 2537.1181 P K 143 165 PSM KNALPPVLTTVNGQSPPEHSAPA 42 sp|Q6PKG0|LARP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5270 23.567 3 2324.2125 2324.2125 T K 129 152 PSM KPVPAAPVPSPVAPAPVPSR 43 sp|Q9UK76-3|JUPI1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=4961 22.216 3 1933.1149 1933.1149 E R 76 96 PSM KSTTPPPAEPVSLPQEPPKP 44 sp|Q9UN86-2|G3BP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 44 ms_run[2]:scan=5057 22.655 3 2096.1154 2096.1154 E R 224 244 PSM KTPVVQNAASIVQPSPAHVGQQGLS 45 sp|Q8WXI9|P66B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 43 ms_run[2]:scan=5176 23.172 3 2512.3398 2512.3398 Q K 199 224 PSM KAIGQAPSNLTMNPSNFATPQTH 46 sp|Q14686|NCOA6_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 12-UNIMOD:35 ms_run[2]:scan=5042 22.58 3 2440.1805 2440.1805 L K 1281 1304 PSM KCDITTAPGPPDQCKPPQVTC 47 sp|Q9Y2H6-2|FND3A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 2-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:4 ms_run[2]:scan=4759 21.295 3 2369.0814 2369.0814 E R 693 714 PSM KEPSITQGNTEDQGSGPSETKPVVSIS 48 sp|Q14746-2|COG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4958 22.204 3 2771.3461 2771.3461 S R 483 510 PSM KSSQQPSTPQQAPPGQPQQGTFVAH 49 sp|Q86VM9|ZCH18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4516 20.117 3 2630.2837 2630.2837 G K 789 814 PSM KTASNIIDVSAADSQGMEQHEYMD 50 sp|Q6IAA8|LTOR1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 17-UNIMOD:35,23-UNIMOD:35 ms_run[2]:scan=5040 22.57 3 2671.1378 2671.1378 A R 60 84 PSM KTETVEEPMEEEEAAKEE 51 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 9-UNIMOD:35 ms_run[2]:scan=4284 19.018 3 2122.91 2122.9100 S K 285 303 PSM RAGAEEGGQGQAAGGQQVAEQGPEPAEDGGHLASEPEVQPSD 52 sp|Q13459-2|MYO9B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 42 ms_run[2]:scan=4841 21.664 4 4096.8231 4096.8231 A R 1066 1108 PSM KAGDNIPEEQPVASTPTTVSDGENK 53 sp|Q9Y320-2|TMX2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=4626 20.643 3 2583.23 2583.2300 S K 231 256 PSM KANDDSTIPLTGAAGETLGTSEGTSAGSHP 54 sp|Q08357|S20A2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=5316 23.777 3 2841.3264 2841.3264 A R 278 308 PSM KDLVASVPDMQGDGEDNHMDGD 55 sp|Q14919|NC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 10-UNIMOD:35 ms_run[2]:scan=4855 21.734 3 2359.9533 2359.9533 L K 84 106 PSM KEYIPGQPPLSQSSDSSPTRNSEPAGLETPEA 56 sp|P07814|SYEP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 41 ms_run[2]:scan=5311 23.762 3 3368.6008 3368.6008 G K 870 902 PSM KAPVQPQQSPAAAPGGTDEKPSG 57 sp|Q13200|PSMD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 ms_run[2]:scan=3912 17.24 3 2217.1026 2217.1026 D K 8 31 PSM KQSDTPNPPAVPLQVDSTPKM 58 sp|Q9BYW2-3|SETD2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 21-UNIMOD:35 ms_run[2]:scan=5062 22.678 3 2265.1311 2265.1311 E K 96 117 PSM KSAMPIEVMMNETAQQNMENHPVI 59 sp|Q05048|CSTF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 40 4-UNIMOD:35,9-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35 ms_run[2]:scan=4957 22.199 3 2805.2442 2805.2442 A R 143 167 PSM KEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVE 60 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4451 19.817 4 3203.5218 3203.5218 D K 69 105 PSM KELEPEMEFEIEPDKEC 61 sp|Q9H307|PININ_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 7-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=5360 23.973 3 2166.9337 2166.9337 S K 423 440 PSM KQEVPVPGDGVEFPSSTGAEGQTGHPAE 62 sp|Q92618|ZN516_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5273 23.581 3 2806.3046 2806.3046 P K 681 709 PSM KTATGTQPLQPAPVTQPPKEST 63 sp|B7ZAP0|RBG10_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=4524 20.156 3 2276.2012 2276.2012 I - 232 254 PSM RAEYVPSTPSPVPPSTPLLSAHS 64 sp|Q4VCS5-2|AMOT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 ms_run[2]:scan=5544 24.849 3 2389.2278 2389.2278 Y K 424 447 PSM REGEAAAVEGPCPSQESLSQEENPEPTEDERSEE 65 sp|Q86W50|MET16_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 39 12-UNIMOD:4 ms_run[2]:scan=4881 21.853 4 3771.5926 3771.5926 L K 437 471 PSM KDINTFEQIDDYNPDTAMPAHS 66 sp|Q9UQ84-4|EXO1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 18-UNIMOD:35 ms_run[2]:scan=5494 24.606 3 2537.1016 2537.1016 N R 330 352 PSM KDLSEVSETTESTDVKDSSEASDSAS 67 sp|P41227-2|NAA10_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=4584 20.444 3 2703.173 2703.1730 S - 195 221 PSM KELSVQDQPSLSPTSLQNSSSHTTTA 68 sp|O95628-3|CNOT4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 ms_run[2]:scan=5113 22.911 3 2742.3308 2742.3308 E K 404 430 PSM KIPMTPTSSFVSPPPPTASPHSN 69 sp|Q7Z5L9-2|I2BP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 38 4-UNIMOD:35 ms_run[2]:scan=5068 22.711 3 2392.1733 2392.1733 L R 372 395 PSM KASAEGPLLGPEAAPSGEGAGSKGEAVL 70 sp|Q9BRJ6|CG050_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5397 24.136 3 2549.2973 2549.2973 K R 21 49 PSM KDGDSVMVLPTIPEEEAK 71 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 7-UNIMOD:35 ms_run[2]:scan=5362 23.98 3 1972.9663 1972.9663 W K 182 200 PSM KEPEAAAPAPGTGGDSVCGETH 72 sp|Q08379-2|GOGA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 18-UNIMOD:4 ms_run[2]:scan=4123 18.231 3 2136.9382 2136.9382 Q R 395 417 PSM KIESDVQEPTEPEDDLDIMLGNK 73 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 19-UNIMOD:35 ms_run[2]:scan=5535 24.804 3 2630.2269 2630.2269 L K 102 125 PSM KQAEPVVVLDPVSTHEPQT 74 sp|A0MZ66-7|SHOT1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 37 ms_run[2]:scan=5267 23.554 3 2073.0742 2073.0742 E K 162 181 PSM RAEYVPSTPSPVPPSTPLLSAHS 75 sp|Q4VCS5-2|AMOT_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 ms_run[2]:scan=5695 25.583 3 2389.2278 2389.2278 Y K 424 447 PSM RTVGTPIASVPGSTNTGTVPGSEKDSDSMETEE 76 sp|Q99460-2|PSMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 36 29-UNIMOD:35 ms_run[2]:scan=4912 21.99 4 3351.526 3351.5260 L K 269 302 PSM KLTEVPVEPVLTVHPES 77 sp|Q9H307|PININ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=5538 24.82 2 1873.0197 1873.0197 V K 536 553 PSM RAPTAAPPPPPPSRPSVAVPPPPPN 78 sp|O00401|WASL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 35 ms_run[2]:scan=4915 22.005 3 2463.3387 2463.3387 S R 316 341 PSM KAETEEAEEPEEDGEEHVCVSAS 79 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 19-UNIMOD:4 ms_run[2]:scan=4558 20.321 3 2560.0395 2560.0395 E K 945 968 PSM KISATEDTPEAEGEVPELYHQ 80 sp|Q96EK5|KBP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=5277 23.601 3 2342.0914 2342.0914 G R 285 306 PSM KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK 81 sp|Q04323|UBXN1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 ms_run[2]:scan=4986 22.328 3 3054.5298 3054.5298 K R 178 209 PSM RDEDPNAPPYQPPPPFTAPMEGKGS 82 sp|Q14118|DAG1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 34 20-UNIMOD:35 ms_run[2]:scan=5300 23.713 3 2710.2333 2710.2333 L R 854 879 PSM KEELQANGSAPAADKEEPAAAGSGAASPSAAE 83 sp|P29966|MARCS_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 ms_run[1]:scan=4434 19.734946190400002 3 2982.374268 2981.385017 A K 55 87 PSM MKSSVAQIKPSSGHD 84 sp|Q9HCG8|CWC22_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 34 1-UNIMOD:1,1-UNIMOD:35 ms_run[1]:scan=3963 17.483548641600002 3 1628.783243 1628.782821 - R 1 16 PSM KAPTIETVVLYTGETPSEQDQGK 85 sp|Q9BYC8|RM32_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5685 25.533 3 2490.249 2490.2490 F R 150 173 PSM KDGAPGEPPLPGAEPPLAHPGTD 86 sp|Q5PRF9|SMAG2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5212 23.335 3 2219.0859 2219.0859 A K 411 434 PSM KELVGPPLAETVFTPKTSPENVQD 87 sp|P49792|RBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5868 26.417 3 2595.3432 2595.3432 N R 1383 1407 PSM KIPENEVPAPVKPVTDSTSAPAP 88 sp|Q15811-13|ITSN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5047 22.607 3 2343.2322 2343.2322 E K 798 821 PSM KLTEVPVEPVLTVHPES 89 sp|Q9H307|PININ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=5533 24.793 3 1873.0197 1873.0197 V K 536 553 PSM KSCVEEPEPEPEAAEGDGDK 90 sp|P51858-2|HDGF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 3-UNIMOD:4 ms_run[2]:scan=4181 18.52 3 2171.9165 2171.9165 K K 99 119 PSM KSSQQPSTPQQAPPGQPQQGTFVAH 91 sp|Q86VM9|ZCH18_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4599 20.517 3 2630.2837 2630.2837 G K 789 814 PSM KTPEVPPAQPKPGVAAPPEVAPAP 92 sp|Q9Y520-3|PRC2C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 33 ms_run[2]:scan=4965 22.233 3 2344.2791 2344.2791 E K 95 119 PSM KEVTQATQPEAIPQGTNITEEKPG 93 sp|Q6W2J9-4|BCOR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=4869 21.803 3 2565.2922 2565.2922 R R 1183 1207 PSM KNALPPVLTTVNGQSPPEHSAPA 94 sp|Q6PKG0|LARP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5303 23.724 3 2324.2125 2324.2125 T K 129 152 PSM KTPEGPGNMEQIQPEGIVGSMEHPA 95 sp|Q6P6B1|ERIC5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 9-UNIMOD:35,21-UNIMOD:35 ms_run[2]:scan=5020 22.477 3 2664.216 2664.2160 H R 288 313 PSM KVPLPSADAPNQAEPDVLVEKPE 96 sp|Q8NEN9|PDZD8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5395 24.126 3 2442.2642 2442.2642 A K 598 621 PSM PALPLDQLQITHKDP 97 sp|Q9H1I8-3|ASCC2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 ms_run[2]:scan=5683 25.522 3 1684.9148 1684.9148 M K 2 17 PSM RDGMELVPQPEDSTAICQCH 98 sp|Q7Z4H8-2|PLGT3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 32 4-UNIMOD:35,17-UNIMOD:4,19-UNIMOD:4 ms_run[2]:scan=5041 22.575 3 2358.0039 2358.0039 V R 423 443 PSM KDMVTELFDPLVQGEVQH 99 sp|Q9BXV9|GON7_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 3-UNIMOD:35 ms_run[2]:scan=6237 27.999 3 2100.0198 2100.0198 M R 41 59 PSM KEVDEGPSPPEQFTAVKLSDS 100 sp|Q14331|FRG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 ms_run[2]:scan=5437 24.324 3 2259.0907 2259.0907 H R 85 106 PSM KVEPEEPSQMPPLPQSHQ 101 sp|Q8IX15|HOMEZ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 31 10-UNIMOD:35 ms_run[2]:scan=4485 19.975 3 2072.9837 2072.9837 L K 182 200 PSM KNDQDTWDYTNPNLSGQGDPGSNPNK 102 sp|P14866|HNRPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 31 ms_run[1]:scan=5218 23.35270952693333 3 2862.239625 2861.248858 F R 277 303 PSM KEGEEPTVYSDEEEPKDESA 103 sp|O00264-2|PGRC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=4423 19.687 3 2266.9601 2266.9601 L R 120 140 PSM KEPEDSTSNQQTPDSIDKDGPEEPCAES 104 sp|Q9ULJ8|NEB1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 25-UNIMOD:4 ms_run[2]:scan=4539 20.23 3 3089.2891 3089.2891 S K 301 329 PSM KTIGGGDDSFNTFFSETGAG 105 sp|P68363-2|TBA1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=6286 28.197 2 2006.8858 2006.8858 D K 40 60 PSM KTPEVPPAQPKPGVAAPPEVAPAP 106 sp|Q9Y520-3|PRC2C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 ms_run[2]:scan=5163 23.114 3 2344.2791 2344.2791 E K 95 119 PSM KVMPTVPTSQVTGPPPQPPPIR 107 sp|Q8NFD5|ARI1B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 30 3-UNIMOD:35 ms_run[2]:scan=5096 22.826 3 2339.2671 2339.2671 Q R 1569 1591 PSM KDGDVTVTNDGATILSMMDVDHQIA 108 sp|P48643|TCPE_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 29 17-UNIMOD:35,18-UNIMOD:35 ms_run[2]:scan=5579 25.019 3 2677.2211 2677.2211 D K 64 89 PSM KEDEEDEEDDDVSHVDEEDCLGVQ 109 sp|O75381|PEX14_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 20-UNIMOD:4 ms_run[1]:scan=5078 22.7530260048 3 2835.092249 2834.083217 D R 323 347 PSM KEDLPAENGETKTEESPASDEAGE 110 sp|P05114|HMGN1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 29 ms_run[1]:scan=4313 19.161654841066664 3 2533.086566 2532.098731 T K 71 95 PSM KAMGIMNSFVNDIFE 111 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=6451 28.882 2 1746.7957 1746.7957 S R 58 73 PSM KTAFQEALDAAGD 112 sp|P10599-2|THIO_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5946 26.764 2 1335.6307 1335.6307 S K 8 21 PSM RPDNFVFGQSGAGNNWA 113 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5986 26.955 2 1835.8339 1835.8339 F K 86 103 PSM RSSGPYGGGGQYFA 114 sp|P09651-3|ROA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5119 22.93 2 1402.6266 1402.6266 G K 231 245 PSM RTVGTPIASVPGSTNTGTVPGSEKDSDSMETEE 115 sp|Q99460-2|PSMD1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 28 ms_run[2]:scan=5075 22.737 3 3335.5311 3335.5311 L K 269 302 PSM KAETEEAEEPEEDGEEHVCVSAS 116 sp|P46821|MAP1B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 19-UNIMOD:4 ms_run[2]:scan=4440 19.763 3 2560.0395 2560.0395 E K 945 968 PSM KDMQPSMESDMALVKDMELPTE 117 sp|P27816-5|MAP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 3-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:35,17-UNIMOD:35 ms_run[2]:scan=5043 22.586 3 2588.1002 2588.1002 A K 290 312 PSM KEALQDVEDENQ 118 sp|P62258-2|1433E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4525 20.16 2 1416.6369 1416.6369 N - 222 234 PSM KGAFGDAPATEQPPLPPPAPH 119 sp|O75182-2|SIN3B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5197 23.265 3 2094.0534 2094.0534 E K 713 734 PSM KIEDVPAPSTSADKVESLDVDSEA 120 sp|P49321-2|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5296 23.692 3 2501.2021 2501.2021 D K 20 44 PSM KNALPPVLTTVNGQSPPEHSAPA 121 sp|Q6PKG0|LARP1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5407 24.184 3 2324.2125 2324.2125 T K 129 152 PSM KNLQTVNVDEN 122 sp|P62899|RL31_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4251 18.86 2 1272.631 1272.6310 F - 115 126 PSM KSVTEQGAELSNEE 123 sp|P63104|1433Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=4373 19.45 2 1519.7002 1519.7002 M R 27 41 PSM RGGGGNFGPGPGSNF 124 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 ms_run[2]:scan=5135 23 2 1376.6222 1376.6222 S R 201 216 PSM TMPVNGAHKDADLWSSHD 125 sp|P34896-3|GLYC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 27 1-UNIMOD:1,2-UNIMOD:35 ms_run[2]:scan=5032 22.534 3 2037.8851 2037.8851 M K 2 20 PSM KDLVASVPDMQGDGEDNHMDGD 126 sp|Q14919|NC2A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 27 10-UNIMOD:35,19-UNIMOD:35 ms_run[1]:scan=4700 21.008914700533335 3 2375.951130 2375.948185 L K 84 106 PSM KEPEAAAPAPGTGGDSVCGETH 127 sp|Q08379-2|GOGA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 18-UNIMOD:4 ms_run[2]:scan=4207 18.65 3 2136.9382 2136.9382 Q R 395 417 PSM KPAEQAEETAPIEATATKEEEGSS 128 sp|Q8N4Q1|MIA40_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=4734 21.179 3 2502.1609 2502.1609 K - 119 143 PSM KQQQPPPPPPQPPQIPEGSADGEPKP 129 sp|Q9UGU0-2|TCF20_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5014 22.459 3 2740.382 2740.3820 K K 1552 1578 PSM RNPDDITNEEYGEFY 130 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5753 25.866 2 1860.7802 1860.7802 T K 299 314 PSM RNPDDITQEEYGEFY 131 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 26 ms_run[2]:scan=5789 26.04 2 1874.7959 1874.7959 T K 291 306 PSM KEAATQEDPEQLPELEAHGVSESEGEE 132 sp|Q9BVJ6|UT14A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 26 ms_run[1]:scan=5350 23.927249392533334 3 2938.309347 2937.299950 T R 385 412 PSM KDATNVGDEGGFAPNILEN 133 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5821 26.2 2 1959.9174 1959.9174 G K 202 221 PSM KEDEEEDDDVVAPKPPIEPEEE 134 sp|Q13409-6|DC1I2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5137 23.006 3 2537.1181 2537.1181 P K 143 165 PSM RGALQNIIPASTGAA 135 sp|P04406-2|G3P_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5536 24.809 2 1438.7892 1438.7892 G K 158 173 PSM RLLDSLEPPGEPGPSTNIPENDTVDGREE 136 sp|Q92734-4|TFG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 25 ms_run[2]:scan=5673 25.479 3 3132.4847 3132.4847 N K 118 147 PSM RTTPSYVAFTDTE 137 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 25 ms_run[1]:scan=5342 23.8920475376 2 1486.695696 1486.693989 N R 36 49 PSM KDLFDPIIED 138 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=6191 27.809 2 1203.6023 1203.6023 F R 86 96 PSM KDSYVGDEAQS 139 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=3845 16.941 2 1197.515 1197.5150 Q K 50 61 PSM KEAMEDGEIDGN 140 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 4-UNIMOD:35 ms_run[2]:scan=3636 16.019 2 1322.5296 1322.5296 A K 627 639 PSM KEVDEQMLNVQN 141 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 7-UNIMOD:35 ms_run[2]:scan=4327 19.228 2 1461.677 1461.6770 M K 324 336 PSM KIPMTPTSSFVSPPPPTASPHSN 142 sp|Q7Z5L9-2|I2BP2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5298 23.703 3 2376.1784 2376.1784 L R 372 395 PSM RAILVDLEPGTMDSV 143 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 12-UNIMOD:35 ms_run[2]:scan=5900 26.566 2 1630.8236 1630.8236 P R 62 77 PSM RNPDDITNEEYGEFY 144 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=7005 31.044 2 1860.7802 1860.7802 T K 299 314 PSM RTATESFASDPILY 145 sp|P14618-2|KPYM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 24 ms_run[2]:scan=5896 26.544 2 1569.7675 1569.7675 V R 92 106 PSM KSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTA 146 sp|O15355|PPM1G_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 24 ms_run[1]:scan=4582 20.432962339466666 4 3585.5692 3584.5732 S K 172 209 PSM KEPPAPAQQLQPQPVAVQGPEPARVE 147 sp|Q9HC07|TM165_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5101 22.852 3 2760.4559 2760.4559 N K 44 70 PSM KGDGPVQGIINFEQ 148 sp|P00441|SODC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5903 26.578 2 1500.7573 1500.7573 L K 10 24 PSM KGFGFVDFNSEEDA 149 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=6161 27.686 2 1560.6733 1560.6733 S K 610 624 PSM KLMIEMDGTEN 150 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=4395 19.553 2 1311.5687 1311.5687 D K 92 103 PSM RGVVDSEDLPLNIS 151 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5849 26.326 2 1512.7784 1512.7784 I R 378 392 PSM RGYISPYFINTS 152 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5851 26.336 2 1416.7038 1416.7038 D K 221 233 PSM RIIPGFMCQGGDFT 153 sp|Q9Y536|PAL4A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 7-UNIMOD:35,8-UNIMOD:4 ms_run[2]:scan=5704 25.627 2 1613.733 1613.7330 H R 55 69 PSM RTTPSYVAFTDTE 154 sp|P0DMV8-2|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 23 ms_run[2]:scan=5361 23.976 2 1486.694 1486.6940 N R 36 49 PSM KADLINNLGTIA 155 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5788 26.035 2 1241.698 1241.6980 T K 95 107 PSM KAGFAGDDAP 156 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4298 19.083 2 947.43486 947.4349 C R 18 28 PSM KDAGVIAGLNVL 157 sp|P0DMV8-2|HS71A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=6200 27.849 2 1168.6816 1168.6816 T R 104 116 PSM KDSYVGDEAQS 158 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=3650 16.076 2 1197.515 1197.5150 Q K 50 61 PSM KNALESYAFNM 159 sp|P0DMV8-2|HS71A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 11-UNIMOD:35 ms_run[2]:scan=5499 24.629 2 1302.5914 1302.5914 A K 484 495 PSM KQGGGGGGGSVPGIE 160 sp|P52272-2|HNRPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4436 19.746 2 1255.6157 1255.6157 A R 349 364 PSM KVTLTSEEEA 161 sp|P00338-4|LDHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4311 19.149 2 1105.5503 1105.5503 V R 247 257 PSM RELISNSSDALD 162 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4919 22.021 2 1318.6365 1318.6365 L K 46 58 PSM RGTGGVDTAAVGGVFDVSNAD 163 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=5766 25.931 2 1963.9235 1963.9235 K R 320 341 PSM RLQSIGTENTEEN 164 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 ms_run[2]:scan=4257 18.892 2 1489.7009 1489.7009 K R 43 56 PSM RPQNYLFGCEL 165 sp|P06748-3|NPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 22 9-UNIMOD:4 ms_run[2]:scan=6068 27.303 2 1395.6605 1395.6605 L K 13 24 PSM RELISNASDALD 166 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 ms_run[1]:scan=5104 22.864564781333335 2 1302.642645 1302.641559 L K 102 114 PSM KVEPEEPSQMPPLPQSHQ 167 sp|Q8IX15|HOMEZ_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 10-UNIMOD:35 ms_run[1]:scan=4468 19.898384657333335 3 2072.982564 2072.983706 L K 182 200 PSM MEEELQHSHCVNCVSR 168 sp|Q8TB52|FBX30_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 22 1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4 ms_run[1]:scan=4468 19.898384657333335 3 2071.849920 2071.850994 - R 1 17 PSM KAMGIMNSFVNDIFE 169 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=6680 29.836 2 1746.7957 1746.7957 S R 58 73 PSM KEITALAPSTM 170 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 11-UNIMOD:35 ms_run[2]:scan=6779 30.252 2 1176.606 1176.6060 Q K 315 326 PSM KIGGIGTVPVG 171 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=5148 23.052 2 996.59678 996.5968 Y R 255 266 PSM KNIEDVIAQGIG 172 sp|P05387|RLA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6076 27.335 2 1255.6772 1255.6772 G K 49 61 PSM KPVSPLLLASGMA 173 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 12-UNIMOD:35 ms_run[2]:scan=5733 25.768 2 1298.7268 1298.7268 D R 196 209 PSM KSGDAAIVDMVPGKPMCVESFSDYPPLG 174 sp|Q5VTE0|EF1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 10-UNIMOD:35,16-UNIMOD:35,17-UNIMOD:4 ms_run[2]:scan=5887 26.505 3 2998.3762 2998.3762 L R 395 423 PSM KTPSSDVLVFDYT 175 sp|Q09028-4|RBBP4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 ms_run[2]:scan=6052 27.24 2 1470.7242 1470.7242 T K 108 121 PSM RVIGSGCNLDSA 176 sp|P00338-4|LDHA_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 7-UNIMOD:4 ms_run[2]:scan=4555 20.312 2 1247.5928 1247.5928 N R 99 111 PSM RWCSWSLSQA 177 sp|P08195-2|4F2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 21 3-UNIMOD:4 ms_run[2]:scan=5792 26.053 2 1279.5768 1279.5768 N R 328 338 PSM RLLLPGELA 178 sp|Q96A08|H2B1A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=5872 26.43553260266667 2 980.602129 980.601866 V K 101 110 PSM KATNESEDEIPQLVPIGK 179 sp|O76021|RL1D1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 21 ms_run[1]:scan=5726 25.734012284533332 3 1968.007509 1967.021136 V K 356 374 PSM KDAGTIAGLNVL 180 sp|P11142-2|HSP7C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5975 26.906 2 1170.6608 1170.6608 T R 159 171 PSM KDSTLIMQLL 181 sp|P63104|1433Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 7-UNIMOD:35 ms_run[2]:scan=6398 28.661 2 1176.6424 1176.6424 Y R 212 222 PSM KEITALAPSTM 182 sp|P63261|ACTG_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 11-UNIMOD:35 ms_run[2]:scan=6206 27.871 2 1176.606 1176.6060 Q K 315 326 PSM KESYSVYVY 183 sp|P62807|H2B1C_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5335 23.859 2 1136.539 1136.5390 R K 35 44 PSM KLLCGLLAE 184 sp|P14174|MIF_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 4-UNIMOD:4 ms_run[2]:scan=5879 26.47 2 1015.5736 1015.5736 S R 78 87 PSM KSADTLWDIQ 185 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5817 26.178 2 1175.5823 1175.5823 K K 319 329 PSM RAGLQFPVG 186 sp|Q71UI9-5|H2AV_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5522 24.742 2 943.52395 943.5240 Q R 23 32 PSM RFPGQLNADL 187 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5557 24.912 2 1129.588 1129.5880 L R 241 251 PSM RGGAGAGGGW 188 sp|Q92896|GSLG1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=4338 19.28 2 844.394 844.3940 R K 101 111 PSM RIINEPTAAAIAYGLD 189 sp|P0DMV8-2|HS71A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=6031 27.151 2 1686.8941 1686.8941 L R 116 132 PSM RISGLIYEET 190 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 20 ms_run[2]:scan=5400 24.149 2 1179.6136 1179.6136 K R 46 56 PSM KTIDCDVITLMGTPSGTAEPYDGTKA 191 sp|Q9NW68|BSDC1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 5-UNIMOD:4,11-UNIMOD:35 ms_run[1]:scan=5440 24.3397153752 3 2757.296774 2756.288463 D R 95 121 PSM RDEDPNAPPYQPPPPFTAPMEGKGS 192 sp|Q14118|DAG1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 20-UNIMOD:35 ms_run[1]:scan=5394 24.120294157866667 3 2710.237644 2710.233331 L R 854 879 PSM KDVLGPSTVVANSDESQLLTPGKMSQ 193 sp|Q9BZF1|OSBL8_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 20 24-UNIMOD:35 ms_run[1]:scan=5539 24.825330877333332 3 2716.364061 2716.358926 S R 20 46 PSM KDGDSVMVLPTIPEEEAK 194 sp|P30041|PRDX6_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5724 25.723 3 1956.9714 1956.9714 W K 182 200 PSM KDGSDEPGTAACPNGSFHCTNTGY 195 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 12-UNIMOD:4,19-UNIMOD:4 ms_run[2]:scan=4749 21.255 3 2542.0125 2542.0125 C K 59 83 PSM KDQLIYNLL 196 sp|P00338-4|LDHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6427 28.782 2 1118.6336 1118.6336 L K 5 14 PSM KESYSIYVY 197 sp|Q16778|H2B2E_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5565 24.949 2 1150.5546 1150.5546 R K 35 44 PSM KIDTIEIITD 198 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5649 25.361 2 1159.6336 1159.6336 G R 125 135 PSM KQGTAVEVEAESLDPTVKPVDVGGDEPEE 199 sp|P49321|NASP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5629 25.263 3 3023.4459 3023.4459 E K 288 317 PSM KSADTLWGIQ 200 sp|P00338-4|LDHA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5737 25.786 2 1117.5768 1117.5768 K K 260 270 PSM KVLTPELYAEL 201 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=6099 27.427 2 1274.7122 1274.7122 A R 32 43 PSM PEPTKSAPAP 202 sp|P58876|H2B1D_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=3664 16.139 2 993.51311 993.5131 M K 2 12 PSM RGGNFGFGDS 203 sp|P22626-2|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5063 22.684 2 1012.4363 1012.4363 G R 191 201 PSM RLAPDYDALDVAN 204 sp|P62750|RL23A_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5501 24.64 2 1431.6994 1431.6994 V K 139 152 PSM RWGWPSDN 205 sp|Q9BTL3|RAMAC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 19 ms_run[2]:scan=5525 24.757 2 1016.4464 1016.4464 N R 70 78 PSM KADLINNLGTIA 206 sp|Q58FF8|H90B2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 ms_run[1]:scan=5782 26.006683405866667 2 1241.700575 1241.697952 T K 95 107 PSM RVIGSGCNLDSA 207 sp|Q6ZMR3|LDH6A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 7-UNIMOD:4 ms_run[1]:scan=4532 20.1963284896 2 1247.594209 1247.592835 N R 157 169 PSM RFGSGMNMG 208 sp|P52272|HNRPM_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 19 6-UNIMOD:35,8-UNIMOD:35 ms_run[1]:scan=3509 15.482151583466667 2 987.390610 987.390236 G R 362 371 PSM KTLEEDEEELF 209 sp|P43487-2|RANG_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=6114 27.488 2 1380.6297 1380.6297 I K 39 50 PSM RNYYEQWG 210 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=5593 25.087 2 1114.4832 1114.4832 L K 26 34 PSM RQMSGAQI 211 sp|Q15366-7|PCBP2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 3-UNIMOD:35 ms_run[2]:scan=3733 16.438 2 905.4389 905.4389 I K 267 275 PSM RTTPSYVAFTDTE 212 sp|P0DMV8-2|HS71A_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 18 ms_run[2]:scan=7015 31.08 2 1486.694 1486.6940 N R 36 49 PSM RNMGGPYGGGNYGPGGSGGSGGYGG 213 sp|P22626|ROA2_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 3-UNIMOD:35 ms_run[1]:scan=4706 21.0410394512 3 2205.901022 2204.892993 S R 325 350 PSM RTLYGFGG 214 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=5314 23.771236072533334 2 869.439889 869.439552 G - 96 104 PSM KVEMDNLDNAQTSGIEEPSETKGSMQ 215 sp|Q96T23|RSF1_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 4-UNIMOD:35,25-UNIMOD:35 ms_run[1]:scan=4625 20.637456788 3 2869.265296 2869.259348 T K 677 703 PSM RQQYESVAA 216 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 ms_run[1]:scan=4080 18.015790895733335 2 1051.517213 1050.509423 V K 273 282 PSM KGPVPAATNGCTGDANGHLQEEPPMPTT 217 sp|Q9NPH2|INO1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 18 11-UNIMOD:4,25-UNIMOD:35 ms_run[1]:scan=4701 21.014266755466668 3 2864.281038 2862.291257 K - 531 559 PSM KAMGIMNSFVNDIFE 218 sp|P62807|H2B1C_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 3-UNIMOD:35,6-UNIMOD:35 ms_run[2]:scan=6892 30.664 2 1746.7957 1746.7957 S R 58 73 PSM KEVVEEAENG 219 sp|P06454-2|PTMA_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=3829 16.862 2 1102.5142 1102.5142 K R 21 31 PSM KVFLENVI 220 sp|P62805|H4_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6069 27.309 2 960.56442 960.5644 L R 60 68 PSM RFNPNFY 221 sp|Q9H832-2|UBE2Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5357 23.961 2 956.45045 956.4505 V R 68 75 PSM RFQNLNW 222 sp|Q9NZT2-2|OGFR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5636 25.297 2 976.4879 976.4879 K R 199 206 PSM RNCGEDWF 223 sp|Q15013|MD2BP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 3-UNIMOD:4 ms_run[2]:scan=5659 25.41 2 1082.424 1082.4240 H R 219 227 PSM RNLLSVAY 224 sp|P63104|1433Z_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5632 25.28 2 934.52362 934.5236 E K 41 49 PSM RNYYEQWG 225 sp|P22626-2|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5237 23.436 2 1114.4832 1114.4832 L K 26 34 PSM RQIDNPDY 226 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4247 18.842 2 1019.4672 1019.4672 P K 278 286 PSM RSLQSVAEE 227 sp|P61313-2|RL15_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4318 19.183 2 1017.5091 1017.5091 A R 96 105 PSM RSSGPYGGGGQYFA 228 sp|P09651-3|ROA1_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=6882 30.632 2 1402.6266 1402.6266 G K 231 245 PSM RVWQWDE 229 sp|Q7KZ85-3|SPT6H_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5574 24.992 2 1017.4668 1017.4668 W K 395 402 PSM RWYNGTNN 230 sp|P17174-2|AATC_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=4428 19.706 2 1023.4522 1023.4522 A K 101 109 PSM RYANNSNY 231 sp|P61326-2|MGN_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=3787 16.675 2 1000.4363 1000.4363 L K 33 41 PSM RYFAGWAD 232 sp|P47895|AL1A3_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001583, MaxQuant, ] 17 ms_run[2]:scan=5581 25.026 2 984.44537 984.4454 L K 142 150 PSM RTLTIVDTGIGMT 233 sp|Q58FG1|HS904_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 12-UNIMOD:35 ms_run[1]:scan=5498 24.623444733600003 2 1392.729057 1392.728266 D K 27 40 PSM KSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA 234 sp|P49006|MRP_HUMAN 1 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1001476, X!Tandem, ] 17 ms_run[1]:scan=5073 22.7279261416 4 3975.8122 3974.8252 V K 35 77 PSM RNYYEQWG 235 sp|P22626|ROA2_HUMAN 0 userFasta.sprot_human_20201019 userFasta.sprot_human_20201019 [MS, MS:1002251, Comet, ] 17 ms_run[1]:scan=6697 29.905490625866666 2 1114.483771 1114.483208 L K 38 46