MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F32.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F32.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UKY7-2|CDV3_HUMAN	Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	91.0	null		0.23	91.0	2	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	72.0	null	241-UNIMOD:4	0.13	72.0	3	2	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	70.0	null		0.06	70.0	6	1	0
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69.0	null		0.03	69.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	68.0	null		0.22	68.0	3	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	67.0	null		0.20	67.0	7	3	0
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	67.0	null		0.06	67.0	2	1	0
PRT	sp|Q8IYD1|ERF3B_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67.0	null	93-UNIMOD:4	0.05	67.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67.0	null	523-UNIMOD:4	0.06	67.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	65.0	null	296-UNIMOD:35	0.07	65.0	2	1	0
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	65.0	null	74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4	0.09	65.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63.0	null	4661-UNIMOD:35,4686-UNIMOD:35	0.01	63.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	63.0	null	218-UNIMOD:35	0.29	63.0	6	3	1
PRT	sp|Q9NYV4-2|CDK12_HUMAN	Isoform 2 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62.0	null		0.02	62.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62.0	null		0.18	62.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62.0	null	254-UNIMOD:4	0.04	62.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	62.0	null		0.04	62.0	2	1	0
PRT	sp|Q8N806|UBR7_HUMAN	Putative E3 ubiquitin-protein ligase UBR7 OS=Homo sapiens OX=9606 GN=UBR7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null	260-UNIMOD:4	0.08	61.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.03	61.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.10	61.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	61.0	null	178-UNIMOD:35,182-UNIMOD:35,186-UNIMOD:4,189-UNIMOD:4	0.07	61.0	3	1	0
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null	31-UNIMOD:4	0.05	61.0	2	2	2
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60.0	null	59-UNIMOD:4	0.05	60.0	1	1	1
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.06	60.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.07	60.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60.0	null	23-UNIMOD:4,31-UNIMOD:35	0.06	60.0	4	1	0
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null	343-UNIMOD:35	0.05	59.0	2	2	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.09	59.0	1	1	1
PRT	sp|Q9BYJ9-2|YTHD1_HUMAN	Isoform 2 of YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.19	59.0	1	1	1
PRT	sp|O00330-3|ODPX_HUMAN	Isoform 3 of Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.06	59.0	1	1	1
PRT	sp|Q9Y6K1-3|DNM3A_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null	78-UNIMOD:35	0.34	59.0	2	2	2
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.01	59.0	1	1	1
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	59.0	null		0.03	59.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null	2202-UNIMOD:4,1159-UNIMOD:35	0.04	58.0	5	4	3
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null	963-UNIMOD:4,1448-UNIMOD:35	0.04	58.0	5	4	3
PRT	sp|Q96AY4|TTC28_HUMAN	Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.01	58.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null	61-UNIMOD:35,73-UNIMOD:35	0.04	58.0	2	1	0
PRT	sp|Q7Z4R8|CF120_HUMAN	UPF0669 protein C6orf120 OS=Homo sapiens OX=9606 GN=C6orf120 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.15	58.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null	503-UNIMOD:35	0.09	58.0	3	2	1
PRT	sp|Q96JG8-3|MAGD4_HUMAN	Isoform 3 of Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null		0.08	58.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58.0	null	53-UNIMOD:35	0.04	58.0	3	1	0
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58.0	null	374-UNIMOD:4,93-UNIMOD:4	0.05	58.0	3	2	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	58.0	null	20-UNIMOD:35	0.06	58.0	2	1	0
PRT	sp|Q92734-4|TFG_HUMAN	Isoform 4 of Protein TFG OS=Homo sapiens OX=9606 GN=TFG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	161-UNIMOD:35,165-UNIMOD:35	0.09	57.0	1	1	1
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.04	57.0	3	3	3
PRT	sp|Q9UKA9-5|PTBP2_HUMAN	Isoform 5 of Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	32-UNIMOD:35,35-UNIMOD:35	0.09	57.0	1	1	0
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.02	57.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	369-UNIMOD:35,359-UNIMOD:35,36-UNIMOD:35	0.10	57.0	6	2	0
PRT	sp|Q9NW82|WDR70_HUMAN	WD repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=WDR70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	25-UNIMOD:35	0.05	57.0	1	1	1
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57.0	null		0.04	57.0	1	1	1
PRT	sp|Q9Y535|RPC8_HUMAN	DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens OX=9606 GN=POLR3H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57.0	null		0.15	57.0	1	1	1
PRT	sp|Q9Y520-3|PRC2C_HUMAN	Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.02	56.0	2	2	2
PRT	sp|P10636-2|TAU_HUMAN	Isoform Fetal-tau of Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.07	56.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.14	56.0	2	2	2
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	1757-UNIMOD:4	0.01	56.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.08	56.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	297-UNIMOD:35	0.07	56.0	4	3	2
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	306-UNIMOD:35	0.05	56.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56.0	null		0.05	56.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.05	55.0	1	1	1
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null		0.15	55.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	55.0	null		0.25	55.0	2	1	0
PRT	sp|Q9UHC6-2|CNTP2_HUMAN	Isoform 2 of Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	89-UNIMOD:35	0.27	55.0	1	1	1
PRT	sp|Q49AR2|CE022_HUMAN	UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	195-UNIMOD:4	0.07	55.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	205-UNIMOD:4,206-UNIMOD:4,227-UNIMOD:35	0.09	55.0	1	1	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	2489-UNIMOD:35,1314-UNIMOD:35	0.02	55.0	3	2	1
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	202-UNIMOD:4	0.08	55.0	2	2	2
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null	75-UNIMOD:35,85-UNIMOD:4,77-UNIMOD:35	0.09	54.0	4	2	1
PRT	sp|Q9NWU1-2|OXSM_HUMAN	Isoform 2 of 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.08	54.0	1	1	0
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	70-UNIMOD:4,77-UNIMOD:4	0.05	54.0	1	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	305-UNIMOD:35,313-UNIMOD:35,257-UNIMOD:4,272-UNIMOD:4,283-UNIMOD:35,325-UNIMOD:35,269-UNIMOD:35	0.23	54.0	8	5	2
PRT	sp|Q14746-2|COG2_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.04	54.0	1	1	1
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	210-UNIMOD:35	0.07	54.0	2	1	0
PRT	sp|Q9BSJ2-3|GCP2_HUMAN	Isoform 2 of Gamma-tubulin complex component 2 OS=Homo sapiens OX=9606 GN=TUBGCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.03	54.0	1	1	1
PRT	sp|Q8IVW6-3|ARI3B_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.06	54.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	199-UNIMOD:35	0.05	54.0	1	1	1
PRT	sp|P28070|PSB4_HUMAN	Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	115-UNIMOD:35	0.09	54.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null	468-UNIMOD:35,480-UNIMOD:35	0.03	54.0	8	3	2
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null	131-UNIMOD:35	0.19	54.0	3	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	634-UNIMOD:35,148-UNIMOD:4,149-UNIMOD:35,219-UNIMOD:35,221-UNIMOD:35,92-UNIMOD:35	0.15	54.0	6	4	2
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	560-UNIMOD:35,571-UNIMOD:35	0.04	54.0	1	1	1
PRT	sp|Q2KHR3|QSER1_HUMAN	Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54.0	null		0.02	54.0	1	1	0
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.25	53.0	2	2	2
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.03	53.0	2	2	2
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.04	53.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	65-UNIMOD:35	0.04	53.0	6	1	0
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.01	53.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	228-UNIMOD:4	0.03	53.0	1	1	1
PRT	sp|Q2KHR3-2|QSER1_HUMAN	Isoform 2 of Glutamine and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=QSER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.02	53.0	1	1	0
PRT	sp|Q4VCS5-2|AMOT_HUMAN	Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	380-UNIMOD:35,402-UNIMOD:35	0.04	53.0	2	1	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	467-UNIMOD:35	0.06	53.0	2	1	0
PRT	sp|P10746|HEM4_HUMAN	Uroporphyrinogen-III synthase OS=Homo sapiens OX=9606 GN=UROS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	241-UNIMOD:4	0.11	53.0	1	1	1
PRT	sp|Q96PK6-5|RBM14_HUMAN	Isoform 5 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.09	53.0	1	1	1
PRT	sp|Q96K58|ZN668_HUMAN	Zinc finger protein 668 OS=Homo sapiens OX=9606 GN=ZNF668 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	518-UNIMOD:4	0.05	53.0	1	1	1
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	1115-UNIMOD:4	0.04	53.0	3	2	1
PRT	sp|Q96DT7-3|ZBT10_HUMAN	Isoform 3 of Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.07	53.0	2	2	2
PRT	sp|Q8WWY3|PRP31_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.06	53.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.05	52.0	1	1	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.10	52.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	970-UNIMOD:35	0.08	52.0	3	3	3
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	693-UNIMOD:35	0.19	52.0	7	5	4
PRT	sp|Q9BY67-5|CADM1_HUMAN	Isoform 5 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.07	52.0	1	1	0
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.11	52.0	1	1	1
PRT	sp|Q5T0F9-3|C2D1B_HUMAN	Isoform 3 of Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.05	52.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	52.0	null	396-UNIMOD:35	0.06	52.0	4	3	2
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	123-UNIMOD:4	0.08	52.0	2	2	1
PRT	sp|Q96N67-7|DOCK7_HUMAN	Isoform 7 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	523-UNIMOD:4,109-UNIMOD:35	0.10	52.0	3	3	3
PRT	sp|Q12830-4|BPTF_HUMAN	Isoform 4 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.02	52.0	2	2	2
PRT	sp|P38398-8|BRCA1_HUMAN	Isoform 8 of Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	484-UNIMOD:35,499-UNIMOD:35	0.02	52.0	1	1	1
PRT	sp|Q9UJX2-3|CDC23_HUMAN	Isoform 3 of Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.06	52.0	1	1	1
PRT	sp|Q7Z6L1-3|TCPR1_HUMAN	Isoform 3 of Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.04	52.0	1	1	1
PRT	sp|Q7Z569-2|BRAP_HUMAN	Isoform 2 of BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	387-UNIMOD:35	0.08	52.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52.0	null	680-UNIMOD:35,701-UNIMOD:35	0.02	52.0	1	1	0
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	27-UNIMOD:4,42-UNIMOD:4,47-UNIMOD:4	0.22	51.0	2	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.02	51.0	2	2	2
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	24-UNIMOD:35,32-UNIMOD:35	0.10	51.0	3	2	1
PRT	sp|Q96RU2-2|UBP28_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	706-UNIMOD:35	0.03	51.0	2	1	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	216-UNIMOD:35,121-UNIMOD:35,127-UNIMOD:35,131-UNIMOD:4,134-UNIMOD:4	0.14	51.0	3	2	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	353-UNIMOD:4	0.07	51.0	2	2	2
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.02	51.0	2	2	2
PRT	sp|Q96RQ3|MCCA_HUMAN	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	170-UNIMOD:35,190-UNIMOD:4	0.04	51.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	449-UNIMOD:35	0.02	51.0	1	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null		0.08	51.0	4	2	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.07	51.0	1	1	1
PRT	sp|P51610-4|HCFC1_HUMAN	Isoform 4 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	503-UNIMOD:35,1930-UNIMOD:4,1939-UNIMOD:4,1504-UNIMOD:35	0.03	51.0	4	3	2
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.15	51.0	2	2	2
PRT	sp|Q9UNM6|PSD13_HUMAN	26S proteasome non-ATPase regulatory subunit 13 OS=Homo sapiens OX=9606 GN=PSMD13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	1-UNIMOD:35	0.06	51.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	116-UNIMOD:35	0.10	51.0	1	1	1
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.13	51.0	1	1	1
PRT	sp|Q9NX14|NDUBB_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	137-UNIMOD:35,141-UNIMOD:4	0.17	51.0	4	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	468-UNIMOD:35,479-UNIMOD:35,214-UNIMOD:35	0.10	51.0	3	3	3
PRT	sp|O60271-9|JIP4_HUMAN	Isoform 6 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	1139-UNIMOD:35	0.02	51.0	1	1	1
PRT	sp|Q96SU4-5|OSBL9_HUMAN	Isoform 5 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.05	51.0	1	1	1
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	20-UNIMOD:35	0.14	51.0	1	1	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	232-UNIMOD:4,55-UNIMOD:35	0.12	51.0	2	2	2
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.04	50.0	2	2	2
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	274-UNIMOD:35	0.03	50.0	2	1	0
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.02	50.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	91-UNIMOD:4,188-UNIMOD:35	0.19	50.0	3	2	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.07	50.0	2	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	101-UNIMOD:4	0.04	50.0	1	1	1
PRT	sp|Q12873-2|CHD3_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.01	50.0	1	1	1
PRT	sp|O95628-3|CNOT4_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.05	50.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	40-UNIMOD:35,55-UNIMOD:35	0.12	50.0	12	3	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	181-UNIMOD:4,190-UNIMOD:4	0.05	50.0	2	2	2
PRT	sp|Q15334|L2GL1_HUMAN	Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	697-UNIMOD:4,703-UNIMOD:35	0.02	50.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	441-UNIMOD:35,446-UNIMOD:35,609-UNIMOD:35,613-UNIMOD:35,620-UNIMOD:35	0.07	50.0	8	4	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.04	50.0	3	1	0
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.31	50.0	2	2	2
PRT	sp|Q6W2J9-3|BCOR_HUMAN	Isoform 3 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.03	50.0	1	1	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	39-UNIMOD:35,643-UNIMOD:35	0.05	50.0	2	2	2
PRT	sp|Q9UPQ9-1|TNR6B_HUMAN	Isoform 2 of Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.02	50.0	1	1	1
PRT	sp|Q92567-3|F168A_HUMAN	Isoform 3 of Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	66-UNIMOD:4	0.22	50.0	1	1	1
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.09	50.0	2	2	2
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	284-UNIMOD:35,288-UNIMOD:4	0.11	50.0	7	2	0
PRT	sp|Q8TF68-3|ZN384_HUMAN	Isoform 3 of Zinc finger protein 384 OS=Homo sapiens OX=9606 GN=ZNF384	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.06	50.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.03	50.0	3	2	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	195-UNIMOD:35	0.14	50.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	145-UNIMOD:35,146-UNIMOD:35,37-UNIMOD:35	0.28	50.0	4	2	1
PRT	sp|Q9Y467-3|SALL2_HUMAN	Isoform 2 of Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	15-UNIMOD:4,34-UNIMOD:4	0.14	50.0	1	1	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	674-UNIMOD:35,682-UNIMOD:35,684-UNIMOD:4	0.03	50.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	123-UNIMOD:35	0.03	50.0	2	2	2
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null	233-UNIMOD:35,239-UNIMOD:4	0.06	50.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null		0.01	50.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	50.0	null		0.11	50.0	4	2	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	50.0	null		0.02	50.0	2	2	2
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	1380-UNIMOD:35	0.04	49.0	4	3	2
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.13	49.0	1	1	1
PRT	sp|P51553|IDH3G_HUMAN	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	356-UNIMOD:35,361-UNIMOD:35	0.08	49.0	1	1	1
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	19-UNIMOD:4	0.03	49.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	1	1	1
PRT	sp|Q96A26|F162A_HUMAN	Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	91-UNIMOD:35	0.13	49.0	2	1	0
PRT	sp|Q7Z2Z2-2|EFL1_HUMAN	Isoform 2 of Elongation factor-like GTPase 1 OS=Homo sapiens OX=9606 GN=EFL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	870-UNIMOD:4,883-UNIMOD:4	0.03	49.0	1	1	1
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.03	49.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	1	1	1
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	358-UNIMOD:35	0.06	49.0	2	1	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	1113-UNIMOD:4,1917-UNIMOD:35	0.02	49.0	5	2	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.06	49.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	771-UNIMOD:4,784-UNIMOD:4,790-UNIMOD:35	0.02	49.0	2	2	2
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	87-UNIMOD:35	0.07	49.0	1	1	1
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	87-UNIMOD:35,163-UNIMOD:4,166-UNIMOD:35	0.14	49.0	4	2	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	88-UNIMOD:35	0.03	49.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	815-UNIMOD:35,822-UNIMOD:35,834-UNIMOD:35	0.03	49.0	2	1	0
PRT	sp|O43395-3|PRPF3_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	94-UNIMOD:35,103-UNIMOD:35,61-UNIMOD:35	0.20	49.0	3	2	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	305-UNIMOD:4	0.05	49.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	235-UNIMOD:35,262-UNIMOD:4,345-UNIMOD:35	0.11	49.0	3	2	1
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	1724-UNIMOD:35,1726-UNIMOD:35	0.02	49.0	2	2	2
PRT	sp|Q9BX40-3|LS14B_HUMAN	Isoform 3 of Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	112-UNIMOD:35	0.19	49.0	2	2	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	76-UNIMOD:35,82-UNIMOD:35	0.16	49.0	3	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	461-UNIMOD:35,296-UNIMOD:4	0.12	49.0	4	4	4
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.13	49.0	4	3	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	25-UNIMOD:35	0.01	49.0	2	1	0
PRT	sp|A0A2Z4LIS9|FXO3B_HUMAN	Forkhead box protein O3B OS=Homo sapiens OX=9606 GN=FOXO3B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	141-UNIMOD:35	0.12	49.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	1180-UNIMOD:35	0.04	49.0	2	2	2
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	138-UNIMOD:35	0.06	49.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.04	48.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	759-UNIMOD:35,645-UNIMOD:35,647-UNIMOD:4	0.01	48.0	4	2	0
PRT	sp|Q99961|SH3G1_HUMAN	Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	121-UNIMOD:35	0.06	48.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	959-UNIMOD:35	0.01	48.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	563-UNIMOD:35,102-UNIMOD:4	0.09	48.0	4	4	4
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	775-UNIMOD:35	0.02	48.0	2	1	0
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.03	48.0	2	1	0
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	827-UNIMOD:35	0.02	48.0	2	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	555-UNIMOD:4,1010-UNIMOD:4,1016-UNIMOD:4	0.04	48.0	2	2	2
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	396-UNIMOD:4,405-UNIMOD:4,210-UNIMOD:35,213-UNIMOD:35	0.11	48.0	2	2	2
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	1546-UNIMOD:35	0.02	48.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	376-UNIMOD:4	0.04	48.0	3	3	3
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.01	48.0	2	2	2
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	431-UNIMOD:4,448-UNIMOD:4	0.02	48.0	1	1	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.07	48.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	691-UNIMOD:4	0.04	48.0	2	2	2
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	3040-UNIMOD:35	0.02	48.0	2	2	2
PRT	sp|Q99504-2|EYA3_HUMAN	Isoform 2 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	378-UNIMOD:35	0.05	48.0	2	1	0
PRT	sp|Q69YN4-3|VIR_HUMAN	Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	1412-UNIMOD:4,1413-UNIMOD:4,1420-UNIMOD:35	0.02	48.0	1	1	1
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	1	1	1
PRT	sp|Q9HCD5|NCOA5_HUMAN	Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	497-UNIMOD:35	0.07	48.0	2	1	0
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	30-UNIMOD:35	0.08	48.0	1	1	1
PRT	sp|P20648|ATP4A_HUMAN	Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=2 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	385-UNIMOD:4	0.03	48.0	1	1	1
PRT	sp|Q96HA1-2|P121A_HUMAN	Isoform 2 of Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.15	47.0	2	2	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.00	47.0	1	1	1
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|Q9UHB6-3|LIMA1_HUMAN	Isoform 3 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	14-UNIMOD:4	0.04	47.0	1	1	1
PRT	sp|Q96RR1|PEO1_HUMAN	Twinkle protein, mitochondrial OS=Homo sapiens OX=9606 GN=TWNK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	667-UNIMOD:4	0.04	47.0	1	1	1
PRT	sp|Q96EK5|KBP_HUMAN	KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.04	47.0	1	1	1
PRT	sp|Q5SSJ5-5|HP1B3_HUMAN	Isoform 4 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.32	47.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	161-UNIMOD:4	0.08	47.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	420-UNIMOD:35,1346-UNIMOD:35,1347-UNIMOD:35,1350-UNIMOD:35	0.02	47.0	2	2	2
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.08	47.0	1	1	1
PRT	sp|Q92888-2|ARHG1_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.04	47.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	404-UNIMOD:35,411-UNIMOD:4,410-UNIMOD:35	0.09	47.0	5	2	1
PRT	sp|Q9P2D3-3|HTR5B_HUMAN	Isoform 3 of HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.01	47.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2813-UNIMOD:35,2019-UNIMOD:35	0.01	47.0	2	2	2
PRT	sp|P98174|FGD1_HUMAN	FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	75-UNIMOD:4,93-UNIMOD:4	0.01	47.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	100-UNIMOD:4	0.23	47.0	1	1	1
PRT	sp|P11171-4|EPB41_HUMAN	Isoform 4 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.11	47.0	4	3	2
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	660-UNIMOD:4	0.02	47.0	1	1	1
PRT	sp|Q16850-2|CP51A_HUMAN	Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	303-UNIMOD:4	0.06	47.0	2	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null		0.04	47.0	3	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	2	1	0
PRT	sp|Q8IWZ8-2|SUGP1_HUMAN	Isoform 2 of SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.12	46.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	678-UNIMOD:4,607-UNIMOD:35	0.04	46.0	2	2	2
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9ULI0-2|ATD2B_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	1026-UNIMOD:4	0.03	46.0	2	2	2
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	518-UNIMOD:35	0.04	46.0	2	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	1	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	568-UNIMOD:35	0.04	46.0	3	2	1
PRT	sp|Q9H8H0|NOL11_HUMAN	Nucleolar protein 11 OS=Homo sapiens OX=9606 GN=NOL11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	539-UNIMOD:35,557-UNIMOD:4,560-UNIMOD:4	0.04	46.0	1	1	1
PRT	sp|Q9P2J5-2|SYLC_HUMAN	Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	444-UNIMOD:35,454-UNIMOD:35,461-UNIMOD:35,323-UNIMOD:35	0.05	46.0	6	3	1
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|Q03188|CENPC_HUMAN	Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	663-UNIMOD:4	0.02	46.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	681-UNIMOD:35	0.02	46.0	1	1	1
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	579-UNIMOD:35	0.04	46.0	2	1	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	186-UNIMOD:4	0.19	46.0	3	2	1
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	472-UNIMOD:35	0.05	46.0	2	2	2
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	2	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.11	46.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	690-UNIMOD:35	0.04	46.0	3	2	1
PRT	sp|Q86XL3-2|ANKL2_HUMAN	Isoform 2 of Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	203-UNIMOD:4	0.08	46.0	3	2	1
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.01	46.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	54-UNIMOD:35	0.05	46.0	2	2	2
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	85-UNIMOD:35	0.10	46.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	2	2	2
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2289-UNIMOD:35,2300-UNIMOD:4	0.01	46.0	1	1	1
PRT	sp|P07947|YES_HUMAN	Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	42-UNIMOD:4	0.06	46.0	1	1	1
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	720-UNIMOD:35,718-UNIMOD:35,627-UNIMOD:35	0.04	46.0	6	2	0
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	469-UNIMOD:35,470-UNIMOD:35	0.05	46.0	3	2	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null		0.05	46.0	2	2	2
PRT	sp|O14880|MGST3_HUMAN	Microsomal glutathione S-transferase 3 OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null	43-UNIMOD:35,56-UNIMOD:4	0.15	46.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null		0.04	45.0	4	2	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1243-UNIMOD:35	0.02	45.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	2	2	2
PRT	sp|Q15750-2|TAB1_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.11	45.0	2	2	1
PRT	sp|Q9UQ84-4|EXO1_HUMAN	Isoform 2 of Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	347-UNIMOD:35	0.05	45.0	2	2	2
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	2	1	0
PRT	sp|Q9BV44|THUM3_HUMAN	THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	208-UNIMOD:4	0.05	45.0	1	1	1
PRT	sp|O75717-2|WDHD1_HUMAN	Isoform 2 of WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q96Q07-3|BTBD9_HUMAN	Isoform 3 of BTB/POZ domain-containing protein 9 OS=Homo sapiens OX=9606 GN=BTBD9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	1	1	1
PRT	sp|Q9NZ32|ARP10_HUMAN	Actin-related protein 10 OS=Homo sapiens OX=9606 GN=ACTR10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	199-UNIMOD:35	0.06	45.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	2	1	0
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	2	2	2
PRT	sp|Q9UPN3-5|MACF1_HUMAN	Isoform 4 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2231-UNIMOD:35,2864-UNIMOD:4	0.01	45.0	3	2	1
PRT	sp|P48029|SC6A8_HUMAN	Sodium- and chloride-dependent creatine transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|Q9NPH2-2|INO1_HUMAN	Isoform 2 of Inositol-3-phosphate synthase 1 OS=Homo sapiens OX=9606 GN=ISYNA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	413-UNIMOD:4,427-UNIMOD:35	0.07	45.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	171-UNIMOD:4,176-UNIMOD:35,357-UNIMOD:4	0.09	45.0	2	2	2
PRT	sp|O96005-3|CLPT1_HUMAN	Isoform 2 of Cleft lip and palate transmembrane protein 1 OS=Homo sapiens OX=9606 GN=CLPTM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	179-UNIMOD:35	0.08	45.0	2	2	2
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	457-UNIMOD:35	0.02	45.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	293-UNIMOD:35	0.04	45.0	6	2	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	131-UNIMOD:4	0.02	45.0	2	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	237-UNIMOD:4	0.10	45.0	2	2	2
PRT	sp|Q9Y4E8-4|UBP15_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	55-UNIMOD:35	0.12	45.0	1	1	1
PRT	sp|Q9BQ95-3|ECSIT_HUMAN	Isoform 3 of Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial OS=Homo sapiens OX=9606 GN=ECSIT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.26	45.0	3	2	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|O95429-2|BAG4_HUMAN	Isoform 2 of BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	179-UNIMOD:35	0.06	45.0	1	1	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	226-UNIMOD:35,228-UNIMOD:35,229-UNIMOD:4	0.10	45.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	719-UNIMOD:35	0.03	45.0	1	1	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2431-UNIMOD:35	0.01	45.0	1	1	1
PRT	sp|Q7Z7C8|TAF8_HUMAN	Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	117-UNIMOD:35	0.08	45.0	1	1	1
PRT	sp|Q01826|SATB1_HUMAN	DNA-binding protein SATB1 OS=Homo sapiens OX=9606 GN=SATB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	458-UNIMOD:35	0.03	45.0	1	1	1
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	335-UNIMOD:4	0.07	45.0	2	2	2
PRT	sp|Q5T5C0|STXB5_HUMAN	Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.02	45.0	2	1	0
PRT	sp|Q68EM7|RHG17_HUMAN	Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	364-UNIMOD:35	0.06	45.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	92-UNIMOD:35,102-UNIMOD:4	0.20	44.0	7	2	1
PRT	sp|Q96KG9-5|SCYL1_HUMAN	Isoform 5 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	512-UNIMOD:4	0.07	44.0	2	2	2
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.12	44.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	2	2	2
PRT	sp|Q13428-5|TCOF_HUMAN	Isoform 5 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	1	1	1
PRT	sp|P30154-5|2AAB_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|Q96I24-2|FUBP3_HUMAN	Isoform 2 of Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	65-UNIMOD:4,136-UNIMOD:35,138-UNIMOD:35	0.18	44.0	5	2	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	277-UNIMOD:35,290-UNIMOD:4,292-UNIMOD:35,140-UNIMOD:4	0.06	44.0	2	2	2
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	589-UNIMOD:35	0.02	44.0	4	2	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	267-UNIMOD:35	0.13	44.0	12	4	0
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	1065-UNIMOD:35	0.06	44.0	6	3	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.19	44.0	1	1	0
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	169-UNIMOD:35	0.22	44.0	4	2	1
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	540-UNIMOD:35,547-UNIMOD:4	0.03	44.0	4	3	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1265-UNIMOD:4	0.02	44.0	1	1	1
PRT	sp|Q9ULK5|VANG2_HUMAN	Vang-like protein 2 OS=Homo sapiens OX=9606 GN=VANGL2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	297-UNIMOD:4	0.08	44.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	151-UNIMOD:35	0.05	44.0	2	1	0
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.10	44.0	1	1	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	1	1	1
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	378-UNIMOD:4,396-UNIMOD:35	0.05	44.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	246-UNIMOD:4	0.02	44.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	1	1	1
PRT	sp|Q9UPT9|UBP22_HUMAN	Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	12-UNIMOD:35,23-UNIMOD:4	0.05	44.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	502-UNIMOD:35	0.04	44.0	2	1	0
PRT	sp|Q96L91-3|EP400_HUMAN	Isoform 3 of E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	3	3	3
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	91-UNIMOD:35,88-UNIMOD:35	0.08	44.0	3	1	0
PRT	sp|Q8TEU7-5|RPGF6_HUMAN	Isoform 5 of Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	3	2	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.07	44.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.03	44.0	1	1	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	179-UNIMOD:35	0.02	43.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	4346-UNIMOD:35,4348-UNIMOD:35,938-UNIMOD:35	0.01	43.0	4	2	1
PRT	sp|Q9Y320-2|TMX2_HUMAN	Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.10	43.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	3	1	0
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	292-UNIMOD:35,296-UNIMOD:35,300-UNIMOD:35,306-UNIMOD:35	0.05	43.0	7	2	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.01	43.0	3	1	0
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	2	2
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.15	43.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	434-UNIMOD:35	0.04	43.0	1	1	1
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	1	1	1
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	199-UNIMOD:35,209-UNIMOD:35,215-UNIMOD:35,78-UNIMOD:4	0.12	43.0	2	2	2
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q9HC07-2|TM165_HUMAN	Isoform 2 of Transmembrane protein 165 OS=Homo sapiens OX=9606 GN=TMEM165	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.08	43.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q96F07-2|CYFP2_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 2 OS=Homo sapiens OX=9606 GN=CYFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	198-UNIMOD:35,212-UNIMOD:35,123-UNIMOD:35	0.03	43.0	3	2	0
PRT	sp|Q9NUQ6-2|SPS2L_HUMAN	Isoform 2 of SPATS2-like protein OS=Homo sapiens OX=9606 GN=SPATS2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	338-UNIMOD:35,353-UNIMOD:35	0.04	43.0	2	1	0
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	162-UNIMOD:35,173-UNIMOD:35	0.10	43.0	1	1	1
PRT	sp|Q9BRG1|VPS25_HUMAN	Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	49-UNIMOD:35,52-UNIMOD:35	0.13	43.0	1	1	1
PRT	sp|P18583-6|SON_HUMAN	Isoform E of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	290-UNIMOD:35	0.02	43.0	3	2	1
PRT	sp|Q99536-3|VAT1_HUMAN	Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.08	43.0	3	2	1
PRT	sp|Q9H6R7-3|WDCP_HUMAN	Isoform 3 of WD repeat and coiled-coil-containing protein OS=Homo sapiens OX=9606 GN=WDCP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	226-UNIMOD:4,227-UNIMOD:4,233-UNIMOD:35	0.11	43.0	1	1	1
PRT	sp|Q9HD20-2|AT131_HUMAN	Isoform B of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	3	2	1
PRT	sp|Q9UET6-2|TRM7_HUMAN	Isoform 2 of Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	276-UNIMOD:4	0.07	43.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	565-UNIMOD:35	0.11	43.0	2	2	2
PRT	sp|Q15418-3|KS6A1_HUMAN	Isoform 3 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	480-UNIMOD:35,483-UNIMOD:4	0.04	43.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	43-UNIMOD:4	0.02	43.0	1	1	1
PRT	sp|P10321-2|HLAC_HUMAN	Isoform 2 of HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.08	43.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	220-UNIMOD:35	0.07	43.0	1	1	1
PRT	sp|Q9C0B7|TNG6_HUMAN	Transport and Golgi organization protein 6 homolog OS=Homo sapiens OX=9606 GN=TANGO6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	286-UNIMOD:4,293-UNIMOD:35	0.02	43.0	1	1	1
PRT	sp|Q8IX01-4|SUGP2_HUMAN	Isoform 4 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	0
PRT	sp|O96013-3|PAK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	123-UNIMOD:4	0.08	43.0	1	1	1
PRT	sp|Q9NXX6|NSE4A_HUMAN	Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q9ULH7-2|MRTFB_HUMAN	Isoform 2 of Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q96CU9-2|FXRD1_HUMAN	Isoform 2 of FAD-dependent oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FOXRED1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	1	1	1
PRT	sp|Q15398-1|DLGP5_HUMAN	Isoform 2 of Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	615-UNIMOD:4	0.03	43.0	1	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	1	1	0
PRT	sp|Q9UKA9|PTBP2_HUMAN	Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	32-UNIMOD:35,35-UNIMOD:35	0.06	43.0	1	1	0
PRT	sp|P62491|RB11A_HUMAN	Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	189-UNIMOD:35	0.11	43.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	263-UNIMOD:35,266-UNIMOD:4	0.08	42.0	2	2	2
PRT	sp|Q15370|ELOB_HUMAN	Elongin-B OS=Homo sapiens OX=9606 GN=ELOB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:4	0.19	42.0	2	1	0
PRT	sp|P56545|CTBP2_HUMAN	C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:4	0.04	42.0	1	1	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	467-UNIMOD:35	0.04	42.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	277-UNIMOD:4,2586-UNIMOD:35,2602-UNIMOD:4	0.02	42.0	4	4	4
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	59-UNIMOD:4	0.10	42.0	1	1	1
PRT	sp|P56182|RRP1_HUMAN	Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	349-UNIMOD:4	0.05	42.0	1	1	1
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q96KA5-2|CLP1L_HUMAN	Isoform 2 of Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens OX=9606 GN=CLPTM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	14-UNIMOD:35	0.03	42.0	1	1	1
PRT	sp|Q5VTB9-3|RN220_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	204-UNIMOD:4	0.07	42.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	1	1	1
PRT	sp|P18085|ARF4_HUMAN	ADP-ribosylation factor 4 OS=Homo sapiens OX=9606 GN=ARF4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	134-UNIMOD:35,139-UNIMOD:35	0.13	42.0	1	1	1
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	101-UNIMOD:4	0.09	42.0	1	1	1
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	362-UNIMOD:35,410-UNIMOD:35,425-UNIMOD:35	0.08	42.0	3	2	1
PRT	sp|Q9HB09-3|B2L12_HUMAN	Isoform 3 of Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|Q5TFE4-2|NT5D1_HUMAN	Isoform 2 of 5'-nucleotidase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NT5DC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|Q8NBF6-2|AVL9_HUMAN	Isoform 2 of Late secretory pathway protein AVL9 homolog OS=Homo sapiens OX=9606 GN=AVL9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	66-UNIMOD:4	0.05	42.0	1	1	1
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.14	42.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	90-UNIMOD:35,95-UNIMOD:4,596-UNIMOD:35	0.03	42.0	3	3	3
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	2	2	2
PRT	sp|Q9Y265-2|RUVB1_HUMAN	Isoform 2 of RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	94-UNIMOD:4,96-UNIMOD:35	0.05	42.0	1	1	1
PRT	sp|O43390|HNRPR_HUMAN	Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.10	42.0	3	3	3
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	456-UNIMOD:35	0.04	42.0	1	1	1
PRT	sp|Q9Y485|DMXL1_HUMAN	DmX-like protein 1 OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.01	42.0	2	1	0
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	388-UNIMOD:35	0.03	42.0	1	1	1
PRT	sp|P42574|CASP3_HUMAN	Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	170-UNIMOD:4,182-UNIMOD:35,184-UNIMOD:4	0.08	42.0	1	1	1
PRT	sp|O60256-4|KPRB_HUMAN	Isoform 4 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	1	0
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	592-UNIMOD:35	0.03	42.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	236-UNIMOD:35,86-UNIMOD:35,415-UNIMOD:35	0.10	42.0	4	3	1
PRT	sp|Q96SB3|NEB2_HUMAN	Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	2	2	2
PRT	sp|Q9P003|CNIH4_HUMAN	Protein cornichon homolog 4 OS=Homo sapiens OX=9606 GN=CNIH4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	93-UNIMOD:35,87-UNIMOD:35	0.15	42.0	4	1	0
PRT	sp|Q63HK5|TSH3_HUMAN	Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q9BR61|ACBD6_HUMAN	Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ACBD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	111-UNIMOD:35	0.07	41.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.11	41.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	400-UNIMOD:4,401-UNIMOD:35	0.03	41.0	2	1	0
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	2	2	2
PRT	sp|Q5U5X0|LYRM7_HUMAN	Complex III assembly factor LYRM7 OS=Homo sapiens OX=9606 GN=LYRM7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	97-UNIMOD:4	0.18	41.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P43243-2|MATR3_HUMAN	Isoform 2 of Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	631-UNIMOD:35	0.03	41.0	2	1	0
PRT	sp|Q8WWK9-6|CKAP2_HUMAN	Isoform 4 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	500-UNIMOD:35	0.03	41.0	2	1	0
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	99-UNIMOD:4,102-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	93-UNIMOD:35,104-UNIMOD:35	0.09	41.0	1	1	1
PRT	sp|P04921-2|GLPC_HUMAN	Isoform Glycophorin-D of Glycophorin-C OS=Homo sapiens OX=9606 GN=GYPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.26	41.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	362-UNIMOD:4,258-UNIMOD:35	0.05	41.0	2	2	2
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	119-UNIMOD:4	0.02	41.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	3	2	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	239-UNIMOD:35,244-UNIMOD:35,247-UNIMOD:4	0.02	41.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	522-UNIMOD:35,140-UNIMOD:4,146-UNIMOD:4	0.09	41.0	3	3	3
PRT	sp|Q14119|VEZF1_HUMAN	Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.04	41.0	2	1	0
PRT	sp|Q86YQ8-2|CPNE8_HUMAN	Isoform 2 of Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.18	41.0	2	2	2
PRT	sp|Q9Y4F1|FARP1_HUMAN	FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.23	41.0	1	1	1
PRT	sp|Q05048|CSTF1_HUMAN	Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	146-UNIMOD:35,151-UNIMOD:35,152-UNIMOD:35,160-UNIMOD:35	0.06	41.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	0
PRT	sp|Q9HAF1-2|EAF6_HUMAN	Isoform 2 of Chromatin modification-related protein MEAF6 OS=Homo sapiens OX=9606 GN=MEAF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.13	41.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	199-UNIMOD:4	0.08	41.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	1126-UNIMOD:35,527-UNIMOD:35,697-UNIMOD:4,1076-UNIMOD:4,1080-UNIMOD:35	0.05	41.0	6	4	2
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.14	41.0	1	1	1
PRT	sp|Q6P6B1|ERIC5_HUMAN	Glutamate-rich protein 5 OS=Homo sapiens OX=9606 GN=ERICH5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	179-UNIMOD:35,185-UNIMOD:4	0.02	41.0	4	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	1	1	1
PRT	sp|Q8NEU8-2|DP13B_HUMAN	Isoform 2 of DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2469-UNIMOD:4,4030-UNIMOD:4,4097-UNIMOD:35	0.01	41.0	4	3	2
PRT	sp|O00401|WASL_HUMAN	Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	2	2	2
PRT	sp|Q12907|LMAN2_HUMAN	Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	271-UNIMOD:35	0.08	41.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	249-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	1113-UNIMOD:4	0.01	41.0	3	2	0
PRT	sp|Q9Y315|DEOC_HUMAN	Deoxyribose-phosphate aldolase OS=Homo sapiens OX=9606 GN=DERA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null	118-UNIMOD:4	0.08	41.0	1	1	1
PRT	sp|Q6PK81-2|ZN773_HUMAN	Isoform 2 of Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	313-UNIMOD:35,323-UNIMOD:4,324-UNIMOD:4	0.02	40.0	1	1	0
PRT	sp|Q7L266|ASGL1_HUMAN	Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	97-UNIMOD:4	0.07	40.0	1	1	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	447-UNIMOD:35	0.01	40.0	1	1	1
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	220-UNIMOD:35	0.04	40.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	125-UNIMOD:35,76-UNIMOD:35	0.09	40.0	2	2	2
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q92797-2|SYMPK_HUMAN	Isoform 2 of Symplekin OS=Homo sapiens OX=9606 GN=SYMPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	2	1	0
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	116-UNIMOD:35	0.06	40.0	2	1	0
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	349-UNIMOD:35	0.05	40.0	1	1	1
PRT	sp|Q9NW64-2|RBM22_HUMAN	Isoform 2 of Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q86U42-2|PABP2_HUMAN	Isoform 2 of Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	147-UNIMOD:35,149-UNIMOD:35,161-UNIMOD:35,167-UNIMOD:35	0.09	40.0	2	1	0
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|Q9NP97|DLRB1_HUMAN	Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	34-UNIMOD:35,46-UNIMOD:35	0.23	40.0	1	1	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	41-UNIMOD:4	0.08	40.0	1	1	1
PRT	sp|Q9C0D5-2|TANC1_HUMAN	Isoform 2 of Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|O43264|ZW10_HUMAN	Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	690-UNIMOD:35	0.05	40.0	5	2	0
PRT	sp|Q6ZNB6-2|NFXL1_HUMAN	Isoform 2 of NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	253-UNIMOD:4,257-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	170-UNIMOD:35	0.07	40.0	3	1	0
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q8TD30-2|ALAT2_HUMAN	Isoform 2 of Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	223-UNIMOD:35	0.06	40.0	1	1	1
PRT	sp|P52630-4|STAT2_HUMAN	Isoform 2 of Signal transducer and activator of transcription 2 OS=Homo sapiens OX=9606 GN=STAT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	106-UNIMOD:35	0.14	40.0	2	1	0
PRT	sp|P53992|SC24C_HUMAN	Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|P47985|UCRI_HUMAN	Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	126-UNIMOD:35	0.09	40.0	7	1	0
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	237-UNIMOD:35	0.06	40.0	2	2	2
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q6UUV9-3|CRTC1_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	188-UNIMOD:35	0.04	40.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|O95793|STAU1_HUMAN	Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	523-UNIMOD:4	0.08	40.0	2	2	2
PRT	sp|Q7Z333|SETX_HUMAN	Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	1110-UNIMOD:4,1123-UNIMOD:4,1652-UNIMOD:35	0.02	40.0	2	2	2
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	229-UNIMOD:4	0.14	40.0	3	2	1
PRT	sp|Q8IX01|SUGP2_HUMAN	SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	1	1	0
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	677-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|P04908|H2A1B_HUMAN	Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.16	40.0	1	1	1
PRT	sp|Q92793|CBP_HUMAN	CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	1-UNIMOD:35	0.15	40.0	1	1	1
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	229-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q53RE8|ANR39_HUMAN	Ankyrin repeat domain-containing protein 39 OS=Homo sapiens OX=9606 GN=ANKRD39 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	1	1	1
PRT	sp|Q9P2K5-4|MYEF2_HUMAN	Isoform 4 of Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.20	39.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	710-UNIMOD:35	0.02	39.0	1	1	0
PRT	sp|Q96Q15-2|SMG1_HUMAN	Isoform 2 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|Q15025-7|TNIP1_HUMAN	Isoform 7 of TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	604-UNIMOD:4,610-UNIMOD:4	0.02	39.0	1	1	0
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	3	2	1
PRT	sp|Q96S66-4|CLCC1_HUMAN	Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	60-UNIMOD:4,67-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	507-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q96JJ7|TMX3_HUMAN	Protein disulfide-isomerase TMX3 OS=Homo sapiens OX=9606 GN=TMX3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q8WY54|PPM1E_HUMAN	Protein phosphatase 1E OS=Homo sapiens OX=9606 GN=PPM1E PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9UI36|DACH1_HUMAN	Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	2	2	2
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	1	0
PRT	sp|Q92558|WASF1_HUMAN	Wiskott-Aldrich syndrome protein family member 1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|P38432|COIL_HUMAN	Coilin OS=Homo sapiens OX=9606 GN=COIL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P28066-2|PSA5_HUMAN	Isoform 2 of Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	170-UNIMOD:35	0.13	39.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P40692-2|MLH1_HUMAN	Isoform 2 of DNA mismatch repair protein Mlh1 OS=Homo sapiens OX=9606 GN=MLH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q2M3G4-2|SHRM1_HUMAN	Isoform 2 of Protein Shroom1 OS=Homo sapiens OX=9606 GN=SHROOM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9C091-3|GRB1L_HUMAN	Isoform 3 of GREB1-like protein OS=Homo sapiens OX=9606 GN=GREB1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1077-UNIMOD:4,1084-UNIMOD:35	0.01	39.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|Q9Y6N7-6|ROBO1_HUMAN	Isoform 6 of Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q9GZN2|TGIF2_HUMAN	Homeobox protein TGIF2 OS=Homo sapiens OX=9606 GN=TGIF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|Q6ZVH7-3|ESPNL_HUMAN	Isoform 3 of Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	590-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	1	0
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	3	2	1
PRT	sp|Q96IU4-2|ABHEB_HUMAN	Isoform 2 of Protein ABHD14B OS=Homo sapiens OX=9606 GN=ABHD14B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	126-UNIMOD:35	0.13	39.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q8TAA5|GRPE2_HUMAN	GrpE protein homolog 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	126-UNIMOD:4	0.09	39.0	1	1	1
PRT	sp|Q15291-2|RBBP5_HUMAN	Isoform 2 of Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	5	4	3
PRT	sp|Q3KQV9-2|UAP1L_HUMAN	Isoform 2 of UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Homo sapiens OX=9606 GN=UAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	98-UNIMOD:35,108-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q9BQE9-2|BCL7B_HUMAN	Isoform 2 of B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.19	39.0	1	1	1
PRT	sp|P16083|NQO2_HUMAN	Ribosyldihydronicotinamide dehydrogenase [quinone] OS=Homo sapiens OX=9606 GN=NQO2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	1	1	1
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	72-UNIMOD:35,75-UNIMOD:35	0.10	39.0	1	1	1
PRT	sp|Q6ZRS2-3|SRCAP_HUMAN	Isoform 3 of Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q5T8P6-5|RBM26_HUMAN	Isoform 5 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9UBZ4|APEX2_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Homo sapiens OX=9606 GN=APEX2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	468-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q8N8A6|DDX51_HUMAN	ATP-dependent RNA helicase DDX51 OS=Homo sapiens OX=9606 GN=DDX51 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q15257-4|PTPA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|Q9H7X3|ZN696_HUMAN	Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q96L73-2|NSD1_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	957-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	228-UNIMOD:35,242-UNIMOD:35,243-UNIMOD:35,292-UNIMOD:35,296-UNIMOD:35,300-UNIMOD:35	0.04	39.0	3	2	0
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	254-UNIMOD:4	0.08	39.0	3	2	1
PRT	sp|Q9ULU4|PKCB1_HUMAN	Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|Q12972|PP1R8_HUMAN	Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PPP1R8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|O43251-6|RFOX2_HUMAN	Isoform 6 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q71RC2-2|LARP4_HUMAN	Isoform 2 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.19	38.0	1	1	1
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q96QZ7-4|MAGI1_HUMAN	Isoform 4 of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q3B7T1-3|EDRF1_HUMAN	Isoform 2 of Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|A0JNW5|UH1BL_HUMAN	UHRF1-binding protein 1-like OS=Homo sapiens OX=9606 GN=UHRF1BP1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9BUK6-7|MSTO1_HUMAN	Isoform 7 of Protein misato homolog 1 OS=Homo sapiens OX=9606 GN=MSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	262-UNIMOD:35	0.05	38.0	2	1	0
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1018-UNIMOD:4	0.02	38.0	3	2	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	261-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|O94855|SC24D_HUMAN	Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q96EK7-2|F120B_HUMAN	Isoform 2 of Constitutive coactivator of peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=FAM120B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	546-UNIMOD:35,547-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q5T7V8-2|GORAB_HUMAN	Isoform 2 of RAB6-interacting golgin OS=Homo sapiens OX=9606 GN=GORAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	18-UNIMOD:35	0.04	38.0	1	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	9	1	0
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q03164-2|KMT2A_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1208-UNIMOD:35	0.04	38.0	2	2	2
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|Q9NZ72-2|STMN3_HUMAN	Isoform 2 of Stathmin-3 OS=Homo sapiens OX=9606 GN=STMN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	59-UNIMOD:35	0.18	38.0	2	2	2
PRT	sp|Q96H35|RBM18_HUMAN	Probable RNA-binding protein 18 OS=Homo sapiens OX=9606 GN=RBM18 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	2	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9BRJ2|RM45_HUMAN	39S ribosomal protein L45, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL45 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	281-UNIMOD:35	0.08	38.0	1	1	1
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	169-UNIMOD:35	0.10	38.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	14-UNIMOD:35,17-UNIMOD:35	0.08	38.0	2	1	0
PRT	sp|Q9UBP6|TRMB_HUMAN	tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|Q15555-2|MARE2_HUMAN	Isoform 2 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	678-UNIMOD:4,679-UNIMOD:35,2-UNIMOD:1	0.05	38.0	2	2	2
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P57737-2|CORO7_HUMAN	Isoform 2 of Coronin-7 OS=Homo sapiens OX=9606 GN=CORO7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	2706-UNIMOD:4	0.01	38.0	3	1	0
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	70-UNIMOD:4,77-UNIMOD:4	0.05	38.0	1	1	0
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q12968|NFAC3_HUMAN	Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|O96007|MOC2B_HUMAN	Molybdopterin synthase catalytic subunit OS=Homo sapiens OX=9606 GN=MOCS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q9H9B1-4|EHMT1_HUMAN	Isoform 4 of Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|O43493-6|TGON2_HUMAN	Isoform 6 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	1	1	1
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|O14787-2|TNPO2_HUMAN	Isoform 2 of Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	346-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|Q9HCI7-2|MSL2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MSL2 OS=Homo sapiens OX=9606 GN=MSL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	1	1	1
PRT	sp|Q5VT52-2|RPRD2_HUMAN	Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	2	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	363-UNIMOD:35,299-UNIMOD:35,300-UNIMOD:35,303-UNIMOD:4	0.13	37.0	5	3	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	103-UNIMOD:35	0.11	37.0	1	1	1
PRT	sp|P78332-2|RBM6_HUMAN	Isoform 2 of RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2988-UNIMOD:4,3330-UNIMOD:35	0.02	37.0	4	4	4
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	660-UNIMOD:4	0.02	37.0	2	2	1
PRT	sp|O15381-3|NVL_HUMAN	Isoform 3 of Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	0
PRT	sp|Q8IX15|HOMEZ_HUMAN	Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	191-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|O43299-3|AP5Z1_HUMAN	Isoform 3 of AP-5 complex subunit zeta-1 OS=Homo sapiens OX=9606 GN=AP5Z1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q9C0B0|UNK_HUMAN	RING finger protein unkempt homolog OS=Homo sapiens OX=9606 GN=UNK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	100-UNIMOD:4,106-UNIMOD:4	0.02	37.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	9-UNIMOD:35,19-UNIMOD:35,162-UNIMOD:4	0.18	37.0	2	2	2
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	238-UNIMOD:4	0.16	37.0	3	2	0
PRT	sp|Q7Z4H8-2|PLGT3_HUMAN	Isoform 2 of Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	426-UNIMOD:35,439-UNIMOD:4,441-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q5JRA6-3|TGO1_HUMAN	Isoform 3 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	401-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|Q8NEZ4-2|KMT2C_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	3242-UNIMOD:35,1108-UNIMOD:35	0.01	37.0	2	2	2
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	2	1	0
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|O75170-6|PP6R2_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	415-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|Q68CP9-3|ARID2_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	667-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q96I51|RCC1L_HUMAN	RCC1-like G exchanging factor-like protein OS=Homo sapiens OX=9606 GN=RCC1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	442-UNIMOD:35,451-UNIMOD:4,456-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|Q15750|TAB1_HUMAN	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	1	1	0
PRT	sp|Q96RU3|FNBP1_HUMAN	Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	291-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|P78417|GSTO1_HUMAN	Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	29-UNIMOD:35	0.08	37.0	1	1	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	885-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|Q99707|METH_HUMAN	Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	313-UNIMOD:35,323-UNIMOD:4,324-UNIMOD:4	0.02	37.0	1	1	0
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9UKU7|ACAD8_HUMAN	Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37.0	null	159-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|Q66PJ3-7|AR6P4_HUMAN	Isoform 7 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	1	0
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q01484-7|ANK2_HUMAN	Isoform 5 of Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	355-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	478-UNIMOD:4,482-UNIMOD:35,483-UNIMOD:35	0.03	36.0	2	1	0
PRT	sp|Q9Y244|POMP_HUMAN	Proteasome maturation protein OS=Homo sapiens OX=9606 GN=POMP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.16	36.0	1	1	1
PRT	sp|P33981-2|TTK_HUMAN	Isoform 2 of Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	689-UNIMOD:35,697-UNIMOD:35	0.03	36.0	1	1	0
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	439-UNIMOD:4,429-UNIMOD:35	0.05	36.0	3	2	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1199-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|Q96GA3|LTV1_HUMAN	Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|P13196|HEM1_HUMAN	5-aminolevulinate synthase, nonspecific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	124-UNIMOD:35	0.13	36.0	1	1	1
PRT	sp|Q15811-13|ITSN1_HUMAN	Isoform 13 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9P000-2|COMD9_HUMAN	Isoform 2 of COMM domain-containing protein 9 OS=Homo sapiens OX=9606 GN=COMMD9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	118-UNIMOD:4	0.15	36.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|O95864-3|FADS2_HUMAN	Isoform 3 of Acyl-CoA 6-desaturase OS=Homo sapiens OX=9606 GN=FADS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q96DZ1-3|ERLEC_HUMAN	Isoform 3 of Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|O43683-2|BUB1_HUMAN	Isoform 2 of Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null		0.23	36.0	7	2	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q8N442|GUF1_HUMAN	Translation factor GUF1, mitochondrial OS=Homo sapiens OX=9606 GN=GUF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q96AE4-2|FUBP1_HUMAN	Isoform 2 of Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	92-UNIMOD:35	0.03	36.0	3	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9UHD8-3|SEPT9_HUMAN	Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q92600-3|CNOT9_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:35	0.08	36.0	1	1	0
PRT	sp|O00459|P85B_HUMAN	Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	1	0
PRT	sp|Q9HB21-2|PKHA1_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	163-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|Q5TCQ9-3|MAGI3_HUMAN	Isoform 3 of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	566-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|O14641|DVL2_HUMAN	Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	99-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|Q9GZQ3|COMD5_HUMAN	COMM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=COMMD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.09	36.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	567-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9BY67|CADM1_HUMAN	Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.06	36.0	1	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	1	1	0
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P30291|WEE1_HUMAN	Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	251-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|O15392-5|BIRC5_HUMAN	Isoform 5 of Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	265-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q9H2J7-3|S6A15_HUMAN	Isoform 3 of Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|O75312|ZPR1_HUMAN	Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	284-UNIMOD:35,288-UNIMOD:4,291-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q14781|CBX2_HUMAN	Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	404-UNIMOD:35	0.06	35.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	244-UNIMOD:35,248-UNIMOD:4	0.04	35.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9NR50-3|EI2BG_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	334-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|Q9BYW2-3|SETD2_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	118-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|Q6MZP7-5|LIN54_HUMAN	Isoform 5 of Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=LIN54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	3453-UNIMOD:35	0.00	35.0	1	1	1
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	243-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P52803|EFNA5_HUMAN	Ephrin-A5 OS=Homo sapiens OX=9606 GN=EFNA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	207-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P34949-2|MPI_HUMAN	Isoform 2 of Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q8TB52|FBX30_HUMAN	F-box only protein 30 OS=Homo sapiens OX=9606 GN=FBXO30 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1738-UNIMOD:35	0.02	35.0	2	2	2
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9NQ88|TIGAR_HUMAN	Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:4,130-UNIMOD:35	0.08	35.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1627-UNIMOD:35	0.02	35.0	2	2	2
PRT	sp|Q9HAH7|FBRS_HUMAN	Probable fibrosin-1 OS=Homo sapiens OX=9606 GN=FBRS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q13615-3|MTMR3_HUMAN	Isoform C of Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9P2X3-2|IMPCT_HUMAN	Isoform 2 of Protein IMPACT OS=Homo sapiens OX=9606 GN=IMPACT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|P51688|SPHM_HUMAN	N-sulphoglucosamine sulphohydrolase OS=Homo sapiens OX=9606 GN=SGSH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9NYP3-2|DONS_HUMAN	Isoform 2 of Protein downstream neighbor of Son OS=Homo sapiens OX=9606 GN=DONSON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q9BX40|LS14B_HUMAN	Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	1	1	0
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	606-UNIMOD:4,612-UNIMOD:4	0.05	35.0	2	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	1	1	0
PRT	sp|Q08379|GOGA2_HUMAN	Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	794-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9P2N6-3|KANL3_HUMAN	Isoform 3 of KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O75044|SRGP2_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P11831|SRF_HUMAN	Serum response factor OS=Homo sapiens OX=9606 GN=SRF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	218-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|P31277|HXD11_HUMAN	Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	148-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:35	0.09	34.0	3	1	0
PRT	sp|Q8IZH2-2|XRN1_HUMAN	Isoform 2 of 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	492-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P30414|NKTR_HUMAN	NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q70EL1-9|UBP54_HUMAN	Isoform 6 of Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	406-UNIMOD:35,411-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	198-UNIMOD:35,201-UNIMOD:4	0.08	34.0	1	1	1
PRT	sp|Q5TA45-2|INT11_HUMAN	Isoform 2 of Integrator complex subunit 11 OS=Homo sapiens OX=9606 GN=INTS11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	246-UNIMOD:35,249-UNIMOD:35,253-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q96GE9-2|DMAC1_HUMAN	Isoform 2 of Distal membrane-arm assembly complex protein 1 OS=Homo sapiens OX=9606 GN=DMAC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.16	34.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	209-UNIMOD:35	0.09	34.0	2	1	0
PRT	sp|Q13207|TBX2_HUMAN	T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	789-UNIMOD:4	0.03	34.0	2	2	2
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q6ZVM7-4|TM1L2_HUMAN	Isoform 4 of TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	437-UNIMOD:35,442-UNIMOD:35,435-UNIMOD:35	0.01	34.0	7	1	0
PRT	sp|Q96HW7-4|INT4_HUMAN	Isoform 4 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	249-UNIMOD:35	0.05	34.0	1	1	1
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	268-UNIMOD:4,277-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q9H6R4-3|NOL6_HUMAN	Isoform 3 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	436-UNIMOD:35,448-UNIMOD:35	0.04	34.0	2	1	0
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	160-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O95251-4|KAT7_HUMAN	Isoform 4 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P13995|MTDC_HUMAN	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	1189-UNIMOD:35,1194-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	571-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|A4D1P6-3|WDR91_HUMAN	Isoform 3 of WD repeat-containing protein 91 OS=Homo sapiens OX=9606 GN=WDR91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9BQS8-3|FYCO1_HUMAN	Isoform 3 of FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	0
PRT	sp|Q15843|NEDD8_HUMAN	NEDD8 OS=Homo sapiens OX=9606 GN=NEDD8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.19	33.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|O94822-2|LTN1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|O95202-2|LETM1_HUMAN	Isoform 2 of Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	138-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q9Y467|SALL2_HUMAN	Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	379-UNIMOD:35	0.04	33.0	2	2	2
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|O94813-3|SLIT2_HUMAN	Isoform 3 of Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1276-UNIMOD:35,1317-UNIMOD:35,1325-UNIMOD:4,1328-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|Q15904|VAS1_HUMAN	V-type proton ATPase subunit S1 OS=Homo sapiens OX=9606 GN=ATP6AP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q8TBE0-3|BAHD1_HUMAN	Isoform 3 of Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens OX=9606 GN=BAHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q96EP1-5|CHFR_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	170-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1149-UNIMOD:4	0.01	33.0	1	1	1
PRT	sp|Q9NZI8-2|IF2B1_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q8NFD5-4|ARI1B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	821-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q709F0-2|ACD11_HUMAN	Isoform 2 of Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	3	3	3
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	524-UNIMOD:4,543-UNIMOD:35	0.04	33.0	2	2	2
PRT	sp|Q9Y487|VPP2_HUMAN	V-type proton ATPase 116 kDa subunit a2 OS=Homo sapiens OX=9606 GN=ATP6V0A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	357-UNIMOD:35,718-UNIMOD:4	0.06	33.0	3	2	1
PRT	sp|O00488|ZN593_HUMAN	Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.16	33.0	1	1	1
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.19	33.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	363-UNIMOD:35,303-UNIMOD:4	0.10	33.0	2	2	2
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	3796-UNIMOD:35	0.00	33.0	1	1	0
PRT	sp|Q9BQS8|FYCO1_HUMAN	FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	0
PRT	sp|Q13191|CBLB_HUMAN	E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q96EZ8-3|MCRS1_HUMAN	Isoform 3 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	0
PRT	sp|Q7KZI7-12|MARK2_HUMAN	Isoform 12 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	520-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	100-UNIMOD:4,105-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	492-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q8IZA0-3|K319L_HUMAN	Isoform 3 of Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	512-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q96DU7|IP3KC_HUMAN	Inositol-trisphosphate 3-kinase C OS=Homo sapiens OX=9606 GN=ITPKC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	514-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|P78368|KC1G2_HUMAN	Casein kinase I isoform gamma-2 OS=Homo sapiens OX=9606 GN=CSNK1G2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	206-UNIMOD:35	0.04	32.0	2	1	0
PRT	sp|Q17R31-4|TATD3_HUMAN	Isoform 4 of Putative deoxyribonuclease TATDN3 OS=Homo sapiens OX=9606 GN=TATDN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	193-UNIMOD:4	0.09	32.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	824-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q15572-5|TAF1C_HUMAN	Isoform 5 of TATA box-binding protein-associated factor RNA polymerase I subunit C OS=Homo sapiens OX=9606 GN=TAF1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|Q8WYA6-4|CTBL1_HUMAN	Isoform 4 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	345-UNIMOD:35,348-UNIMOD:4	0.05	32.0	2	1	0
PRT	sp|Q8WWB7-2|GLMP_HUMAN	Isoform 2 of Glycosylated lysosomal membrane protein OS=Homo sapiens OX=9606 GN=GLMP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	219-UNIMOD:4	0.08	32.0	1	1	1
PRT	sp|Q07812-5|BAX_HUMAN	Isoform Epsilon of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	38-UNIMOD:35	0.13	32.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	735-UNIMOD:35	0.04	32.0	3	2	1
PRT	sp|O43379|WDR62_HUMAN	WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9Y2J2-3|E41L3_HUMAN	Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	594-UNIMOD:35,604-UNIMOD:35	0.03	32.0	1	1	0
PRT	sp|Q9NXR1|NDE1_HUMAN	Nuclear distribution protein nudE homolog 1 OS=Homo sapiens OX=9606 GN=NDE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q05397-6|FAK1_HUMAN	Isoform 6 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.11	32.0	2	2	2
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	36-UNIMOD:4,39-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q9UN36|NDRG2_HUMAN	Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	255-UNIMOD:4,258-UNIMOD:35,274-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|Q96EZ8|MCRS1_HUMAN	Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	1	1	0
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NWQ8|PHAG1_HUMAN	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Homo sapiens OX=9606 GN=PAG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q14686|NCOA6_HUMAN	Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q96I15|SCLY_HUMAN	Selenocysteine lyase OS=Homo sapiens OX=9606 GN=SCLY PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	316-UNIMOD:4,323-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1316-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q86W33|TPRA1_HUMAN	Transmembrane protein adipocyte-associated 1 OS=Homo sapiens OX=9606 GN=TPRA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	296-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	151-UNIMOD:35	0.09	31.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	954-UNIMOD:35,956-UNIMOD:35,968-UNIMOD:4,975-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	338-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q96B01-3|R51A1_HUMAN	Isoform 3 of RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.00	31.0	1	1	1
PRT	sp|Q9Y375|CIA30_HUMAN	Complex I intermediate-associated protein 30, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P35813-2|PPM1A_HUMAN	Isoform Alpha-2 of Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q8WWI5-3|CTL1_HUMAN	Isoform 3 of Choline transporter-like protein 1 OS=Homo sapiens OX=9606 GN=SLC44A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O95239-2|KIF4A_HUMAN	Isoform 2 of Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	297-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q7Z4H7-2|HAUS6_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 6 OS=Homo sapiens OX=9606 GN=HAUS6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	424-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	154-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|B7ZAP0|RBG10_HUMAN	Rab GTPase-activating protein 1-like, isoform 10 OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q5FBB7-6|SGO1_HUMAN	Isoform 6 of Shugoshin 1 OS=Homo sapiens OX=9606 GN=SGO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	3	3	3
PRT	sp|Q68CL5-3|TPGS2_HUMAN	Isoform 3 of Tubulin polyglutamylase complex subunit 2 OS=Homo sapiens OX=9606 GN=TPGS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	53-UNIMOD:35,64-UNIMOD:35	0.07	31.0	1	1	1
PRT	sp|Q12830|BPTF_HUMAN	Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q7L576|CYFP1_HUMAN	Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	198-UNIMOD:35	0.02	31.0	1	1	0
PRT	sp|Q9P2D3|HTR5B_HUMAN	HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1222-UNIMOD:35,1227-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9NZ53|PDXL2_HUMAN	Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q8IUH4|ZDH13_HUMAN	Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	177-UNIMOD:35,187-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:35,20-UNIMOD:4	0.11	31.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	130-UNIMOD:35,133-UNIMOD:35	0.07	31.0	14	1	0
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	121-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|Q9NTK5-3|OLA1_HUMAN	Isoform 3 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	159-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q6PIW4-2|FIGL1_HUMAN	Isoform 2 of Fidgetin-like protein 1 OS=Homo sapiens OX=9606 GN=FIGNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O94760-2|DDAH1_HUMAN	Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	3	1	0
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	239-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	490-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.15	30.0	1	1	1
PRT	sp|Q9NXE4-9|NSMA3_HUMAN	Isoform 9 of Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|Q14CB8-5|RHG19_HUMAN	Isoform 5 of Rho GTPase-activating protein 19 OS=Homo sapiens OX=9606 GN=ARHGAP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	182-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	63-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	209-UNIMOD:35	0.07	30.0	2	1	0
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|P46531|NOTC1_HUMAN	Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9NSY1-2|BMP2K_HUMAN	Isoform 2 of BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q6PCT2-2|FXL19_HUMAN	Isoform 2 of F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q16851|UGPA_HUMAN	UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.05	30.0	1	1	0
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	770-UNIMOD:35	0.02	30.0	1	1	0
PRT	sp|Q86WJ1|CHD1L_HUMAN	Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	205-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9NWU1|OXSM_HUMAN	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.06	30.0	1	1	0
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	94-UNIMOD:35	0.02	29.0	3	1	0
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	184-UNIMOD:35,193-UNIMOD:35,194-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|P46100-3|ATRX_HUMAN	Isoform 2 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1601-UNIMOD:4	0.02	29.0	2	2	1
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	160-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q13126-7|MTAP_HUMAN	Isoform 7 of S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens OX=9606 GN=MTAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1143-UNIMOD:35,1144-UNIMOD:35	0.04	29.0	4	4	3
PRT	sp|P56282-2|DPOE2_HUMAN	Isoform 2 of DNA polymerase epsilon subunit 2 OS=Homo sapiens OX=9606 GN=POLE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	324-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	47-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|P30038-3|AL4A1_HUMAN	Isoform 3 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q8N1B4-2|VPS52_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens OX=9606 GN=VPS52	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	297-UNIMOD:35	0.11	29.0	2	2	2
PRT	sp|Q96IQ9-2|ZN414_HUMAN	Isoform 2 of Zinc finger protein 414 OS=Homo sapiens OX=9606 GN=ZNF414	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q15643-2|TRIPB_HUMAN	Isoform 2 of Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O94788-2|AL1A2_HUMAN	Isoform 2 of Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	67-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	596-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	18-UNIMOD:35	0.04	29.0	1	1	0
PRT	sp|Q15398|DLGP5_HUMAN	Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	696-UNIMOD:4	0.03	29.0	1	1	0
PRT	sp|P52747|ZN143_HUMAN	Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	204-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	1	1	1
PRT	sp|Q8IZV5|RDH10_HUMAN	Retinol dehydrogenase 10 OS=Homo sapiens OX=9606 GN=RDH10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	272-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q8N999|CL029_HUMAN	Uncharacterized protein C12orf29 OS=Homo sapiens OX=9606 GN=C12orf29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P16219|ACADS_HUMAN	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	217-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.26	28.0	2	2	2
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	100-UNIMOD:35	0.09	28.0	1	1	1
PRT	sp|Q9UKK3|PARP4_HUMAN	Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P20290-2|BTF3_HUMAN	Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.20	28.0	1	1	1
PRT	sp|P13473-2|LAMP2_HUMAN	Isoform LAMP-2B of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	157-UNIMOD:4,158-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|O14744-3|ANM5_HUMAN	Isoform 3 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	312-UNIMOD:35,316-UNIMOD:4	0.10	28.0	3	3	1
PRT	sp|P46100|ATRX_HUMAN	Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	1718-UNIMOD:4	0.01	28.0	1	1	0
PRT	sp|Q8N5G2|MACOI_HUMAN	Macoilin OS=Homo sapiens OX=9606 GN=MACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	368-UNIMOD:35,371-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P51531|SMCA2_HUMAN	Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O14744|ANM5_HUMAN	Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null		0.03	28.0	1	1	0
PRT	sp|P54709|AT1B3_HUMAN	Sodium/potassium-transporting ATPase subunit beta-3 OS=Homo sapiens OX=9606 GN=ATP1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	209-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	348-UNIMOD:35,351-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q9BRT6|LLPH_HUMAN	Protein LLP homolog OS=Homo sapiens OX=9606 GN=LLPH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P09601|HMOX1_HUMAN	Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	2	1	0
PRT	sp|Q96CB8|INT12_HUMAN	Integrator complex subunit 12 OS=Homo sapiens OX=9606 GN=INTS12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	4	2	1
PRT	sp|Q9NU19|TB22B_HUMAN	TBC1 domain family member 22B OS=Homo sapiens OX=9606 GN=TBC1D22B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q16718|NDUA5_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens OX=9606 GN=NDUFA5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	17-UNIMOD:4	0.15	27.0	1	1	1
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:35,126-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|Q86XI2|CNDG2_HUMAN	Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9H040|SPRTN_HUMAN	SprT-like domain-containing protein Spartan OS=Homo sapiens OX=9606 GN=SPRTN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	392-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	110-UNIMOD:35	0.09	27.0	2	2	2
PRT	sp|P16298-2|PP2BB_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP3CB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	93-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|P18433-6|PTPRA_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	242-UNIMOD:4,248-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9BY32-3|ITPA_HUMAN	Isoform 3 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	105-UNIMOD:4,113-UNIMOD:4,126-UNIMOD:35	0.19	27.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	53-UNIMOD:4	0.02	27.0	2	1	0
PRT	sp|Q9NW07|ZN358_HUMAN	Zinc finger protein 358 OS=Homo sapiens OX=9606 GN=ZNF358 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P33981|TTK_HUMAN	Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	698-UNIMOD:35,284-UNIMOD:4,295-UNIMOD:4,297-UNIMOD:35	0.06	27.0	2	2	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	306-UNIMOD:35,314-UNIMOD:35	0.07	27.0	1	1	1
PRT	sp|Q8WXE0|CSKI2_HUMAN	Caskin-2 OS=Homo sapiens OX=9606 GN=CASKIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	21-UNIMOD:4,22-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q6IBW4|CNDH2_HUMAN	Condensin-2 complex subunit H2 OS=Homo sapiens OX=9606 GN=NCAPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	193-UNIMOD:35,199-UNIMOD:35,202-UNIMOD:35,210-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	502-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q02252-2|MMSA_HUMAN	Isoform 2 of Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	517-UNIMOD:35,520-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q6P1L5|F117B_HUMAN	Protein FAM117B OS=Homo sapiens OX=9606 GN=FAM117B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NSV4-1|DIAP3_HUMAN	Isoform 1 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q6ZWJ1|STXB4_HUMAN	Syntaxin-binding protein 4 OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	22-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	392-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9NU53|GINM1_HUMAN	Glycoprotein integral membrane protein 1 OS=Homo sapiens OX=9606 GN=GINM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	3902-UNIMOD:35	0.00	26.0	1	1	1
PRT	sp|O43681|GET3_HUMAN	ATPase GET3 OS=Homo sapiens OX=9606 GN=GET3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|P02649|APOE_HUMAN	Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q6P4R8-3|NFRKB_HUMAN	Isoform 3 of Nuclear factor related to kappa-B-binding protein OS=Homo sapiens OX=9606 GN=NFRKB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	852-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:35,63-UNIMOD:35	0.37	26.0	4	4	4
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	78-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	824-UNIMOD:4,831-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P35250-2|RFC2_HUMAN	Isoform 2 of Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	88-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q92766-4|RREB1_HUMAN	Isoform 4 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	147-UNIMOD:35,149-UNIMOD:35,167-UNIMOD:35	0.09	26.0	1	1	0
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|P51825|AFF1_HUMAN	AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	864-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|O75128-6|COBL_HUMAN	Isoform 6 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P08397-4|HEM3_HUMAN	Isoform 4 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	97-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	127-UNIMOD:4,129-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	31-UNIMOD:4,33-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P21964-2|COMT_HUMAN	Isoform Soluble of Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	173-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|Q8IWV7|UBR1_HUMAN	E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens OX=9606 GN=UBR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1051-UNIMOD:35,1058-UNIMOD:35,1066-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O95372|LYPA2_HUMAN	Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	70-UNIMOD:35,72-UNIMOD:35,79-UNIMOD:35	0.11	25.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	494-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	65-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q8IZP0-11|ABI1_HUMAN	Isoform 11 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	150-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q8TCU4-3|ALMS1_HUMAN	Isoform 3 of Alstrom syndrome protein 1 OS=Homo sapiens OX=9606 GN=ALMS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	2	1
PRT	sp|Q5BJH7-4|YIF1B_HUMAN	Isoform 4 of Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	29-UNIMOD:35	0.09	25.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UPW5|CBPC1_HUMAN	Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	958-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|O15504|NUP42_HUMAN	Nucleoporin NUP42 OS=Homo sapiens OX=9606 GN=NUP42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O75586|MED6_HUMAN	Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9BRR8|GPTC1_HUMAN	G patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GPATCH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96KN1|LRAT2_HUMAN	Protein LRATD2 OS=Homo sapiens OX=9606 GN=LRATD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	404-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.16	24.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	61-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|Q8TCU4|ALMS1_HUMAN	Alstrom syndrome protein 1 OS=Homo sapiens OX=9606 GN=ALMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.00	24.0	1	1	0
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P52564|MP2K6_HUMAN	Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|O15131|IMA6_HUMAN	Importin subunit alpha-6 OS=Homo sapiens OX=9606 GN=KPNA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q7Z7H5-3|TMED4_HUMAN	Isoform 3 of Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TMED4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	77-UNIMOD:35	0.10	23.0	1	1	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1657-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	106-UNIMOD:4	0.18	23.0	2	2	2
PRT	sp|P58876|H2B1D_HUMAN	Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9UBU6|FA8A1_HUMAN	Protein FAM8A1 OS=Homo sapiens OX=9606 GN=FAM8A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	15-UNIMOD:35	0.28	23.0	1	1	1
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	450-UNIMOD:35	0.01	23.0	1	1	0
PRT	sp|O96028|NSD2_HUMAN	Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O95169|NDUB8_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	70-UNIMOD:35	0.13	23.0	1	1	1
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	130-UNIMOD:35,134-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q8IYK4|GT252_HUMAN	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q92600|CNOT9_HUMAN	CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	0
PRT	sp|O95785-2|WIZ_HUMAN	Isoform 2 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	224-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P22102-2|PUR2_HUMAN	Isoform Short of Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	212-UNIMOD:35	0.03	22.0	2	1	0
PRT	sp|P22830|HEMH_HUMAN	Ferrochelatase, mitochondrial OS=Homo sapiens OX=9606 GN=FECH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	323-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q9UGU0|TCF20_HUMAN	Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q15014|MO4L2_HUMAN	Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	176-UNIMOD:35	0.10	22.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q8IX90-3|SKA3_HUMAN	Isoform 3 of Spindle and kinetochore-associated protein 3 OS=Homo sapiens OX=9606 GN=SKA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	17-UNIMOD:35,26-UNIMOD:35	0.09	21.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	164-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O15381|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q9Y2J2-2|E41L3_HUMAN	Isoform 2 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	604-UNIMOD:35	0.02	21.0	1	1	0
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	505-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	441-UNIMOD:35,455-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NZJ6|COQ3_HUMAN	Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	358-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q14699|RFTN1_HUMAN	Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.24	20.0	2	2	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|Q9BYG5|PAR6B_HUMAN	Partitioning defective 6 homolog beta OS=Homo sapiens OX=9606 GN=PARD6B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	69-UNIMOD:4	0.22	20.0	1	1	1
PRT	sp|Q9BVS4|RIOK2_HUMAN	Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	309-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q6ICB0|DESI1_HUMAN	Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.15	20.0	1	1	1
PRT	sp|Q0JRZ9|FCHO2_HUMAN	F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|O15126|SCAM1_HUMAN	Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q6P3X3|TTC27_HUMAN	Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	299-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P49593-2|PPM1F_HUMAN	Isoform 2 of Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.28	19.0	3	3	3
PRT	sp|Q9ULV3-5|CIZ1_HUMAN	Isoform 5 of Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	151-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.14	19.0	1	1	0
PRT	sp|Q6PGQ7|BORA_HUMAN	Protein aurora borealis OS=Homo sapiens OX=9606 GN=BORA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	378-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|P28370-2|SMCA1_HUMAN	Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q9UMX1|SUFU_HUMAN	Suppressor of fused homolog OS=Homo sapiens OX=9606 GN=SUFU PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.00	18.0	1	1	0
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q14457|BECN1_HUMAN	Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q5TBB1|RNH2B_HUMAN	Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q06323-3|PSME1_HUMAN	Isoform 3 of Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9NVV9|THAP1_HUMAN	THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	83-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q14CZ7|FAKD3_HUMAN	FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q92879-4|CELF1_HUMAN	Isoform 4 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	12-UNIMOD:35,17-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	81-UNIMOD:4	0.09	17.0	1	1	1
PRT	sp|P31276|HXC13_HUMAN	Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q9HCD6|TANC2_HUMAN	Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	18-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q6ZU65|UBN2_HUMAN	Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P82970|HMGN5_HUMAN	High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	465-UNIMOD:35,484-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9UPX0|TUTLB_HUMAN	Protein turtle homolog B OS=Homo sapiens OX=9606 GN=IGSF9B PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O60508|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens OX=9606 GN=CDC40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O60443-2|GSDME_HUMAN	Isoform 2 of Gasdermin-E OS=Homo sapiens OX=9606 GN=GSDME	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.24	16.0	1	1	1
PRT	sp|P61204-2|ARF3_HUMAN	Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|Q6IA69|NADE_HUMAN	Glutamine-dependent NAD(+) synthetase OS=Homo sapiens OX=9606 GN=NADSYN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P04350|TBB4A_HUMAN	Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	127-UNIMOD:4,129-UNIMOD:4,147-UNIMOD:35	0.07	16.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	102-UNIMOD:35	0.03	16.0	1	1	0
PRT	sp|Q9UHD8|SEPT9_HUMAN	Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	375-UNIMOD:4,380-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|Q96RS0|TGS1_HUMAN	Trimethylguanosine synthase OS=Homo sapiens OX=9606 GN=TGS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	573-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|P20671|H2A1D_HUMAN	Histone H2A type 1-D OS=Homo sapiens OX=9606 GN=H2AC7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.16	16.0	1	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q14147|DHX34_HUMAN	Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens OX=9606 GN=DHX34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q5VT06|CE350_HUMAN	Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9NR28|DBLOH_HUMAN	Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	74-UNIMOD:35	0.06	16.0	1	1	1
PRT	sp|P01133|EGF_HUMAN	Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	608-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q9UIG0|BAZ1B_HUMAN	Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	0
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	855-UNIMOD:35	0.03	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAAT	1	sp|Q9UKY7-2|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	91		ms_run[2]:scan=4132	18.429	3	3696.7185	3696.7185	N	K	27	76
PSM	KSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTA	2	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	72		ms_run[2]:scan=4528	20.244	3	3584.5735	3584.5735	S	K	172	209
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	3	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	70		ms_run[2]:scan=4158	18.538	3	2522.2361	2522.2361	K	K	455	486
PSM	RAGAGAPVVGSGSSGGGNAFTGLGPVSTLPSLHG	4	sp|Q9NNW5|WDR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69		ms_run[2]:scan=6946	27.23	3	2991.5162	2991.5162	A	K	535	569
PSM	KSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	5	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	68		ms_run[1]:scan=5096	22.185299357066665	3	3974.822463	3974.825357	V	K	35	77
PSM	KEELQANGSAPAADKEEPAAAGSGAASPSAAE	6	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67		ms_run[2]:scan=4330	19.346	3	2981.385	2981.3850	A	K	55	87
PSM	KQLSQATAAATNHTTDNGVGPEEESVDPNQYY	7	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67		ms_run[2]:scan=5460	23.169	3	3434.5498	3434.5498	E	K	46	78
PSM	RGPTQPPTLPAGSGSNDETCTGAGYPQGK	8	sp|Q8IYD1|ERF3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67	20-UNIMOD:4	ms_run[2]:scan=4757	21.111	3	2900.3359	2900.3359	L	R	74	103
PSM	RVTEAPCYPGAPSTEASGQTGPQEPTSARA	9	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67	7-UNIMOD:4	ms_run[2]:scan=4798	21.252	3	3072.4207	3072.4207	P	-	517	547
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	10	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=4674	20.815	3	2522.2361	2522.2361	K	K	455	486
PSM	KENGTVTAANASTLNDGAAALVLMTADAAK	11	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	65	24-UNIMOD:35	ms_run[2]:scan=7071	27.718	3	2904.4499	2904.4499	Q	R	273	303
PSM	RTPGAATASASGAAEDGACGCLPNPGTFEECH	12	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	65	19-UNIMOD:4,21-UNIMOD:4,31-UNIMOD:4	ms_run[1]:scan=5703	23.7105474232	3	3218.350114	3218.345160	E	R	56	88
PSM	KENGTVTAANASTLNDGAAALVLMTADAAK	13	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	64		ms_run[2]:scan=7468	29.575	3	2888.455	2888.4550	Q	R	273	303
PSM	KEFMEDSAGEGATEFHDYEGGGIGEGEGM	14	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63	4-UNIMOD:35,29-UNIMOD:35	ms_run[2]:scan=5639	23.546	3	3067.1971	3067.1971	P	K	4658	4687
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPV	15	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=5133	22.289	3	3066.4214	3066.4214	R	R	205	234
PSM	KLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYG	16	sp|Q9NYV4-2|CDK12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=6280	25.197	3	3292.5385	3292.5385	T	K	1427	1461
PSM	RQEEEQDLDGEKGPSSEGPEEEDGEGFSF	17	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=6165	24.881	3	3212.3178	3212.3178	A	K	113	142
PSM	RTAGQPEGGPGADFGQSCFPAEAGRDTLS	18	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62	18-UNIMOD:4	ms_run[2]:scan=5919	24.23	3	2935.3155	2935.3155	T	R	237	266
PSM	KEALSNLTALTSDSDTDSSSDSDSDTSEGK	19	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	62		ms_run[1]:scan=5709	23.727480891733332	3	3062.341676	3062.317116	Q	-	660	690
PSM	KVEQNSEPCAGSSSESDLQTVFKNESLNAES	20	sp|Q8N806|UBR7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	9-UNIMOD:4	ms_run[2]:scan=6400	25.539	3	3370.5107	3370.5107	V	K	252	283
PSM	RAAAAPGASPSPGGDAAWSEAGPGPRPLA	21	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=5579	23.421	3	2641.2997	2641.2997	G	R	33	62
PSM	REPTSSEQGGLEGSGSAAGEGKPALSEEE	22	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=4638	20.683	3	2845.285	2845.2850	G	R	62	91
PSM	RQLAPGMVQQMQSVCSDCNGEGEVINEKD	23	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	7-UNIMOD:35,11-UNIMOD:35,15-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=4808	21.284	3	3310.4323	3310.4323	I	R	172	201
PSM	RSPISDNSGCDAPGNSNPSLSVPSSAESEKQT	24	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	10-UNIMOD:4	ms_run[2]:scan=4930	21.682	3	3274.4644	3274.4644	Q	R	22	54
PSM	KEGICALGGTSELSSEGTQHSYSEEE	25	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60	5-UNIMOD:4	ms_run[2]:scan=5372	22.945	3	2784.2032	2784.2032	R	K	55	81
PSM	KPGTTGSGAGSGGPGGLTSAAPAGGDK	26	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=4133	18.431	3	2212.072	2212.0720	T	K	26	53
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	27	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=4243	18.953	3	2522.2361	2522.2361	K	K	455	486
PSM	RAGGAGVPAFYTPTGYGTLVQEGGSPIKYN	28	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=6949	27.241	3	3027.509	3027.5090	I	K	146	176
PSM	REFITGDVEPTDAESEWHSENEEEE	29	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=6064	24.609	3	2963.2217	2963.2217	R	K	107	132
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPV	30	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60	14-UNIMOD:35	ms_run[1]:scan=4732	21.013592542933335	3	3082.420161	3082.416275	R	R	205	234
PSM	RGSDELFSTCVTNGPFIMSSNSASAANGNDSK	31	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60	10-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=6499	25.8127107296	3	3337.455213	3336.462299	K	K	14	46
PSM	KEALSNLTALTSDSDTDSSSDSDSDTSEGK	32	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60		ms_run[1]:scan=5689	23.6816997744	3	3062.341676	3062.317116	Q	-	660	690
PSM	KADPAFGLESSGIAGTTSDEPERIEESGNDEA	33	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=6247	25.114	3	3278.4699	3278.4699	G	R	759	791
PSM	KSLAGSSGPGASSGTSGDHGELVV	34	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=4958	21.765	3	2156.0346	2156.0346	Q	R	59	83
PSM	RNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLE	35	sp|Q9BYJ9-2|YTHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=5354	22.9	3	3520.6203	3520.6203	N	K	149	185
PSM	RPVIPPVSTPGQPNAVGTFTEIPASNIR	36	sp|O00330-3|ODPX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=6722	26.446	3	2914.5665	2914.5665	P	R	242	270
PSM	RSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEAS	37	sp|Q9Y6K1-3|DNM3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=4717	20.966	3	3247.4865	3247.4865	K	R	96	130
PSM	RTVASQPISTQTLVEGENDEQSSTDQASAIKT	38	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=5599	23.462	3	3390.6387	3390.6387	P	K	204	236
PSM	KEFGDQAEAAQDATLTTTTFQNEDEKN	39	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	59		ms_run[1]:scan=5706	23.718503810666668	3	3001.347791	3001.342483	N	K	899	926
PSM	KADEASELACPTPKEDGLAQQQTQLNL	40	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	10-UNIMOD:4	ms_run[2]:scan=6077	24.654	3	2954.4291	2954.4291	S	R	2193	2220
PSM	KAETEEAEEPEEDGEEHVCVSAS	41	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	19-UNIMOD:4	ms_run[2]:scan=4540	20.297	3	2560.0395	2560.0395	E	K	945	968
PSM	KLASSDTGESDQSSTETDSTVKSQEESNP	42	sp|Q96AY4|TTC28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=4003	17.792	3	3043.3225	3043.3225	G	K	2127	2156
PSM	KPMNVGLSETQNGGMSQEAVGNIKVT	43	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	3-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5137	22.298	3	2720.3109	2720.3109	Q	K	59	85
PSM	KVYYDGTVEQHPFGEAAYPADGADAGQ	44	sp|Q7Z4R8|CF120_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=5755	23.84	3	2855.2675	2855.2675	M	K	132	159
PSM	RLQQQAALSPTTAPAVSSVSKQETIM	45	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	26-UNIMOD:35	ms_run[2]:scan=5302	22.76	3	2757.4331	2757.4331	Q	R	478	504
PSM	RPAPAQEAATEGPSAASGVPQTGPGREVAAT	46	sp|Q96JG8-3|MAGD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=4795	21.242	3	2930.4482	2930.4482	K	R	254	285
PSM	RLQAALDDEEAGGRPAMEPGNGSLDLGGDSAG	47	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58	17-UNIMOD:35	ms_run[1]:scan=5604	23.471884783733334	3	3142.419211	3141.426899	E	R	37	69
PSM	KNLEAVETLGSTSTICSDKTGTLTQN	48	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58	16-UNIMOD:4	ms_run[1]:scan=5617	23.499546842133334	3	2768.359974	2767.354569	V	R	359	385
PSM	KATESGAQSAPLPMEGVDISPKQDEGVL	49	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58		ms_run[1]:scan=6642	26.212378693333335	3	2854.415104	2853.406604	M	K	7	35
PSM	KQSTQVMAASMSAFDPLKNQDEIN	50	sp|Q92734-4|TFG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	7-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5702	23.708	3	2684.2422	2684.2422	G	K	155	179
PSM	RENLTDLVVDTDTLGESTQPQREGAQVPTG	51	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=6823	26.783	3	3225.5749	3225.5749	S	R	642	672
PSM	RGSDELLSGSVLSSPNSNMSSMVVTANGNDSK	52	sp|Q9UKA9-5|PTBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	19-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=5754	23.838	3	3271.4933	3271.4933	K	K	14	46
PSM	RLPISVDSPPAAADSNTTAASNVDKVQES	53	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=5549	23.349	3	2939.4472	2939.4472	S	R	1755	1784
PSM	RPAAPANNPPPPSLMSTTQSRPPWMNSGPSES	54	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	25-UNIMOD:35	ms_run[2]:scan=5867	24.1	3	3374.5772	3374.5772	P	R	345	377
PSM	RQLAPGMVQQMQSVCSDCNGEGEVINEKD	55	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	11-UNIMOD:35,15-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=5149	22.33	3	3294.4373	3294.4373	I	R	172	201
PSM	RSGPSEVTGSDASGPDPQLAVTMGFTGFGK	56	sp|Q9NW82|WDR70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	23-UNIMOD:35	ms_run[2]:scan=6704	26.39	3	2968.3873	2968.3873	E	K	3	33
PSM	KGESASPANEEITEEQNGTANGFSEINSKE	57	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57		ms_run[1]:scan=5395	22.997254453866667	3	3168.423099	3166.417439	E	K	690	720
PSM	RVVDESFVDTSPTGPSSADATTSSEELPK	58	sp|Q9Y535|RPC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57		ms_run[1]:scan=5630	23.531873961066665	3	3011.427003	3008.409835	F	K	151	180
PSM	KAAGSPSSSDQDEKLPGQDESTAGTSEQNDIL	59	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=5345	22.878	3	3261.4757	3261.4757	G	K	183	215
PSM	KAEEAGIGDTPSLEDEAAGHVTQA	60	sp|P10636-2|TAU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=5478	23.21	3	2395.1139	2395.1139	L	R	44	68
PSM	KDATNVGDEGGFAPNILENKEGLELL	61	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=7463	29.552	3	2742.3712	2742.3712	G	K	109	135
PSM	KSLSDNGQPGTPDPADSGGTSAKESECIT	62	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	27-UNIMOD:4	ms_run[2]:scan=4590	20.496	3	2905.2883	2905.2883	C	K	1731	1760
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	63	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=4470	19.99	3	2522.2361	2522.2361	K	K	455	486
PSM	RLDVTLGPVPEIGGSEAPAPQNKDQ	64	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=6446	25.672	3	2587.3242	2587.3242	E	K	69	94
PSM	RTVGTPIASVPGSTNTGTVPGSEKDSDSMETEE	65	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	29-UNIMOD:35	ms_run[2]:scan=4995	21.883	3	3351.526	3351.5260	L	K	269	302
PSM	RVVVPATEEEAEVDEFPTDGEMSAQEEDR	66	sp|O00541|PESC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	22-UNIMOD:35	ms_run[2]:scan=5886	24.146	3	3279.4361	3279.4361	A	R	285	314
PSM	RLQAALDDEEAGGRPAMEPGNGSLDLGGDSAG	67	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56	17-UNIMOD:35	ms_run[1]:scan=5694	23.691437113866666	3	3142.419211	3141.426899	E	R	37	69
PSM	RPEEENASANPPSGIEDETAENGVPKP	68	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56		ms_run[1]:scan=5068	22.106783296	3	2833.299468	2833.300225	E	K	50	77
PSM	KAGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAA	69	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=5456	23.159	3	3811.7634	3811.7634	Q	K	601	642
PSM	KASAEGPLLGPEAAPSGEGAGSKGEAVL	70	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=5815	23.974	3	2549.2973	2549.2973	K	R	21	49
PSM	KEDLPAENGETKTEESPASDEAGE	71	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=4212	18.807	3	2532.0987	2532.0987	T	K	71	95
PSM	KGAESAESADAAIMNNDPNFTETIDESK	72	sp|Q9UHC6-2|CNTP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	14-UNIMOD:35	ms_run[2]:scan=5765	23.856	3	2970.3037	2970.3037	A	K	76	104
PSM	KLALEDSENTASTNCDSSSEGLEKDTATQ	73	sp|Q49AR2|CE022_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	15-UNIMOD:4	ms_run[2]:scan=4928	21.677	3	3100.3626	3100.3626	P	R	181	210
PSM	KSSSQPSSCCSDPSKPGGNVEGATQSLAEQM	74	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	9-UNIMOD:4,10-UNIMOD:4,31-UNIMOD:35	ms_run[2]:scan=4733	21.018	3	3226.3813	3226.3813	E	R	197	228
PSM	RSVVDMDLDDTDDGDDNAPLFYQPGK	75	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=6996	27.408	3	2897.2661	2897.2661	S	R	2484	2510
PSM	RYVAQAGLEPLASGDPSASASHAAGITGS	76	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=5793	23.935	3	2740.3416	2740.3416	S	R	46	75
PSM	KANDGGLAAGAPAMHMASYGPEPCTDNSDSLIA	77	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	14-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=6070	24.628	3	3304.4435	3304.4435	A	K	62	95
PSM	KDAGVQPEEISYINAHATSTPLGDAAEN	78	sp|Q9NWU1-2|OXSM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=6278	25.193	3	2897.3679	2897.3679	L	K	250	278
PSM	KDGSDEPGTAACPNGSFHCTNTGY	79	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	12-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=4705	20.924	3	2542.0125	2542.0125	C	K	59	83
PSM	KDLYANTVLSGGTTMYPGIADRMQ	80	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	15-UNIMOD:35	ms_run[2]:scan=6363	25.44	3	2617.2516	2617.2516	R	K	291	315
PSM	KEPSITQGNTEDQGSGPSETKPVVSIS	81	sp|Q14746-2|COG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=5069	22.109	3	2771.3461	2771.3461	S	R	483	510
PSM	KGQPVAPYNTTQFLMDDHDQEEPDL	82	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	15-UNIMOD:35	ms_run[2]:scan=6493	25.795	3	2903.292	2903.2920	A	K	196	221
PSM	KLDGELGGQTLEHSTVLGLPAGAEE	83	sp|Q9BSJ2-3|GCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=6663	26.279	3	2520.2708	2520.2708	M	R	640	665
PSM	KLVTQPTLLSATAGRPSGSTPLGPLA	84	sp|Q8IVW6-3|ARI3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=6806	26.726	3	2532.4275	2532.4275	Q	R	45	71
PSM	KQNLYDLDEDDDGIASVPTKQM	85	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	22-UNIMOD:35	ms_run[2]:scan=5840	24.032	3	2510.1483	2510.1483	A	K	178	200
PSM	KQVLGQMVIDEELLGDGHSYSP	86	sp|P28070|PSB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	7-UNIMOD:35	ms_run[2]:scan=6850	26.883	3	2430.1737	2430.1737	L	R	109	131
PSM	RIPEAPAGPPSDFGLFLSDDDPK	87	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=7215	28.351	3	2440.1911	2440.1911	E	K	35	58
PSM	RQILLGPNTGLSGGMPGALPSLPGKI	88	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	15-UNIMOD:35	ms_run[2]:scan=7025	27.54	3	2559.4207	2559.4207	Q	-	117	143
PSM	RQQAAYYAQTSPQGMPQHPPAPQGQ	89	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=4872	21.495	3	2736.2827	2736.2827	Y	-	620	645
PSM	RTVMDGGLESDGPNMTENGLEDESRPQ	90	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	4-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=4889	21.562	3	2965.2666	2965.2666	D	R	557	584
PSM	KVNGDASPAAAESGAKEELQANGSAPAAD	91	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=4951	21.740387636533335	3	2726.279303	2725.279095	V	K	40	69
PSM	RPEEENASANPPSGIEDETAENGVPKP	92	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=5201	22.4802586488	3	2833.299468	2833.300225	E	K	50	77
PSM	KPSSTTPTPLVSETGGNSPSDKVDNEL	93	sp|Q2KHR3|QSER1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=5430	23.088622514933334	3	2756.342151	2756.335213	P	K	1194	1221
PSM	KAEGAATEEEGTPKESEPQAAAEPAEA	94	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4173	18.613	3	2697.2253	2697.2253	K	K	25	52
PSM	KEAPTPKEGTLTQVPLAPPPPGAPPSPAPA	95	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5973	24.357	3	2912.5648	2912.5648	D	R	1122	1152
PSM	KGADSELSTVPSVTKTQASSSFQDSSQPAG	96	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5309	22.781	3	2996.4211	2996.4211	S	K	651	681
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	97	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4209	18.792	3	2835.1625	2835.1625	E	K	54	81
PSM	KLEGDNVNPESQLIQQSEQSESETAGSTKY	98	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=6108	24.727	3	3295.5328	3295.5328	A	R	1834	1864
PSM	KNVPILYTASQACLQHPDVAAY	99	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	13-UNIMOD:4	ms_run[2]:scan=6572	26.015	3	2458.2315	2458.2315	Q	K	216	238
PSM	KPSSTTPTPLVSETGGNSPSDKVDNEL	100	sp|Q2KHR3-2|QSER1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5441	23.119	3	2756.3352	2756.3352	P	K	955	982
PSM	KSLMSISNAGSGLLSHSSTLTGSPIMEE	101	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	4-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=6387	25.497	3	2865.3736	2865.3736	A	K	377	405
PSM	KTAMSTPHVAEPAENEQDEQDENGAEASADL	102	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	4-UNIMOD:35	ms_run[2]:scan=4861	21.454	3	3299.4008	3299.4008	L	R	464	495
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	103	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4370	19.528	3	2522.2361	2522.2361	K	K	455	486
PSM	RALAAQGLPVSCTAESPTPQALATGIR	104	sp|P10746|HEM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	12-UNIMOD:4	ms_run[2]:scan=6267	25.163	3	2735.4388	2735.4388	A	K	230	257
PSM	RATAPVPTVGEGYGYGHESELSQASAAA	105	sp|Q96PK6-5|RBM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5540	23.336	3	2775.31	2775.3100	R	R	288	316
PSM	REAPGPLEGAGEAGGEEADEKPPQFVC	106	sp|Q96K58|ZN668_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	27-UNIMOD:4	ms_run[2]:scan=5823	23.991	3	2796.2661	2796.2661	V	R	492	519
PSM	RNSSAQAFLGPENPEEPYLDGINYNCVAPGK	107	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	26-UNIMOD:4	ms_run[2]:scan=6912	27.098	3	3406.5888	3406.5888	S	R	1090	1121
PSM	RQQAAYYAQTSPQGMPQHPPAPQGQ	108	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	15-UNIMOD:35	ms_run[2]:scan=4487	20.058	3	2752.2776	2752.2776	Y	-	620	645
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	109	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	15-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=4985	21.858	3	2958.3349	2958.3349	M	R	454	482
PSM	RSGGDGGDEVEGSGVGAGEGETVQHFPLA	110	sp|Q96DT7-3|ZBT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=5996	24.427	3	2770.243	2770.2430	R	R	36	65
PSM	RSSGTASSVAFTPLQGLEIVNPQAAEK	111	sp|Q8WWY3|PRP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=7216	28.354	3	2757.4297	2757.4297	D	K	444	471
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPV	112	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	53	14-UNIMOD:35	ms_run[1]:scan=4834	21.366452773066666	3	3082.420161	3082.416275	R	R	205	234
PSM	RQLAPGMVQQMQSVCSDCNGEGEVINEKD	113	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	53	15-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=5942	24.283568654933333	3	3279.447392	3278.442431	I	R	172	201
PSM	KADVLTTGAGNPVGDKLNVITVGP	114	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=6597	26.088	3	2335.2747	2335.2747	Q	R	23	47
PSM	KAPVPGTPDSLSSGSSRDVQGTDASLDEELD	115	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5760	23.849	3	3129.4586	3129.4586	T	R	276	307
PSM	KATGSDSSGVIDLTMDDEESGASQDPK	116	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	15-UNIMOD:35	ms_run[2]:scan=5114	22.238	3	2755.1978	2755.1978	G	K	956	983
PSM	KATLVESSTSGFTPGGGGSSVSMIASR	117	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	23-UNIMOD:35	ms_run[2]:scan=5509	23.275	3	2586.2595	2586.2595	L	K	671	698
PSM	KGADDAADADTAIINAEGGQNNSEEK	118	sp|Q9BY67-5|CADM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5089	22.165	3	2603.1583	2603.1583	A	K	384	410
PSM	KIYQNIQDGSLDLNAAESGVQH	119	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5929	24.261	3	2399.1717	2399.1717	K	K	171	193
PSM	KLASAEDSAPADKDEDEGEPPAQAPVA	120	sp|Q5T0F9-3|C2D1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4539	20.295	3	2707.2461	2707.2461	E	K	162	189
PSM	KLEAPFTQDDTLGLENSHPVWTQ	121	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7060	27.682	3	2625.2711	2625.2711	S	K	77	100
PSM	KPIGPDDAIDALSSDFTCGSPTAAGK	122	sp|P20810-3|ICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	18-UNIMOD:4	ms_run[2]:scan=7225	28.397	3	2590.2221	2590.2221	A	K	106	132
PSM	KQVFESDEAPDGNSYQDDQDDLK	123	sp|Q96N67-7|DOCK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5012	21.926	3	2642.1256	2642.1256	P	R	155	178
PSM	KSLTSATSTSNIQSSASQPPRPQQGQV	124	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4697	20.893	3	2784.4002	2784.4002	Q	K	2245	2272
PSM	KTGSPGGPGVSGGSPAGGAGGGSSGLPPSTK	125	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=4570	20.421	3	2522.2361	2522.2361	K	K	455	486
PSM	KTPEMINQGTNQTEQNGQVMNITNSGHEN	126	sp|P38398-8|BRCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	5-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=4445	19.874	3	3245.4313	3245.4313	Q	K	480	509
PSM	RNQGETPTTEVPAPFFLPASLSANNTPTR	127	sp|Q9UJX2-3|CDC23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=7262	28.579	3	3112.5578	3112.5578	L	R	439	468
PSM	RPGPGQILPAEPLDDSKNATGNSASGLGAG	128	sp|Q7Z6L1-3|TCPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5890	24.158	3	2846.4159	2846.4159	E	R	352	382
PSM	RQEIQEGQINIAMASASSPASSGGSGKLPS	129	sp|Q7Z569-2|BRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	13-UNIMOD:35	ms_run[2]:scan=5388	22.983	3	2973.4462	2973.4462	T	R	375	405
PSM	RTVGTPIASVPGSTNTGTVPGSEKDSDSMETEE	130	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=5256	22.628	3	3335.5311	3335.5311	L	K	269	302
PSM	KVNGDASPAAAESGAKEELQANGSAPAAD	131	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=4830	21.350292399466664	3	2726.267537	2725.279095	V	K	40	69
PSM	KVEMDNLDNAQTSGIEEPSETKGSMQ	132	sp|Q96T23|RSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52	4-UNIMOD:35,25-UNIMOD:35	ms_run[1]:scan=4617	20.60276040293333	3	2870.267945	2869.259348	T	K	677	703
PSM	KDCGSVDGVIKEVNVSPCPTQPCQLS	133	sp|P61916-2|NPC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	3-UNIMOD:4,18-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=6114	24.744	3	2873.3358	2873.3358	F	K	25	51
PSM	KDLYANTVLSGGTTMYPGIADRMQ	134	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	15-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=6090	24.692	3	2633.2465	2633.2465	R	K	291	315
PSM	KEAIVTSEELGQDLEHVEVLQ	135	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7201	28.29	3	2365.2013	2365.2013	D	K	168	189
PSM	KEVELNELEPEKQPMNAASGAAMSLAGAE	136	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	15-UNIMOD:35	ms_run[2]:scan=6341	25.375	3	3029.4322	3029.4322	M	K	10	39
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	137	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	12-UNIMOD:35	ms_run[2]:scan=4027	17.907	3	2851.1574	2851.1574	E	K	54	81
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	138	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	12-UNIMOD:35	ms_run[2]:scan=4112	18.333	3	2851.1574	2851.1574	E	K	54	81
PSM	KIPQMESSTNSSSQDYSTSQEPSVASSHGV	139	sp|Q96RU2-2|UBP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	5-UNIMOD:35	ms_run[2]:scan=4695	20.888	3	3170.3946	3170.3946	C	R	702	732
PSM	KLNSNTQVVLLSATMPSDVLEVTK	140	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	15-UNIMOD:35	ms_run[2]:scan=6897	27.043	3	2602.3888	2602.3888	Q	K	202	226
PSM	KNGADQPFATDQSKPVAVPEEQPVAESGLLA	141	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6488	25.783	3	3192.5939	3192.5939	Y	R	307	338
PSM	KPGQEAPVLPKDGAVNGPSVVGDQTPIEPQTSIE	142	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6099	24.707	3	3453.7627	3453.7627	E	R	366	400
PSM	KPQVAAQSQPQSNVQGQSPVRVQSPSQT	143	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4537	20.288	3	2960.5064	2960.5064	S	R	2448	2476
PSM	KPVSSNNSLSAFTPALSNQNVEEEK	144	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5986	24.393	3	2689.3195	2689.3195	S	R	211	236
PSM	KSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTA	145	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4585	20.474	3	3584.5735	3584.5735	S	K	172	209
PSM	KSIMAAAGVPVVEGYHGEDQSDQCL	146	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	4-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=5729	23.776	3	2676.216	2676.2160	S	K	167	192
PSM	KVEMDNLDNAQTSGIEEPSETKGSMQ	147	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	25-UNIMOD:35	ms_run[2]:scan=5081	22.143	3	2853.2644	2853.2644	T	K	425	451
PSM	KVIAINVDDPDAANYNDINDVK	148	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5980	24.379	3	2415.1918	2415.1918	W	R	155	177
PSM	KVNFSEEGETEEDDQDSSHSSVTTV	149	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4931	21.686	3	2755.158	2755.1580	Q	K	212	237
PSM	KVTGPQATTGTPLVTMRPASQAG	150	sp|P51610-4|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	16-UNIMOD:35	ms_run[2]:scan=4647	20.717	3	2284.1845	2284.1845	L	K	488	511
PSM	KVTTVVATPGQGPDRPQEVSYTDT	151	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4972	21.815	3	2545.266	2545.2660	S	K	36	60
PSM	MKDVPGFLQQSQNSGPGQPAVWH	152	sp|Q9UNM6|PSD13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:35	ms_run[2]:scan=6261	25.149	3	2523.1965	2523.1965	-	R	1	24
PSM	RAEDNADTLALVFEAPNQEKVSDYEM	153	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	26-UNIMOD:35	ms_run[2]:scan=7160	28.105	3	2970.3553	2970.3553	L	K	91	117
PSM	RDAAASASTPAQAPTSDSPVAEDASR	154	sp|P55789|ALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=4376	19.549	3	2528.1739	2528.1739	R	R	42	68
PSM	REANGLPIMESNCFDPSKIQLPEDE	155	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	9-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6839	26.838	3	2904.327	2904.3270	Y	-	129	154
PSM	REMLESAVLPPEDMSQSGPSGSHPQGP	156	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	3-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=5249	22.609	3	2851.2753	2851.2753	H	R	466	493
PSM	RGTEAGQVGEPGIPTGEAGPSCSSASDKLP	157	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	22-UNIMOD:4	ms_run[2]:scan=5370	22.939	3	2911.3618	2911.3618	E	R	220	250
PSM	RMGDEGGESELLGEDLPLEPSVTKAE	158	sp|O60271-9|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	2-UNIMOD:35	ms_run[2]:scan=6829	26.804	3	2773.2964	2773.2964	F	R	1138	1164
PSM	RPDTTESLNSSLSNGTSDADLFDSHDD	159	sp|Q96SU4-5|OSBL9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6259	25.143	3	2895.2278	2895.2278	K	R	154	181
PSM	RSVVDMDLDDTDDGDDNAPLFYQPGK	160	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	6-UNIMOD:35	ms_run[2]:scan=6530	25.912	3	2913.2611	2913.2611	S	R	2484	2510
PSM	RVADGLPLAASMQEDEQSGRDLQQYQSQA	161	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	12-UNIMOD:35	ms_run[2]:scan=5841	24.033	3	3206.4898	3206.4898	A	K	9	38
PSM	RYASICQQNGIVPIVEPEILPDGDHDL	162	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	6-UNIMOD:4	ms_run[2]:scan=7293	28.73	3	3047.5022	3047.5022	A	K	227	254
PSM	KPMNVGLSETQNGGMSQEAVGNIKVT	163	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51	3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=5216	22.516330477866667	3	2722.302829	2720.310930	Q	K	59	85
PSM	KAEVTEEVEDGKEEDEEEETENSLPIPAS	164	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5816	23.976	3	3231.4314	3231.4314	A	K	308	337
PSM	KASEIMVDDEELAQHPATTEDI	165	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6068	24.622	3	2441.1268	2441.1268	S	R	269	291
PSM	KDGSLEDDEDEEDDLDEGVGGK	166	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5023	21.959	3	2364.9565	2364.9565	G	R	1608	1630
PSM	KDINAYNCEEPTEKLPFPIIDD	167	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	8-UNIMOD:4	ms_run[2]:scan=7159	28.1	3	2620.2367	2620.2367	S	R	84	106
PSM	KEAELENSGLALYDGKDGTDGETEVGEIQQN	168	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6170	24.893	3	3308.5168	3308.5168	L	K	86	117
PSM	KEGICAIGGTSEQSSVGTQHSYSEEE	169	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	5-UNIMOD:4	ms_run[2]:scan=4847	21.411	3	2769.2035	2769.2035	K	K	97	123
PSM	KELQGDGPPSSPTNDPTVKYETQP	170	sp|Q12873-2|CHD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4801	21.266	3	2584.2293	2584.2293	K	R	703	727
PSM	KELSVQDQPSLSPTSLQNSSSHTTTA	171	sp|O95628-3|CNOT4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5300	22.757	3	2742.3308	2742.3308	E	K	404	430
PSM	KGQPVAPYNTTQFLMDDHDQEEPDL	172	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6808	26.729	3	2887.2971	2887.2971	A	K	196	221
PSM	KIPISAFSTSSAAEQNSNTTPRIENQTN	173	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5595	23.453	3	3005.469	3005.4690	M	K	909	937
PSM	KISSIQSIVPALEIANAH	174	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=7141	28.01	2	1890.0575	1890.0575	K	R	250	268
PSM	KLAFPGETLSDIPCKTEEEGVGCGGAG	175	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	14-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=6434	25.634	3	2778.284	2778.2840	D	R	168	195
PSM	KLQEANAQLAEQACPHDVEMTPVQ	176	sp|Q15334|L2GL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	14-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=5079	22.137	3	2722.2691	2722.2691	S	R	684	708
PSM	KLTATPTPLGGMTGFHMQTED	177	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6554	25.962	3	2232.0555	2232.0555	R	R	430	451
PSM	KLYGSAGPPPTGEEDTAEKDEL	178	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4987	21.867	3	2303.0805	2303.0805	S	-	633	655
PSM	KPAEQAEETAPIEATATKEEEGSS	179	sp|Q8N4Q1|MIA40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4727	20.999	3	2502.1609	2502.1609	K	-	119	143
PSM	KPNTPETVEASAVSGKPPNGFSAIY	180	sp|Q6W2J9-3|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6324	25.32	3	2560.2809	2560.2809	F	K	125	150
PSM	KPQISAAQSTQPQKQVVQATAEQM	181	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	24-UNIMOD:35	ms_run[2]:scan=4563	20.393	3	2612.3228	2612.3228	E	R	16	40
PSM	KPSLSQPTAASPIGSSPSPPVNGGNNAK	182	sp|Q9UPQ9-1|TNR6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4853	21.429	3	2659.3566	2659.3566	T	R	44	72
PSM	KQAWPQNSSSCGTEGTFHLPVDTGTEN	183	sp|Q92567-3|F168A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	11-UNIMOD:4	ms_run[2]:scan=6217	25.026	3	2947.3043	2947.3043	M	R	56	83
PSM	KQGSPDQVSPVSEMTSTSLYQDKQEG	184	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5824	23.994	3	2825.3025	2825.3025	G	K	1435	1461
PSM	KTFPTVNPTTGEVIGHVAEGD	185	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=6013	24.465	3	2168.075	2168.0750	K	R	52	73
PSM	KTGQATVASGIPAGWMGLDCGPESSK	186	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6621	26.154	3	2620.2261	2620.2261	A	K	269	295
PSM	KVASTLTEEGGGGGGGGGSVAPKPP	187	sp|Q8TF68-3|ZN384_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=4628	20.642	3	2166.0917	2166.0917	K	R	112	137
PSM	KVIAINVDDPDAANYNDINDVK	188	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5972	24.356	3	2415.1918	2415.1918	W	R	155	177
PSM	KVSEEAESQQQWDTSKGEQVSQNGLPAEQGSP	189	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=5155	22.351	3	3457.587	3457.5870	T	R	2095	2127
PSM	RALASGTEASSTDPGAPGGPGGAEGPMAK	190	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	27-UNIMOD:35	ms_run[2]:scan=4259	19.018	3	2612.2137	2612.2137	G	K	169	198
PSM	READIDGDGQVNYEEFVQMMTAK	191	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	19-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=6266	25.161	3	2677.1636	2677.1636	I	-	127	150
PSM	RLGVPCGEPAELGGDASEEDHPQVCA	192	sp|Q9Y467-3|SALL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	6-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=5596	23.455	3	2749.2072	2749.2072	S	K	10	36
PSM	RNVTVQPDDPISFMQLTAKNEMNC	193	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	14-UNIMOD:35,22-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=6268	25.166	3	2839.2939	2839.2939	K	K	661	685
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	194	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	27-UNIMOD:35	ms_run[2]:scan=5417	23.057	3	2942.3399	2942.3399	M	R	454	482
PSM	RTSSVLGMSVESAPAVEEEKGEELEQ	195	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	8-UNIMOD:35	ms_run[2]:scan=5576	23.416	3	2806.3178	2806.3178	N	K	116	142
PSM	KLTTPTYGDLNHLVSATMSGVTTCL	196	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50	18-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=7231	28.429332608533333	3	2695.324134	2695.319704	L	R	216	241
PSM	KVEEDDYPSEELLEDENAINAK	197	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=6442	25.662140733333334	3	2549.173802	2549.165688	S	R	719	741
PSM	KIDNSQVESGSLEDDWDFLPPK	198	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=7080	27.7617161688	3	2518.187998	2518.186364	V	K	185	207
PSM	KVSTLAGPSSDDENEEESKPE	199	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=4125	18.395801993866666	3	2247.006302	2247.002646	S	K	623	644
PSM	KAPPVDDAEVDELVLQTK	200	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6402	25.543	2	1966.0259	1966.0259	P	R	1314	1332
PSM	KAPTIETVVLYTGETPSEQDQGK	201	sp|Q9BYC8|RM32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6333	25.349	3	2490.249	2490.2490	F	R	150	173
PSM	KATESGAQSAPLPMEGVDISPKQDEGVL	202	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	14-UNIMOD:35	ms_run[2]:scan=5978	24.373	3	2869.4015	2869.4015	M	K	7	35
PSM	KAVLASMDNENMHTPDIGGQGTTSEAIQDVI	203	sp|P51553|IDH3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6458	25.699	3	3273.5129	3273.5129	R	R	350	381
PSM	KCGDYGGALAAYTQALGLDATPQDQAVLH	204	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	2-UNIMOD:4	ms_run[2]:scan=7517	29.798	3	3003.4396	3003.4396	F	R	18	47
PSM	KDQLQTFSEEHPVLLTEAPLNP	205	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7038	27.592	3	2505.2751	2505.2751	S	R	96	118
PSM	KEDEIPETVSLEMLDAAKN	206	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7039	27.595	3	2131.0355	2131.0355	K	K	79	98
PSM	KEGQEENETCSGGNENQELQDGCSEAFEK	207	sp|Q7Z2Z2-2|EFL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=4837	21.376	3	3302.3212	3302.3212	A	R	861	890
PSM	KEILSSPPNDAVGELEQQLK	208	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6871	26.948	3	2194.1481	2194.1481	S	R	120	140
PSM	KELPPPSEEIKTGEDEDEEDNDALL	209	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5881	24.135	3	2811.2822	2811.2822	A	K	531	556
PSM	KEVEETDEMDQVELVDFDPNQER	210	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	9-UNIMOD:35	ms_run[2]:scan=6300	25.256	3	2809.2236	2809.2236	R	R	350	373
PSM	KEVEETDEMDQVELVDFDPNQER	211	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6773	26.612	3	2793.2287	2793.2287	R	R	350	373
PSM	KFQPASAPAEDCISSSTEPKPDP	212	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	12-UNIMOD:4	ms_run[2]:scan=4924	21.668	3	2458.1322	2458.1322	A	K	1102	1125
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	213	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	12-UNIMOD:35	ms_run[2]:scan=3749	16.582	3	2851.1574	2851.1574	E	K	54	81
PSM	KIDNSQVESGSLEDDWDFLPPK	214	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7318	28.855	3	2518.1864	2518.1864	V	K	185	207
PSM	KIPDEEATKPEGWLDDEPEYVPDPDAE	215	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6776	26.623	3	3083.3771	3083.3771	A	K	203	230
PSM	KIQALQTACPDLQLSAASVGNCPTK	216	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	9-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=6095	24.699	3	2670.3469	2670.3469	E	K	763	788
PSM	KLEEDINSSMTNSTAASRPPVTL	217	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:35	ms_run[2]:scan=5468	23.188	3	2476.2115	2476.2115	D	R	78	101
PSM	KLEEDISSSMTNSTAASRPPVTL	218	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:35	ms_run[2]:scan=5527	23.312	3	2449.2006	2449.2006	D	R	78	101
PSM	KLEEDISSSMTNSTAASRPPVTL	219	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:35	ms_run[2]:scan=5529	23.315	3	2449.2006	2449.2006	D	R	78	101
PSM	KLTATPTPLGGMTGFHMQTED	220	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	12-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5177	22.409	3	2264.0453	2264.0453	R	R	430	451
PSM	KLVSDGQALPEMEIHLQTNAE	221	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	12-UNIMOD:35	ms_run[2]:scan=5750	23.832	3	2338.1475	2338.1475	H	K	77	98
PSM	KLYGSAGPPPTGEEDTAEKDEL	222	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=5111	22.232	3	2303.0805	2303.0805	S	-	633	655
PSM	KMIINEELMASLDQPTQTVVMH	223	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	2-UNIMOD:35,9-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=6171	24.895	3	2575.2332	2575.2332	S	R	814	836
PSM	KPGLIGNANMVGLANLHAMGIAPP	224	sp|O43395-3|PRPF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=6593	26.078	3	2387.2454	2387.2454	L	K	85	109
PSM	KPVSSPFPTKPLEGQAEGDSGEC	225	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	23-UNIMOD:4	ms_run[2]:scan=5278	22.706	3	2416.1217	2416.1217	S	K	283	306
PSM	KSAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPST	226	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	10-UNIMOD:35,37-UNIMOD:4	ms_run[2]:scan=5369	22.936	4	4327.9903	4327.9903	V	R	226	268
PSM	KSSEDDAASESFLPSEGASSDPVTLR	227	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=6190	24.952	3	2681.2304	2681.2304	N	R	600	626
PSM	KTAQETSTMTMNVSQVDDVVSSKT	228	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	9-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4873	21.5	3	2618.2051	2618.2051	F	R	1716	1740
PSM	KTASDVVQPAAVQAQGQVNDENR	229	sp|Q9BX40-3|LS14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=4588	20.486	3	2424.1993	2424.1993	S	R	151	174
PSM	KTASNIIDVSAADSQGMEQHEYMD	230	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	17-UNIMOD:35	ms_run[2]:scan=5522	23.301	3	2655.1429	2655.1429	A	R	60	84
PSM	KTGQATVASGIPAGWMGLDCGPESSK	231	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	20-UNIMOD:4	ms_run[2]:scan=6684	26.342	3	2604.2312	2604.2312	A	K	269	295
PSM	KVDEDSAEDTQSNDGKEVVEVGQ	232	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=4467	19.974	3	2477.1041	2477.1041	Q	K	560	583
PSM	KYAPTEAQLNAVDALIDSMSLAK	233	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	19-UNIMOD:35	ms_run[2]:scan=7324	28.879	3	2464.2519	2464.2519	K	K	443	466
PSM	KYGGPPPDSVYSGQQPSVGTEIFVGKIP	234	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7004	27.444	3	2903.4705	2903.4705	R	R	143	171
PSM	READIDGDGQVNYEEFVQMMTAK	235	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	19-UNIMOD:35	ms_run[2]:scan=7282	28.678	3	2661.1687	2661.1687	I	-	127	150
PSM	RGPGNPVPGPLAPLPDYMSEEKLQE	236	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	18-UNIMOD:35	ms_run[2]:scan=6426	25.61	3	2706.3323	2706.3323	Y	K	8	33
PSM	RPELQASPAKPSGETAADSMIPEEEDDEDDEDGGG	237	sp|A0A2Z4LIS9|FXO3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	20-UNIMOD:35	ms_run[2]:scan=4898	21.586	3	3659.5177	3659.5177	Q	R	122	157
PSM	RPPPEPSTPVSGQDDLIQHQDM	238	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	22-UNIMOD:35	ms_run[2]:scan=5026	21.964	3	2459.1387	2459.1387	L	R	1159	1181
PSM	RPVTVEPMDQLDDEEGLPEKLVI	239	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	8-UNIMOD:35	ms_run[2]:scan=6992	27.395	3	2637.3207	2637.3207	P	K	131	154
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	240	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	27-UNIMOD:35	ms_run[2]:scan=5420	23.064	3	2942.3399	2942.3399	M	R	454	482
PSM	KQGSPDQVSPVSEMTSTSLYQDKQEG	241	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49	14-UNIMOD:35	ms_run[1]:scan=4903	21.59912638666667	3	2841.304394	2841.297448	G	K	1435	1461
PSM	KQLSQATAAATNHTTDNGVGPEEESVDPNQYY	242	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=5542	23.339629530666667	3	3435.542467	3434.549851	E	K	46	78
PSM	KDLGLSESGEDVNAAILDESGK	243	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6244	25.107	3	2246.0914	2246.0914	V	K	463	485
PSM	KELFQTPGPSEESMTDEKTT	244	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	14-UNIMOD:35	ms_run[2]:scan=4896	21.58	3	2270.026	2270.0260	F	K	746	766
PSM	KELGGESNFGDALLDAGESMK	245	sp|Q99961|SH3G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	20-UNIMOD:35	ms_run[2]:scan=6454	25.691	3	2183.0052	2183.0052	G	R	102	123
PSM	KEPTQAVVEEQVLDKEEPLPEEQ	246	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6092	24.695	3	2663.3178	2663.3178	K	R	100	123
PSM	KEQVLEPMLNGTDKTPALISDY	247	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	8-UNIMOD:35	ms_run[2]:scan=6487	25.78	3	2477.236	2477.2360	Y	K	952	974
PSM	KGELSDLGAEDGWTMDAEADHSGGSD	248	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	15-UNIMOD:35	ms_run[2]:scan=6006	24.452	3	2665.0722	2665.0722	L	R	549	575
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	249	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	12-UNIMOD:35	ms_run[2]:scan=3846	17.056	3	2851.1574	2851.1574	E	K	54	81
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	250	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	12-UNIMOD:35	ms_run[2]:scan=3935	17.483	3	2851.1574	2851.1574	E	K	54	81
PSM	KIEEAMDGSETPQLFTVLPEK	251	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	6-UNIMOD:35	ms_run[2]:scan=6669	26.294	3	2377.1723	2377.1723	K	R	770	791
PSM	KLPGEGNAGLLGLGPEAAAPGK	252	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6250	25.123	2	2016.1004	2016.1004	N	R	10	32
PSM	KNDQDTWDYTNPNLSGQGDPGSNPNK	253	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5293	22.739	3	2861.2489	2861.2489	F	R	144	170
PSM	KNMTVEQLLTGSPTSPTVEPEKPT	254	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6633	26.19	3	2583.3102	2583.3102	L	R	825	849
PSM	KNYALPSPATTEGGSLTPVRDSPCTP	255	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	24-UNIMOD:4	ms_run[2]:scan=5732	23.785	3	2715.3174	2715.3174	E	R	532	558
PSM	KPLSIEADDNGCFPLDGHVLC	256	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	12-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=6857	26.902	3	2356.0828	2356.0828	G	R	385	406
PSM	KSLMSISNAGSGLLSHSSTLTGSPIMEE	257	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	4-UNIMOD:35	ms_run[2]:scan=6741	26.507	3	2849.3787	2849.3787	A	K	377	405
PSM	KSPISSDQSLSMTSNTILSADRPS	258	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	12-UNIMOD:35	ms_run[2]:scan=5801	23.949	3	2537.2279	2537.2279	S	R	1535	1559
PSM	KSSVSDAPVHITASGEPVPISEESEELDQ	259	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6057	24.581	3	3036.4411	3036.4411	K	K	1383	1412
PSM	KTAPPVTNNSEIQASEVLVAADKE	260	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6121	24.768	3	2510.2864	2510.2864	E	K	2585	2609
PSM	KTGQATVASGIPAGWMGLDCGPESSK	261	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6302	25.26	3	2620.2261	2620.2261	A	K	269	295
PSM	KVAEQCEPAESQPEALSEKEDVC	262	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	6-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=4737	21.033	3	2632.1633	2632.1633	D	K	426	449
PSM	KVVMALGDYMGASCHACIGGTNV	263	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	4-UNIMOD:35,10-UNIMOD:35,14-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=5474	23.201	3	2442.08	2442.0800	Q	R	118	141
PSM	RDGGNPFAEPSELDNPFQDPAVIQH	264	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7168	28.142	3	2749.2732	2749.2732	S	R	5	30
PSM	RDSSTSYTETKDPSSGQEVATPPVPQLQVCEP	265	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	30-UNIMOD:4	ms_run[2]:scan=6262	25.151	3	3489.6206	3489.6206	S	K	662	694
PSM	RELAQNASSDTPMDPVTFIQTLPSDLR	266	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	13-UNIMOD:35	ms_run[2]:scan=7433	29.415	3	3017.4764	3017.4764	R	R	3028	3055
PSM	RLSSGDPSTSPSLSQTTPSKDTDDQS	267	sp|Q99504-2|EYA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=4333	19.358	3	2693.2264	2693.2264	Q	R	127	153
PSM	RNVLLDPQLVPGGGASEMAVAHALTE	268	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	18-UNIMOD:35	ms_run[2]:scan=7246	28.498	3	2660.3592	2660.3592	C	K	361	387
PSM	RQDGSQEAPEAPLSSELEPFHP	269	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6740	26.505	3	2420.1244	2420.1244	T	K	1082	1104
PSM	RQILNSDTIGCCGDDNGLMEVEGAHTS	270	sp|Q69YN4-3|VIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	11-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=5692	23.688	3	2964.2648	2964.2648	M	R	1402	1429
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	271	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	15-UNIMOD:35	ms_run[2]:scan=5258	22.636	3	2942.3399	2942.3399	M	R	454	482
PSM	RSLSFPILNPALSQPSQPSSPLPGSHG	272	sp|Q8ND24-2|RN214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7114	27.887	3	2770.4402	2770.4402	P	R	327	354
PSM	RSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSS	273	sp|Q9HCD5|NCOA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	22-UNIMOD:35	ms_run[2]:scan=6093	24.696	4	3820.8299	3820.8299	Q	R	476	515
PSM	RTEGVGPGVPGEVEMVKGQPFDVGP	274	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	15-UNIMOD:35	ms_run[2]:scan=6251	25.126	3	2553.2533	2553.2533	R	R	16	41
PSM	RVAPAPAAADAEVEQTDAESKDAVPTE	275	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=5122	22.258	3	2737.3042	2737.3042	T	-	666	693
PSM	RGSDELFSTCVTNGPFIMSSNSASAANGNDSK	276	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	10-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=6575	26.0211738776	3	3337.455213	3336.462299	K	K	14	46
PSM	KNLEAVETLGSTSVICSDKTGTLTQN	277	sp|P20648|ATP4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	16-UNIMOD:4	ms_run[1]:scan=5617	23.499546842133334	3	2766.357463	2765.375304	V	R	370	396
PSM	KAPPTLQAETATKPQATSAPSPAP	278	sp|Q96HA1-2|P121A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4683	20.848	3	2359.2383	2359.2383	T	K	412	436
PSM	KASSTSLTSTQPTKTSGVPSGFNFTAPPVLG	279	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6922	27.139	3	3064.5717	3064.5717	N	K	1340	1371
PSM	KEAAGEGPALYEDPPDQKTSPSG	280	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4700	20.907	3	2343.0866	2343.0866	D	K	35	58
PSM	KEAQAVPATLPELEATKASL	281	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6546	25.943	3	2066.1259	2066.1259	L	K	1081	1101
PSM	KEDQPAVPGETQGDSYFTGK	282	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5214	22.513	3	2152.9913	2152.9913	A	K	729	749
PSM	KEEIPEEELAEDVEEIDHAE	283	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7364	29.074	3	2352.0493	2352.0493	Q	R	1078	1098
PSM	KELFQTPGPSEESMTDEKTT	284	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5329	22.835	3	2254.0311	2254.0311	F	K	746	766
PSM	KENVPPGPEVCITHQEGE	285	sp|Q9UHB6-3|LIMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	11-UNIMOD:4	ms_run[2]:scan=4851	21.422	3	2018.9368	2018.9368	Q	K	4	22
PSM	KGATTQNSEICSGQAPTPDQPDTSK	286	sp|Q96RR1|PEO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	11-UNIMOD:4	ms_run[2]:scan=4123	18.385	3	2617.1926	2617.1926	K	R	657	682
PSM	KISATEDTPEAEGEVPELYHQ	287	sp|Q96EK5|KBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5607	23.478	3	2342.0914	2342.0914	G	R	285	306
PSM	KLAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQP	288	sp|Q5SSJ5-5|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5448	23.138	4	4441.978	4441.9780	S	K	56	97
PSM	KLGAASLGAEDPETQVVLINAVKDVA	289	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7447	29.479	3	2607.4119	2607.4119	V	K	2063	2089
PSM	KLSFDSSPTSSTDGHSSYGLDSGFCTIS	290	sp|Q00587-2|BORG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	25-UNIMOD:4	ms_run[2]:scan=6604	26.105	3	2939.2767	2939.2767	G	R	137	165
PSM	KMQAYQYEQISADPDKPLADGI	291	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:35	ms_run[2]:scan=6153	24.85	3	2496.1843	2496.1843	E	R	419	441
PSM	KNASPEDVEYYNCQQELTDDLH	292	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	13-UNIMOD:4	ms_run[2]:scan=6058	24.583	3	2667.1395	2667.1395	L	K	364	386
PSM	KPNIEGAPGAPIGNTFQHVQSLPT	293	sp|O94979-7|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6163	24.875	3	2472.2761	2472.2761	S	K	830	854
PSM	KPTSNPQVVNEGGAKPELASQATEGS	294	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4605	20.56	3	2595.2776	2595.2776	T	K	320	346
PSM	KQEQSDPKSSDASTAQPPESQPLPASQTPASNQP	295	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4526	20.237	4	3532.6554	3532.6554	S	K	89	123
PSM	KQLLFPAEEDNGAGPPRDGDGVPGGGPLSPA	296	sp|Q92888-2|ARHG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6461	25.709	3	3014.4734	3014.4734	L	R	802	833
PSM	KSGDAAIVDMVPGKPMCVESFSDYPPLG	297	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	10-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=6993	27.397	3	2982.3813	2982.3813	L	R	395	423
PSM	KSIEDQLQPNSASGSGALEHDPSSIYL	298	sp|Q9P2D3-3|HTR5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6641	26.209	3	2842.3621	2842.3621	H	R	736	763
PSM	KSISSPSVSSETMDKPVDLST	299	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	13-UNIMOD:35	ms_run[2]:scan=4869	21.487	3	2210.0624	2210.0624	T	R	2801	2822
PSM	KSLSLDPGQSLEPHPEGPQ	300	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5470	23.191	3	2014.996	2014.9960	V	R	113	132
PSM	KSTSCDDTPDGAGGAFAAQPEDCDGEK	301	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	5-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=4654	20.737	3	2785.1079	2785.1079	C	R	71	98
PSM	KVIDPVTGKPCAGTTYLESPLSSETTQLS	302	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	11-UNIMOD:4	ms_run[2]:scan=6552	25.957	3	3078.5431	3078.5431	G	K	90	119
PSM	REANGLPIMESNCFDPSKIQLPEDE	303	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	13-UNIMOD:4	ms_run[2]:scan=7198	28.278	3	2888.3321	2888.3321	Y	-	129	154
PSM	RIQAAASTPTNATAASDANTGDRGQTNNAASASASNST	304	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4134	18.437	4	3620.6647	3620.6647	A	-	383	421
PSM	RNVLLDPQLVPGGGASEMAVAHALTE	305	sp|P49368-2|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7419	29.343	3	2644.3643	2644.3643	C	K	361	387
PSM	RNVTVQPDDPISFMQLTAKNEMNC	306	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	22-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=7119	27.912	3	2823.299	2823.2990	K	K	661	685
PSM	RPTSAPAITQGQVAEGGVLDASAK	307	sp|P11171-4|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5333	22.845	3	2323.2132	2323.2132	P	K	348	372
PSM	RQILLGPNTGLSGGMPGALPSLPGKI	308	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=7271	28.624	3	2543.4258	2543.4258	Q	-	117	143
PSM	RSPDVGLYGVIPECGETYHSDLAEA	309	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	14-UNIMOD:4	ms_run[2]:scan=6805	26.724	3	2734.2545	2734.2545	L	K	647	672
PSM	RTPQTVAGYTIPPGHQVCVSPTVNQ	310	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	18-UNIMOD:4	ms_run[2]:scan=5496	23.242	3	2706.3548	2706.3548	A	R	286	311
PSM	RLQAALDDEEAGGRPAMEPGNGSLDLGGDSAG	311	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=6115	24.7461574176	3	3126.423486	3125.431984	E	R	37	69
PSM	KPSTDLSAPVNGEATSQKGESAED	312	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=4332	19.354393450666667	3	2418.113070	2417.119407	D	K	593	617
PSM	KANDGGLAAGAPAMHMASYGPEPCTDNSDSLIA	313	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	14-UNIMOD:35,16-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=5623	23.519	3	3320.4384	3320.4384	A	K	62	95
PSM	KAPVQPQQSPAAAPGGTDEKPSG	314	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=3868	17.161	3	2217.1026	2217.1026	D	K	8	31
PSM	KAQTSTDAPTSAPSAPPSTPTPSAGK	315	sp|Q8IWZ8-2|SUGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4155	18.524	3	2452.2082	2452.2082	Q	R	98	124
PSM	KCQNEQLQTAVTQQVSQIQQH	316	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	2-UNIMOD:4	ms_run[2]:scan=5903	24.191	3	2495.2187	2495.2187	L	K	677	698
PSM	KDEENDALLGGPAQLTDEEKY	317	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6256	25.138	3	2334.0863	2334.0863	H	R	1253	1274
PSM	KDIDLICSNALEYNPDKDPGD	318	sp|Q9ULI0-2|ATD2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	7-UNIMOD:4	ms_run[2]:scan=6432	25.629	3	2391.09	2391.0900	L	K	1020	1041
PSM	KDVPGGGPSSSAPAGAEADGPKASPEA	319	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4181	18.653	3	2406.1299	2406.1299	A	R	250	277
PSM	KEAALTSEEVGADLEQVEVLQK	320	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6940	27.209	3	2385.2275	2385.2275	E	K	1090	1112
PSM	KEDEIPETVSLEMLDAAKN	321	sp|Q96A26|F162A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	13-UNIMOD:35	ms_run[2]:scan=6203	24.996	3	2147.0304	2147.0304	K	K	79	98
PSM	KEDSGSVPSTGPSQGTPISLK	322	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4892	21.571	3	2071.0433	2071.0433	P	R	850	871
PSM	KEELMSSDLEETAGSTSIPK	323	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	5-UNIMOD:35	ms_run[2]:scan=5168	22.386	3	2167.0202	2167.0202	S	R	514	534
PSM	KEVEELEQLTQQLMQDMEHPQ	324	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	14-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=7210	28.334	3	2614.1891	2614.1891	L	R	197	218
PSM	KGVNLPGAAVDLPAVSEKDIQDL	325	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7229	28.419	3	2348.2587	2348.2587	K	K	192	215
PSM	KIAVEPVNPSELPKMLDGL	326	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	15-UNIMOD:35	ms_run[2]:scan=6934	27.191	3	2065.1129	2065.1129	I	R	554	573
PSM	KIEDVPAPSTSADKVESLDVDSEA	327	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5589	23.44	3	2501.2021	2501.2021	D	K	20	44
PSM	KMEEQTEILQNGFNPEEDKCNNCDQELN	328	sp|Q9H8H0|NOL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	2-UNIMOD:35,20-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=5787	23.915	3	3441.4395	3441.4395	E	K	538	566
PSM	KMIDAGDALIYMEPEKQVMS	329	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	2-UNIMOD:35,12-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5573	23.411	3	2316.0688	2316.0688	K	R	443	463
PSM	KMIINEELMASLDQPTQTVVMH	330	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	2-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=6822	26.779	3	2559.2383	2559.2383	S	R	814	836
PSM	KNEQQLFYISQPGSSVVTSLSPGEAVK	331	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6930	27.168	3	2892.4869	2892.4869	T	K	255	282
PSM	KPQTSGYTCNIPTESNLDSGEH	332	sp|Q03188|CENPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	9-UNIMOD:4	ms_run[2]:scan=5029	21.97	3	2434.0707	2434.0707	L	K	655	677
PSM	KQTSEGANSTTDSIQEPVVLFHS	333	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6332	25.347	3	2474.1925	2474.1925	G	R	1563	1586
PSM	KSPGPGPGPGAGAEPGATGGSSHFISS	334	sp|Q9ULI0-2|ATD2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4781	21.197	3	2363.1142	2363.1142	S	R	15	42
PSM	KSPVLSNTTTEPASTMSPPPAK	335	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	16-UNIMOD:35	ms_run[2]:scan=4222	18.856	3	2256.1308	2256.1308	L	K	666	688
PSM	KTGAPQYGSYGTAPVNLNIKTGG	336	sp|Q6UN15-4|FIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5633	23.536	3	2293.1703	2293.1703	I	R	89	112
PSM	KTGQATVASGIPAGWMGLDCGPESSK	337	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	20-UNIMOD:4	ms_run[2]:scan=6797	26.696	3	2604.2312	2604.2312	A	K	269	295
PSM	KTPLLGDGPRAPFNQEGQSTGPPPLIPGLGQQGAQG	338	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7028	27.553	4	3579.8434	3579.8434	Q	R	906	942
PSM	KTVTSGSIQPVTQAPQAGQMVDTK	339	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	20-UNIMOD:35	ms_run[2]:scan=4579	20.452	3	2487.2639	2487.2639	L	R	560	584
PSM	KVEEQEPELTSTPNFVVEVIKNDDG	340	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7388	29.191	3	2815.3763	2815.3763	Q	K	154	179
PSM	KVNGASVVMVQPSKTATGPSTGGGTVIS	341	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	9-UNIMOD:35	ms_run[2]:scan=4915	21.637	3	2645.3694	2645.3694	Q	R	464	492
PSM	KVQDTSNTGLGEDIIHQLS	342	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6813	26.751	3	2054.028	2054.0280	E	K	791	810
PSM	KVSVTPPEESQNSDTPPRPD	343	sp|Q05209-2|PTN12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4431	19.808	3	2179.0393	2179.0393	N	R	375	395
PSM	KVVDYSQFQESDDADEDYGRDSGPPT	344	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5433	23.096	3	2919.2319	2919.2319	R	K	9	35
PSM	KVVPSFLPVDQGGSLVGRNGVGGMA	345	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	24-UNIMOD:35	ms_run[2]:scan=6629	26.182	3	2456.2846	2456.2846	D	K	667	692
PSM	RAEETSSPVIGELWSPDQTAEASHVS	346	sp|Q86XL3-2|ANKL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6698	26.376	3	2782.3046	2782.3046	L	R	482	508
PSM	RAPSPAPSSVPLGSEKPSNVSQD	347	sp|O75179-4|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=4672	20.811	3	2306.1503	2306.1503	V	R	1805	1828
PSM	RDPVQVAAPSDHGVGIEPVFPENTENSE	348	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6374	25.465	3	2989.4054	2989.4054	L	K	536	564
PSM	REEYQPATPGLGMFVEVKDPED	349	sp|Q9BVK6|TMED9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	13-UNIMOD:35	ms_run[2]:scan=6464	25.717	3	2522.1635	2522.1635	Q	K	73	95
PSM	RETVVEVPQVTWEDIGGLEDVK	350	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7383	29.169	3	2497.27	2497.2700	L	R	465	487
PSM	RMLSSTPPTPIACAPSAVNQAAPHQQN	351	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	2-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=5148	22.327	3	2859.3756	2859.3756	M	R	2288	2315
PSM	RPENTPEPVSTSVSHYGAEPTTVSPCPSSSA	352	sp|P07947|YES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	26-UNIMOD:4	ms_run[2]:scan=5129	22.277	3	3227.4677	3227.4677	Y	K	17	48
PSM	RPGVATPLVSSSDYMPMAPQNVSASK	353	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	17-UNIMOD:35	ms_run[2]:scan=5889	24.154	3	2705.3153	2705.3153	M	K	704	730
PSM	RQGAEGAPSPNYDDDDDERADDTLFMM	354	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	26-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=5689	23.682	3	3062.2142	3062.2142	L	K	444	471
PSM	RSLQTTSPPVVAPGNENGLAVPVPLR	355	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6512	25.857	3	2668.466	2668.4660	D	K	386	412
PSM	KIDNSQVESGSLEDDWDFLPPK	356	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=7207	28.31876873306667	3	2518.187998	2518.186364	V	K	185	207
PSM	KVEYPIMYSTDPENGHIFNCIQ	357	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	7-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=6601	26.096273219733334	3	2670.210578	2670.209425	Y	R	37	59
PSM	RGSDELFSTCVTNGPFIMSSNSASAANGNDSK	358	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	10-UNIMOD:4	ms_run[1]:scan=6968	27.312719279466666	3	3323.461221	3320.467384	K	K	14	46
PSM	KAIEPPPLDAVIEAEHTL	359	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7362	29.063	3	1942.0411	1942.0411	A	R	819	837
PSM	KALLYTAVNQLAMGSSSAEDEKNTAL	360	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	13-UNIMOD:35	ms_run[2]:scan=6888	27.01	3	2740.3589	2740.3589	K	K	1231	1257
PSM	KASLNPSDTPPSVVNEDFLHDL	361	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7245	28.496	3	2394.1703	2394.1703	S	K	147	169
PSM	KASLQSQLPEGVPQHQLPPQYQ	362	sp|Q15750-2|TAB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5597	23.458	3	2472.2761	2472.2761	E	K	128	150
PSM	KDINTFEQIDDYNPDTAMPAHS	363	sp|Q9UQ84-4|EXO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	18-UNIMOD:35	ms_run[2]:scan=6024	24.49	3	2537.1016	2537.1016	N	R	330	352
PSM	KEAEEEELEIPPQYQAGGSGIH	364	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5837	24.027	3	2410.1288	2410.1288	Q	R	1099	1121
PSM	KEDVSTLIGDDLASCKDETDESS	365	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:4	ms_run[2]:scan=6403	25.546	3	2513.0963	2513.0963	I	K	194	217
PSM	KEEEEDGQEGSIHNLPLVTSQ	366	sp|O75717-2|WDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5673	23.642	3	2338.0925	2338.0925	L	R	274	295
PSM	KEENSEESGTGDTSLAGQQLDSHAL	367	sp|Q96Q07-3|BTBD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5411	23.042	3	2602.1631	2602.1631	Q	R	496	521
PSM	KEFQDAGEQVVSSPADVAEKAD	368	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5222	22.532	3	2319.0866	2319.0866	C	R	76	98
PSM	KEQSLPSVMGSVPEGVLEDIKA	369	sp|Q9NZ32|ARP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	9-UNIMOD:35	ms_run[2]:scan=6916	27.111	3	2328.1883	2328.1883	A	R	191	213
PSM	KEVEPEPTEDKDLEADEEDT	370	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4661	20.766	3	2316.9969	2316.9969	T	R	42	62
PSM	KEVVVYLDDNQKPPVGEGLN	371	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5821	23.988	3	2212.1376	2212.1376	R	R	780	800
PSM	KFEDQPEGIDLEVVTESTGKE	372	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6618	26.146	3	2349.1224	2349.1224	E	R	395	416
PSM	KGALDTTDGYMGVNQAPEKLD	373	sp|Q9UPN3-5|MACF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	11-UNIMOD:35	ms_run[2]:scan=5112	22.235	3	2238.0474	2238.0474	E	K	2221	2242
PSM	KGGAAPEGPNEAEVTSGKPEQEVPDAEEE	374	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4753	21.094	3	2950.3316	2950.3316	A	K	214	243
PSM	KGPLIAPGPDGAPAKGDGPVGLGTPGG	375	sp|P48029|SC6A8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5593	23.449	3	2352.2438	2352.2438	K	R	19	46
PSM	KGPVPAATNGCTGDANGHLQEEPPMPTT	376	sp|Q9NPH2-2|INO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	11-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=4664	20.779	3	2862.2913	2862.2913	K	-	403	431
PSM	KIAVYSCPFDGMITETKGTVLI	377	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=6995	27.404	3	2458.2488	2458.2488	A	K	165	187
PSM	KNMTVEQLLTGSPTSPTVEPEKPT	378	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	3-UNIMOD:35	ms_run[2]:scan=6126	24.778	3	2599.3051	2599.3051	L	R	825	849
PSM	KPTQGASSASEPQEAPPKPAED	379	sp|O96005-3|CLPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3813	16.9	3	2221.0499	2221.0499	T	K	542	564
PSM	KSMTEAEQQQLIDDHFLFD	380	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	3-UNIMOD:35	ms_run[2]:scan=6973	27.33	3	2310.0474	2310.0474	L	K	177	196
PSM	KSPSDPSHVSVPPPPLLLPAATT	381	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6790	26.675	3	2307.2474	2307.2474	I	R	633	656
PSM	KSSSLEMTPYNTPQLSPATTPANK	382	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5559	23.374	3	2562.2636	2562.2636	G	K	451	475
PSM	KTASNIIDVSAADSQGMEQHEYMD	383	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	17-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=5189	22.443	3	2671.1378	2671.1378	A	R	60	84
PSM	KTETVEEPMEEEEAAKEE	384	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	9-UNIMOD:35	ms_run[2]:scan=4253	18.995	3	2122.91	2122.9100	S	K	285	303
PSM	KTPVVQNAASIVQPSPAHVGQQGLS	385	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5412	23.044	3	2512.3398	2512.3398	Q	K	199	224
PSM	KTVIGELPPASSGSALAANVCK	386	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	21-UNIMOD:4	ms_run[2]:scan=5859	24.077	3	2169.1464	2169.1464	L	K	111	133
PSM	KVSGTLDTPEKTVDSQGPTPVCTPTFLE	387	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	22-UNIMOD:4	ms_run[2]:scan=6475	25.747	3	3003.4747	3003.4747	K	R	216	244
PSM	KYQMGDQNVYPGPIDNSGLLKDGDAQSL	388	sp|Q9Y4E8-4|UBP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	4-UNIMOD:35	ms_run[2]:scan=6506	25.84	3	3038.4291	3038.4291	D	K	52	80
PSM	RELQTSSAGLEEPPLPEDHQEEDDNLQ	389	sp|Q9BQ95-3|ECSIT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5590	23.442	3	3075.3905	3075.3905	T	R	184	211
PSM	REVSDGIIAPGYEEEALTILSK	390	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7515	29.791	3	2389.2377	2389.2377	S	K	334	356
PSM	RGQVPGYPPSQNPGMTLPHYPYGDGN	391	sp|O95429-2|BAG4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:35	ms_run[2]:scan=5647	23.568	3	2814.282	2814.2820	L	R	165	191
PSM	RGVLSQAMVMCASSPEKIEILAPPNGSVPGD	392	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	8-UNIMOD:35,10-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6555	25.964	3	3241.5781	3241.5781	M	R	219	250
PSM	RISLEQPPNGSDTPNPEKYQESPGIQM	393	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	27-UNIMOD:35	ms_run[2]:scan=5490	23.23	3	3027.4244	3027.4244	D	K	693	720
PSM	RIVEDAPPIDLQAEAQHASGEVEEPP	394	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6424	25.603	3	2796.3566	2796.3566	Q	R	57	83
PSM	RMGQAPSQSLLPPAQDQPRSPVPSAFSDQS	395	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	2-UNIMOD:35	ms_run[2]:scan=6113	24.74	3	3194.5415	3194.5415	S	R	2430	2460
PSM	RMVITAPPVTNQPVTPKALTAGQN	396	sp|Q7Z7C8|TAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	2-UNIMOD:35	ms_run[2]:scan=5498	23.251	3	2519.353	2519.3530	Q	R	116	140
PSM	RPAAPANNPPPPSLMSTTQSRPPWMNSGPSES	397	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	15-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=5336	22.857	4	3390.5721	3390.5721	P	R	345	377
PSM	RPLEGSSSEDSPPEGQAPPSHSP	398	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4161	18.554	3	2344.0567	2344.0567	A	R	1835	1858
PSM	RSLNAASAMGPAPLISTPPSRPPQV	399	sp|Q01826|SATB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	9-UNIMOD:35	ms_run[2]:scan=5800	23.947	3	2530.3326	2530.3326	E	K	450	475
PSM	RWVYPLTPEANFTDSTTQSCTHS	400	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	20-UNIMOD:4	ms_run[2]:scan=6721	26.442	3	2697.2129	2697.2129	R	R	316	339
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	401	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	15-UNIMOD:35	ms_run[1]:scan=5230	22.5532114872	3	2942.347245	2942.339939	M	R	454	482
PSM	KVLDGLTAGSSSASQQQQQQHPPGN	402	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=4650	20.725172106133336	3	2562.240091	2562.242256	R	R	8	33
PSM	RPSVPPPPQPPGVHSAGDSSLTNTAPTAS	403	sp|Q68EM7|RHG17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=5173	22.3986000008	3	2821.408009	2821.399485	N	K	806	835
PSM	KGSPLNAAPYGIESMSQDTEVRS	404	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	15-UNIMOD:35	ms_run[1]:scan=5313	22.7904994504	3	2453.158671	2452.154018	E	R	350	373
PSM	KAFLASPEYVNLPINGNGKQ	405	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6486	25.778	3	2159.1375	2159.1375	L	-	191	211
PSM	KAPPVDDAEVDELVLQTK	406	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6399	25.536	3	1966.0259	1966.0259	P	R	1314	1332
PSM	KASEIMVDDEELAQHPATTEDI	407	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	6-UNIMOD:35	ms_run[2]:scan=5697	23.698	3	2457.1217	2457.1217	S	R	269	291
PSM	KATGSPVSIFVYDVKPGAEEQTQVA	408	sp|Q96KG9-5|SCYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6824	26.788	3	2620.3384	2620.3384	K	K	37	62
PSM	KDLSEVSETTESTDVKDSSEASDSAS	409	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4522	20.216	3	2703.173	2703.1730	S	-	195	221
PSM	KDSETVDEDEEVDPALTVGTIK	410	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5974	24.36	3	2389.1384	2389.1384	Q	K	1008	1030
PSM	KEEIEASNIDNVVLDEDRSGA	411	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6124	24.774	3	2302.0925	2302.0925	E	R	102	123
PSM	KGGAAPEGPNEAEVTSGKPEQEVPDAEEE	412	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4876	21.515	3	2950.3316	2950.3316	A	K	214	243
PSM	KGQIIGNFQAFDEDTGLPAHA	413	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6830	26.807	3	2228.0862	2228.0862	S	R	406	427
PSM	KGSLGQGTAPVLPGKTGPTVTQV	414	sp|Q13428-5|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5397	23.004	3	2192.2165	2192.2165	V	K	732	755
PSM	KIGPILDTNALQGEVKPVLQ	415	sp|P30154-5|2AAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6855	26.895	3	2132.2205	2132.2205	Q	K	431	451
PSM	KIQIASESSGIPERPCVLTGTPESIEQA	416	sp|Q96I24-2|FUBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	16-UNIMOD:4	ms_run[2]:scan=6310	25.282	3	2996.5125	2996.5125	C	K	50	78
PSM	KLMSSNSTDLPLNIECFMNDKDVSG	417	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:35,16-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=6778	26.632	3	2846.2772	2846.2772	K	K	275	300
PSM	KLPGEGNAGLLGLGPEAAAPGK	418	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6246	25.113	3	2016.1004	2016.1004	N	R	10	32
PSM	KLQVELDNVTGLLSQSDSKSS	419	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6983	27.365	3	2247.1594	2247.1594	T	K	1277	1298
PSM	KMILIQDGSQNTNVDKPL	420	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	2-UNIMOD:35	ms_run[2]:scan=5164	22.377	3	2029.0514	2029.0514	V	R	266	284
PSM	KNALPPVLTTVNGQSPPEHSAPA	421	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5585	23.435	3	2324.2125	2324.2125	T	K	129	152
PSM	KPVPAAPVPSPVAPAPVPSR	422	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5065	22.098	3	1933.1149	1933.1149	E	R	76	96
PSM	KQPGPVTNGQLQQPTTGAASGGYIK	423	sp|O00161|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4935	21.699	3	2497.2925	2497.2925	S	R	117	142
PSM	KQSSTPGSLFLSPPAPAPKNGSSSDSSVGE	424	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5945	24.292	3	2915.4149	2915.4149	E	K	8	38
PSM	KSSSLEMTPYNTPQLSPATTPANK	425	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:35	ms_run[2]:scan=5125	22.266	3	2578.2585	2578.2585	G	K	451	475
PSM	KSTDSSSYPSPCASPSPPSSGKGS	426	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	12-UNIMOD:4	ms_run[2]:scan=4163	18.564	3	2354.0332	2354.0332	L	K	1254	1278
PSM	KSVTIQAPGEPLLDNESTRGDE	427	sp|Q9ULK5|VANG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5663	23.62	3	2355.1554	2355.1554	D	R	42	64
PSM	KTILTLTGVSTLGDVKNNQESDCVS	428	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	23-UNIMOD:4	ms_run[2]:scan=6498	25.81	3	2678.3433	2678.3433	L	K	275	300
PSM	KTVSSPPTSPRPGSAATVSASTSNIIPP	429	sp|O76094-2|SRP72_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5335	22.85	3	2706.4188	2706.4188	S	R	556	584
PSM	KTYNTDVPLVLMNSFNTDEDTK	430	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	12-UNIMOD:35	ms_run[2]:scan=6667	26.287	3	2560.2003	2560.2003	N	K	140	162
PSM	KVEEAEPEEFVVEKVLD	431	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7015	27.493	3	1987.999	1987.9990	K	R	21	38
PSM	KVLSSAASLPGSELPSSRPEGSQGGELS	432	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5487	23.227	3	2726.3723	2726.3723	P	R	2264	2292
PSM	KVQQYCYELAPDQGLQPADQPTDMR	433	sp|Q5TKA1-3|LIN9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	6-UNIMOD:4,24-UNIMOD:35	ms_run[2]:scan=5664	23.622	3	2966.3539	2966.3539	H	R	373	398
PSM	KVTEGLTDVILYHQPDD	434	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6530	25.912	2	1941.9684	1941.9684	S	K	265	282
PSM	KVVVPIYCTSFLAVEEDKQQ	435	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	8-UNIMOD:4	ms_run[2]:scan=7003	27.441	3	2352.2035	2352.2035	Q	K	239	259
PSM	RADGSGYGSTLPPEKLPYLVELSPDGSDS	436	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7219	28.37	3	3006.4458	3006.4458	E	R	368	397
PSM	READIDGDGQVNYEEFVQMMTAK	437	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	20-UNIMOD:35	ms_run[2]:scan=6812	26.747	3	2661.1687	2661.1687	I	-	127	150
PSM	RGPGNPVPGPLAPLPDYMSEEKLQE	438	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6945	27.225	3	2690.3374	2690.3374	Y	K	8	33
PSM	RIGQELLFPPQENVQDAGAPGGHTQNL	439	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6538	25.928	3	2885.442	2885.4420	Q	R	824	851
PSM	RNPTASAAPLGTTLAVQAVPTAHSIVQAT	440	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6770	26.604	3	2842.5301	2842.5301	Q	R	856	885
PSM	RPEPEGEAMDAELAVAPPGCSHLGSF	441	sp|Q9UPT9|UBP22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	9-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6415	25.581	3	2739.2269	2739.2269	S	K	4	30
PSM	RTSTSAVPNLFVPLNTNPKEVQEM	442	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7044	27.618	3	2671.364	2671.3640	H	R	479	503
PSM	RVAVNALAVGEPGTASKPASPIGGPTQEE	443	sp|Q96L91-3|EP400_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5602	23.468	3	2802.4512	2802.4512	G	K	1640	1669
PSM	RVIISAPSADAPMFVMGVNHE	444	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	16-UNIMOD:35	ms_run[2]:scan=6476	25.75	3	2256.1031	2256.1031	K	K	76	97
PSM	RVLESTPAESSEGLDPKDATDPVY	445	sp|Q8TEU7-5|RPGF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5618	23.502	3	2575.229	2575.2290	Q	K	1461	1485
PSM	KSGTTSESGALSLEPSHIGDLQ	446	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5947	24.296608395466667	3	2213.082607	2213.081171	L	K	581	603
PSM	KGGPGSAVSPYPTFNPSSDVAALH	447	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=6380	25.479139769333337	3	2356.157146	2355.149525	S	K	29	53
PSM	KEAAEAIEAEGATAPLTELLHS	448	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=7267	28.602318927733332	3	2251.144886	2250.137957	D	R	625	647
PSM	KAAEAGGAEEQYGFLTTPTKQLGAQSPG	449	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6152	24.846	3	2806.3774	2806.3774	D	R	1051	1079
PSM	KAAILETAPKEVPMVVVPPVGA	450	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:35	ms_run[2]:scan=6455	25.693	3	2231.2599	2231.2599	S	K	166	188
PSM	KAEVDMDTDAPQVSH	451	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4423	19.772	2	1641.7305	1641.7305	D	K	933	948
PSM	KAGDNIPEEQPVASTPTTVSDGENK	452	sp|Q9Y320-2|TMX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4682	20.845	3	2583.23	2583.2300	S	K	231	256
PSM	KAIEDEGGNPDEIEITSEGNK	453	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4957	21.763	3	2244.0394	2244.0394	K	K	63	84
PSM	KDLLLTSSYLSDSGSTGEHT	454	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6139	24.812	3	2110.0066	2110.0066	N	K	295	315
PSM	KDMQPSMESDMALVKDMELPTE	455	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	3-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5211	22.509	3	2588.1002	2588.1002	A	K	290	312
PSM	KDPLPPLDPQAIKPIL	456	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7161	28.109	3	1754.0342	1754.0342	N	K	2579	2595
PSM	KDSGPLSDPITGKPYVPLLEAEEV	457	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7395	29.224	3	2553.3214	2553.3214	G	R	349	373
PSM	KDTSEDIEELVEPVAAHGP	458	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6937	27.201	3	2034.9746	2034.9746	L	K	915	934
PSM	KDTYPPSASVVGASVGGH	459	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4848	21.414	3	1727.8479	1727.8479	D	R	219	237
PSM	KEGEEPTVYSDEEEPKDESA	460	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4390	19.619	3	2266.9601	2266.9601	L	R	120	140
PSM	KEGMNPSYDEYADSDEDQHDAYLE	461	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	4-UNIMOD:35	ms_run[2]:scan=5331	22.839	3	2836.093	2836.0930	L	R	431	455
PSM	KEVDEGPSPPEQFTAVKLSDS	462	sp|Q14331|FRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5895	24.172	3	2259.0907	2259.0907	H	R	85	106
PSM	KGALDTTDGYMGVNQAPEKLD	463	sp|Q9UPN3-5|MACF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5606	23.476	3	2222.0525	2222.0525	E	K	2221	2242
PSM	KGAQAMQFGQPLVFDMAYENYMK	464	sp|Q7L0Y3|TM10C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	6-UNIMOD:35,16-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=6653	26.249	3	2714.2179	2714.2179	W	R	194	217
PSM	KIIAEGANGPTTPEADKIFLE	465	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6379	25.477	3	2213.158	2213.1580	A	R	232	253
PSM	KLLNGPGDVETGTSITVPQK	466	sp|Q9HC07-2|TM165_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5423	23.069	3	2053.1055	2053.1055	T	K	145	165
PSM	KLSPATPTSEGPKVVSVQLGDGT	467	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5537	23.331	3	2267.2009	2267.2009	L	R	372	395
PSM	KLTATPTPLGGMTGFHMQTED	468	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	12-UNIMOD:35	ms_run[2]:scan=5807	23.959	3	2248.0504	2248.0504	R	R	430	451
PSM	KLVGVVPGPVGEPADSDK	469	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5213	22.512	3	1762.9465	1762.9465	G	R	206	224
PSM	KMADPQSIQESQNLSMFLANHN	470	sp|Q96F07-2|CYFP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	2-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6519	25.877	3	2534.153	2534.1530	R	R	197	219
PSM	KMVSSLPSTADPSHQTMPAN	471	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	2-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=4179	18.642	3	2129.9722	2129.9722	P	K	337	357
PSM	KMVVPGLDGAQIPRDPSQQELP	472	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	2-UNIMOD:35	ms_run[2]:scan=6213	25.018	3	2390.2264	2390.2264	L	R	1158	1180
PSM	KPFDQTTISLQMGTNKGASQAGMLAPGT	473	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	12-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=5680	23.661	3	2881.395	2881.3950	D	R	151	179
PSM	KQSSMTVMEAQESPLFNNVKLQ	474	sp|Q9BRG1|VPS25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6182	24.929	3	2540.2251	2540.2251	H	R	45	67
PSM	KSGDAAIVDMVPGKPMCVESFSDYPPLG	475	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	10-UNIMOD:35,16-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=6678	26.324	3	2998.3762	2998.3762	L	R	395	423
PSM	KSPSMAQDSGASELLPNGDLEK	476	sp|Q9Y6K1-3|DNM3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:35	ms_run[2]:scan=5337	22.859	3	2289.0795	2289.0795	S	R	74	96
PSM	KSSVQEECVSTISSSKDEDPLAAT	477	sp|Q7L0Y3|TM10C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	8-UNIMOD:4	ms_run[2]:scan=5338	22.861	3	2567.1909	2567.1909	M	R	71	95
PSM	KSVESTSPEPSKIMLVEPPVA	478	sp|P18583-6|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:35	ms_run[2]:scan=5783	23.906	3	2240.161	2240.1610	L	K	277	298
PSM	KTEAASDPQHPAASEGAAAAAASPPLL	479	sp|Q99536-3|VAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5551	23.352	3	2528.2507	2528.2507	P	R	22	49
PSM	KTEGDEEAEEEQEENLEASGDYKYSG	480	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5134	22.291	3	2935.2003	2935.2003	Y	R	9	35
PSM	KTGQATVASGIPAGWMGLDCGPESSK	481	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6037	24.523	3	2620.2261	2620.2261	A	K	269	295
PSM	KTVDSQGPTPVCTPTFLER	482	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	12-UNIMOD:4	ms_run[2]:scan=5862	24.084	3	2132.0572	2132.0572	E	R	226	245
PSM	KVFTGLAAPSLDTTGCCNHVDGMA	483	sp|Q9H6R7-3|WDCP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	16-UNIMOD:4,17-UNIMOD:4,23-UNIMOD:35	ms_run[2]:scan=5907	24.196	3	2537.1349	2537.1349	L	-	211	235
PSM	KVVPTPNNGSTELVALH	484	sp|Q9HD20-2|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5325	22.824	3	1774.9577	1774.9577	V	R	25	42
PSM	KYTPPTQPPISPPYQEACTLK	485	sp|Q9UET6-2|TRM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	18-UNIMOD:4	ms_run[2]:scan=5612	23.488	3	2415.2144	2415.2144	Y	R	259	280
PSM	RAAPSTAPAEATPPKPGEAEAPP	486	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4437	19.839	3	2212.1124	2212.1124	E	K	395	418
PSM	RAENGLLMTPCYTANFVAPEVLK	487	sp|Q15418-3|KS6A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=7052	27.649	3	2609.2982	2609.2982	L	R	473	496
PSM	RAPTCSLDGALPLGAQIPAVH	488	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:4	ms_run[2]:scan=6755	26.554	3	2143.1208	2143.1208	R	R	39	60
PSM	RDGEDQTQDTELVETRPAGDGTFQ	489	sp|P10321-2|HLAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5289	22.733	3	2664.1899	2664.1899	Q	K	243	267
PSM	RDGMEYPFIGEGEPHVDGEPGDL	490	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	4-UNIMOD:35	ms_run[2]:scan=6751	26.543	3	2531.0911	2531.0911	V	R	217	240
PSM	RELLILQGGPPQSCTDVKTQM	491	sp|Q9C0B7|TNG6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:4,21-UNIMOD:35	ms_run[2]:scan=5922	24.245	3	2386.1985	2386.1985	V	R	273	294
PSM	REPVSVGTPSEGEGLGADGQEH	492	sp|Q8IX01-4|SUGP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4718	20.971	3	2207.0091	2207.0091	I	K	986	1008
PSM	RGAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGP	493	sp|O96013-3|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	23-UNIMOD:4	ms_run[2]:scan=6286	25.217	3	3374.7194	3374.7194	A	R	101	137
PSM	RLPVIEPVSINEENEGFEHNTQV	494	sp|Q9NXX6|NSE4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6620	26.151	3	2649.3035	2649.3035	D	R	325	348
PSM	RPAAPVLPTNTVSSAKPGPALV	495	sp|Q9ULH7-2|MRTFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5845	24.045	3	2142.2161	2142.2161	P	K	204	226
PSM	RSDGSGESAQPPEDSSPPASSESSSTRDSAVAISGADS	496	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=4666	20.788	4	3664.5845	3664.5845	G	R	2903	2941
PSM	RSPTEQEEPDPANLEVDHDFFQD	497	sp|Q96CU9-2|FXRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6794	26.687	3	2714.1732	2714.1732	G	K	152	175
PSM	RSSIEDAQCPGLPDLIEENHVVN	498	sp|Q15398-1|DLGP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	9-UNIMOD:4	ms_run[2]:scan=6720	26.439	3	2591.2286	2591.2286	S	K	607	630
PSM	RVIISAPSADAPMFVMGVNHE	499	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6005	24.451	3	2272.098	2272.0980	K	K	76	97
PSM	KLASQGDSISSQLGPIHPPP	500	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=5707	23.724897602133336	3	2028.070065	2028.064004	K	R	122	142
PSM	KPAEATAGSGGVNGGEEQGLGK	501	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3993	17.747174796000003	3	2013.961971	2012.976312	E	R	130	152
PSM	KSDGGYTYDTSDLAAIKQ	502	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=5567	23.395276936266665	3	1931.912344	1931.911252	V	R	377	395
PSM	RGSDELLSGSVLSSPNSNMSSMVVTANGNDSK	503	sp|Q9UKA9|PTBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	19-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=5846	24.047020226666667	3	3272.484191	3271.493264	K	K	14	46
PSM	RENDMSPSNNVVPIHVPPTTEN	504	sp|P62491|RB11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	5-UNIMOD:35	ms_run[1]:scan=5284	22.722693642933333	3	2462.149160	2462.149602	R	K	185	207
PSM	KAAAPAPEEEMDECEQALAAEPKA	505	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=5054	22.065	3	2571.1469	2571.1469	K	K	253	277
PSM	KAAEAAAAPAESAAPAAGEEPSKEEGEP	506	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4324	19.318	3	2635.2249	2635.2249	P	K	121	149
PSM	KALVLDCHYPEDEVGQEDEAESDIFSI	507	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	7-UNIMOD:4	ms_run[2]:scan=7307	28.8	3	3107.3917	3107.3917	K	R	180	207
PSM	KDCGSVDGVIKEVNVSPCPTQPCQLS	508	sp|P61916-2|NPC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4,18-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=5774	23.88	3	2873.3358	2873.3358	F	K	25	51
PSM	KDDQLLDDGKTLGECGFTSQTA	509	sp|Q15370|ELOB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	15-UNIMOD:4	ms_run[2]:scan=6046	24.549	3	2398.0958	2398.0958	Y	R	46	68
PSM	KDLATVAFCDAQSTQEIHE	510	sp|P56545|CTBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:4	ms_run[2]:scan=6334	25.351	3	2161.995	2161.9950	L	K	52	71
PSM	KDMALNIGNEIDAQNPQIK	511	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:35	ms_run[2]:scan=5674	23.644	3	2127.063	2127.0630	L	R	167	186
PSM	KDMATETDASLSTLLTETK	512	sp|Q9Y2W6-3|TDRKH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:35	ms_run[2]:scan=6603	26.103	3	2070.0038	2070.0038	L	K	465	484
PSM	KEAEFQAPPEPIQQEVER	513	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5431	23.091	3	2124.0487	2124.0487	H	R	310	328
PSM	KECEEEAINIQSTAPEEEHESP	514	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=5024	21.961	3	2555.097	2555.0970	K	R	275	297
PSM	KEGEEAGPGDPLLEAVPKTGDE	515	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6104	24.719	3	2237.0699	2237.0699	A	K	352	374
PSM	KGLPLGSAVSSPVLFSPVGR	516	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6988	27.38	3	1967.1204	1967.1204	R	R	35	55
PSM	KIGGDAATTVNNSTPDFGFGGQK	517	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5690	23.684	3	2281.0975	2281.0975	A	R	87	110
PSM	KIGGDAATTVNNSTPDFGFGGQK	518	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5871	24.112	3	2281.0975	2281.0975	A	R	87	110
PSM	KLCPGGQLPFLLYGTEVHTDTN	519	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=7289	28.711	3	2459.2155	2459.2155	Q	K	57	79
PSM	KLQDLAGGIFPEDEIPEKAC	520	sp|P56182|RRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:4	ms_run[2]:scan=6942	27.214	3	2229.0987	2229.0987	R	R	330	350
PSM	KLVTPEDDELDELRPGQ	521	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5888	24.152	3	1952.9691	1952.9691	M	R	330	347
PSM	KLYGSAGPPPTGEEDTAEKDEL	522	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5269	22.675	3	2303.0805	2303.0805	S	-	633	655
PSM	KPEEINLLTGESDTQQIEAEK	523	sp|Q96KA5-2|CLP1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6021	24.484	3	2371.1755	2371.1755	P	K	137	158
PSM	KPLLTGLMWAQQGTTPGTPKL	524	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	8-UNIMOD:35	ms_run[2]:scan=6921	27.134	3	2253.2191	2253.2191	P	R	7	28
PSM	KPQYTEADVIPCTGEEPGEAKE	525	sp|Q5VTB9-3|RN220_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	12-UNIMOD:4	ms_run[2]:scan=5234	22.563	3	2447.1162	2447.1162	G	R	193	215
PSM	KPVTDCVISVPSFFTDAER	526	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	6-UNIMOD:4	ms_run[2]:scan=7240	28.473	3	2167.062	2167.0620	K	R	135	154
PSM	KQAPELSLSSQDLEVGGNQGH	527	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5710	23.728	3	2193.0662	2193.0662	E	-	248	269
PSM	KQDLPNAMAISEMTDKLGLQSL	528	sp|P18085|ARF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	8-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=6924	27.149	3	2434.2084	2434.2084	N	R	127	149
PSM	KQPLEQNQTISPLSTYEESKVS	529	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5810	23.966	3	2505.2599	2505.2599	L	K	402	424
PSM	KSCVEEPEPEPEAAEGDGDK	530	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=4143	18.477	3	2171.9165	2171.9165	K	K	99	119
PSM	KSLLDIISDPDAGTPEDKM	531	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:35	ms_run[2]:scan=7138	27.994	3	2059.9984	2059.9984	D	R	344	363
PSM	KSPPSPELQGPPSTEKEAIL	532	sp|Q9HB09-3|B2L12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5508	23.273	3	2104.1052	2104.1052	L	R	190	210
PSM	KSVNDQPSGNLPFLKPDDIQYFD	533	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7323	28.875	3	2636.2758	2636.2758	M	K	454	477
PSM	KTAGYYPNPPLVLSSDETLISK	534	sp|Q5TFE4-2|NT5D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6796	26.692	3	2392.2526	2392.2526	S	-	384	406
PSM	KTDTLEDLFPTTKIPNP	535	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7111	27.875	3	1929.0095	1929.0095	E	R	469	486
PSM	KTEEPLFQVEDSSKGQEPNDTNQYL	536	sp|Q8NBF6-2|AVL9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6422	25.598	3	2895.341	2895.3410	M	K	292	317
PSM	KTETVEEPMEEEEAAKEE	537	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4671	20.808	3	2106.9151	2106.9151	S	K	285	303
PSM	KTFPTVNPSTGEVICQVAEGDKEDVD	538	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	15-UNIMOD:4	ms_run[2]:scan=6460	25.705	3	2834.328	2834.3280	R	K	52	78
PSM	KTGQATVASGIPAGWMGLDCGPESSK	539	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	16-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=6167	24.888	3	2620.2261	2620.2261	A	K	269	295
PSM	KVDVGGSEPASLSYLSFEGATK	540	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6640	26.207	3	2241.1165	2241.1165	F	R	130	152
PSM	KVEDMAELTCLNEASVLHNL	541	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	5-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=7082	27.768	3	2301.0981	2301.0981	S	K	86	106
PSM	KVGINYQPPTVVPGGDLAKVQ	542	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6134	24.801	3	2179.2001	2179.2001	F	R	317	338
PSM	KVGNPFELDTQQGPQVDKEQFE	543	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6368	25.449	3	2532.2132	2532.2132	R	R	347	369
PSM	KVPFCPMVGSEVYSTEIK	544	sp|Q9Y265-2|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	5-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=6047	24.551	3	2086.0115	2086.0115	S	K	90	108
PSM	KVQISPDSGGLPERSVSLTGAPESVQ	545	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5804	23.954	3	2637.361	2637.3610	C	K	177	203
PSM	KVTEGLVDVILYHQPDD	546	sp|O43390|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7218	28.365	3	1939.9891	1939.9891	S	K	268	285
PSM	KVTGPQATTGTPLVTMRPASQAG	547	sp|P51610-4|HCFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5226	22.541	3	2268.1896	2268.1896	L	K	488	511
PSM	RCQENGQELSPIALEPGPEPH	548	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4	ms_run[2]:scan=5857	24.074	3	2357.107	2357.1070	L	R	201	222
PSM	RDVIDEPIIEEPSRLQESVMEAS	549	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=6752	26.546	3	2657.2854	2657.2854	Q	R	437	460
PSM	RDVPEDVAQEMVESGYVCEGDH	550	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=5408	23.036	3	2536.0482	2536.0482	E	K	530	552
PSM	REANGLPIMESNCFDPSKIQLPEDE	551	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	13-UNIMOD:4	ms_run[2]:scan=7180	28.198	3	2888.3321	2888.3321	Y	-	129	154
PSM	REPGYTPPGAGNQNPPGMYPVTGPK	552	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	18-UNIMOD:35	ms_run[2]:scan=4914	21.634	3	2597.2333	2597.2333	K	K	328	353
PSM	RESAPLTPSSAPVSQESLAVKE	553	sp|Q9Y485|DMXL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5273	22.693	3	2282.1754	2282.1754	C	K	2401	2423
PSM	RGFGSSAPEGLEPDSMASAASALHLLSP	554	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	16-UNIMOD:35	ms_run[2]:scan=7205	28.309	3	2770.3232	2770.3232	S	R	373	401
PSM	RGTELDCGIETDSGVDDDMACH	555	sp|P42574|CASP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	7-UNIMOD:4,19-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=4936	21.701	3	2467.9526	2467.9526	C	K	164	186
PSM	RIEESAIDEVVVTNTIPHEVQ	556	sp|O60256-4|KPRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6746	26.526	3	2377.2125	2377.2125	R	K	223	244
PSM	RIEEVPELPLVVEDKVEGY	557	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7309	28.81	3	2212.1627	2212.1627	H	K	143	162
PSM	RLPPEPGLSDSYSFDYPSDMGPR	558	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=6322	25.312	3	2598.1697	2598.1697	A	R	573	596
PSM	RPGVATPLVSSSDYMPMAPQNVSASK	559	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	15-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5353	22.897	3	2721.3102	2721.3102	M	K	704	730
PSM	RTLPAAPASTNTTATPSLTHMVPA	560	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	21-UNIMOD:35	ms_run[2]:scan=5144	22.317	3	2421.2322	2421.2322	P	K	216	240
PSM	RTPQTVAGYTIPPGHQVCVSPTVNQ	561	sp|Q16850-2|CP51A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	18-UNIMOD:4	ms_run[2]:scan=6096	24.7	3	2706.3548	2706.3548	A	R	286	311
PSM	RVFQPPPPPPPAPSGDAPAEKE	562	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4964	21.785	3	2280.1539	2280.1539	S	R	249	271
PSM	RVIISAPSADAPMFVMGVNHE	563	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6982	27.363	3	2240.1082	2240.1082	K	K	76	97
PSM	RYIMVPSGNMGVFDPTEIHN	564	sp|Q9P003|CNIH4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	10-UNIMOD:35	ms_run[2]:scan=6542	25.936	3	2292.0667	2292.0667	Y	R	84	104
PSM	KVIAINVDDPDAANYNDINDVK	565	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=6123	24.771390449600002	3	2416.186278	2415.191784	W	R	155	177
PSM	RGSDELFSTCVTNGPFIMSSNSASAANGNDSK	566	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	10-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=6511	25.855147741333333	4	3337.459564	3336.462299	K	K	14	46
PSM	RYIMVPSGNMGVFDPTEIHN	567	sp|Q9P003|CNIH4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	4-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=6233	25.073723689066664	3	2308.063504	2308.061639	Y	R	84	104
PSM	KAAALVDEGLDPEEHTADGEPSA	568	sp|Q63HK5|TSH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5381	22.966	3	2321.0659	2321.0659	L	K	21	44
PSM	KAAPEEPQQRPPEAVAAAPAGTTSS	569	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4366	19.507	3	2460.2245	2460.2245	A	R	23	48
PSM	KAIEDEGGNPDEIEITSEGNK	570	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5007	21.914	3	2244.0394	2244.0394	K	K	63	84
PSM	KALGDSSPSQAMQEYIAVVK	571	sp|Q9BR61|ACBD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	12-UNIMOD:35	ms_run[2]:scan=5571	23.407	3	2137.0725	2137.0725	W	K	100	120
PSM	KAQAAAPASVPAQAPK	572	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=3894	17.288	2	1504.8362	1504.8362	T	R	134	150
PSM	KCMVEVPQELETSTGHSLE	573	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	2-UNIMOD:4,3-UNIMOD:35	ms_run[2]:scan=5584	23.433	3	2188.998	2188.9980	D	K	399	418
PSM	KDINSVAIAPNDKLLATGSQD	574	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5699	23.7	3	2169.1277	2169.1277	D	R	480	501
PSM	KDLLVENVPYCDAPTQKQ	575	sp|Q5U5X0|LYRM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:4	ms_run[2]:scan=5591	23.444	3	2117.0463	2117.0463	R	-	87	105
PSM	KDPVPGYSVPAAEHSTITAWG	576	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6377	25.473	3	2182.0695	2182.0695	T	K	234	255
PSM	KDSTGAADPPQPHIVGIQSPDQQAALA	577	sp|Q9BQ95-3|ECSIT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5808	23.96	3	2711.3515	2711.3515	P	R	37	64
PSM	KDTSENADGQSDENKDDYTIPDEY	578	sp|P43243-2|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5380	22.963	3	2748.1158	2748.1158	N	R	468	492
PSM	KEAADAIDAEGASAPLMELLHS	579	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:35	ms_run[2]:scan=7187	28.234	3	2254.0787	2254.0787	D	R	615	637
PSM	KEVSIEDTGVDVDPEKLEMES	580	sp|Q8WWK9-6|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	19-UNIMOD:35	ms_run[2]:scan=6242	25.103	3	2364.089	2364.0890	V	K	482	503
PSM	KFVLCPECENPETDLHVNP	581	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6295	25.243	3	2297.0457	2297.0457	K	K	95	114
PSM	KGIIIMGEDDDSHPSEM	582	sp|Q9GZP4-2|PITH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	6-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=4561	20.387	3	1904.8132	1904.8132	L	R	88	105
PSM	KGTEFAESADAALQGDPALQDAGDSSR	583	sp|P04921-2|GLPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6164	24.878	3	2706.2369	2706.2369	A	K	76	103
PSM	KGVTIASGGVLPNIHPELLA	584	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7070	27.717	3	1985.131	1985.1310	L	K	96	116
PSM	KGVTIIGPATVGGIKPGCF	585	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:4	ms_run[2]:scan=6739	26.502	3	1871.0339	1871.0339	Q	K	345	364
PSM	KILNNSGLPITSAIDLEDAAK	586	sp|Q96I99|SUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6931	27.173	3	2182.1845	2182.1845	Q	K	403	424
PSM	KLDDLSVLDLSHNQLTECP	587	sp|Q13045-2|FLII_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:4	ms_run[2]:scan=7092	27.809	3	2196.0732	2196.0732	F	R	102	121
PSM	KLEEDISSSMTNSTAASRPPVTL	588	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6220	25.037	3	2433.2057	2433.2057	D	R	78	101
PSM	KLLGPDAAINLTDPDGALAK	589	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6662	26.277	3	1992.0892	1992.0892	E	R	156	176
PSM	KMDETGMVHCDTAVGTPDYISPEVL	590	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	2-UNIMOD:35,7-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=6465	25.719	3	2796.2292	2796.2292	M	K	238	263
PSM	KMQVDQEEPHVEEQQQQTPAEN	591	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	2-UNIMOD:35	ms_run[2]:scan=4078	18.168	3	2637.1613	2637.1613	E	K	521	543
PSM	KMVSSLPSTADPSHQTMPAN	592	sp|Q9NUQ6-2|SPS2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	2-UNIMOD:35	ms_run[2]:scan=4568	20.412	3	2113.9772	2113.9772	P	K	337	357
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	593	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4509	20.157	4	3493.5466	3493.5466	Q	K	798	833
PSM	KPLLPIPITQKPQGAPETL	594	sp|Q14119|VEZF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6668	26.292	3	2040.1983	2040.1983	Q	K	41	60
PSM	KPSPAPPPYTPPTHVLQTQI	595	sp|Q86YQ8-2|CPNE8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5975	24.362	3	2168.163	2168.1630	I	-	214	234
PSM	KPVVDCVVSVPCFYTDAER	596	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	6-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6696	26.373	3	2240.0606	2240.0606	K	R	135	154
PSM	KQADGAASAPTEEEEEVVKD	597	sp|Q9Y4F1|FARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4574	20.432	3	2101.9651	2101.9651	N	R	438	458
PSM	KQITSYGETCPGLEQYAIK	598	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:4	ms_run[2]:scan=5771	23.87	3	2185.0725	2185.0725	A	K	348	367
PSM	KQPPVSPGTALVGSQKEPSEVPTP	599	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5379	22.962	3	2429.2802	2429.2802	R	K	31	55
PSM	KSAMPIEVMMNETAQQNMENHPVI	600	sp|Q05048|CSTF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:35,9-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=5085	22.154	3	2805.2442	2805.2442	A	R	143	167
PSM	KSDGGYTYDTSDLAAIKQ	601	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5586	23.437	3	1931.9113	1931.9113	V	R	305	323
PSM	KSSVTSAAAVSALAGVQDQLIEK	602	sp|Q9HAF1-2|EAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6929	27.164	3	2272.2274	2272.2274	S	R	91	114
PSM	KSVAEGLSGSLVQEPFQLATEK	603	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6989	27.384	3	2317.2165	2317.2165	K	R	645	667
PSM	KTAMSTPHVAEPAENEQDEQDENGAEASADL	604	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:35	ms_run[2]:scan=4882	21.537	3	3299.4008	3299.4008	L	R	464	495
PSM	KTCTTVAFTQVNSEDKGALA	605	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:4	ms_run[2]:scan=5326	22.825	3	2140.047	2140.0470	R	K	197	217
PSM	KTELAEPIAIRPTSETVMYPAYA	606	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:35	ms_run[2]:scan=6355	25.422	3	2566.2989	2566.2989	G	K	1109	1132
PSM	KTFVNITPAEVGVLVGKD	607	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7076	27.744	3	1886.0513	1886.0513	G	R	38	56
PSM	KTQPGEGLEESGPPQPGGKEDAPAAEG	608	sp|Q6P6B1|ERIC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4551	20.341	3	2632.2253	2632.2253	E	K	103	130
PSM	KVMPFSTACNTPLSNFESHQNY	609	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6489	25.785	3	2587.1472	2587.1472	V	K	177	199
PSM	KWPEVDDDSIEDLGEVK	610	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6729	26.474	3	1972.9266	1972.9266	E	K	181	198
PSM	KYVLLNDQPDDDDGNPNEH	611	sp|Q8NEU8-2|DP13B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5070	22.111	3	2196.956	2196.9560	G	R	596	615
PSM	RDGDFENPVPYTGAVKVGAIQ	612	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6304	25.267	3	2232.1175	2232.1175	F	R	122	143
PSM	RELLNPVVEFVSHPSTTC	613	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:4	ms_run[2]:scan=7093	27.812	3	2084.0361	2084.0361	L	R	2452	2470
PSM	RGGPPPPPPPPHNSGPPPPPA	614	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4471	19.995	3	2016.033	2016.0330	S	R	284	305
PSM	RLPTGYYFGASAGTGDLSDNHDIISM	615	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	26-UNIMOD:35	ms_run[2]:scan=6723	26.451	3	2773.2654	2773.2654	V	K	246	272
PSM	RSAVAVYSYSCEGPEEESEDDSHLEG	616	sp|Q9C0B1|FTO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:4	ms_run[2]:scan=5367	22.931	3	2901.1883	2901.1883	D	R	239	265
PSM	KVVSTPPSVTEPPEKELSTVS	617	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=5299	22.755335375199998	3	2210.171302	2210.168195	P	K	66	87
PSM	KLQVELDNVTGLLSQSDSKSS	618	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=6971	27.323908732266666	3	2247.162389	2247.159421	T	K	1277	1298
PSM	KFQPASAPAEDCISSSTEPKPD	619	sp|Q14008|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41	12-UNIMOD:4	ms_run[1]:scan=4839	21.3821275888	3	2362.0912	2361.0792	A	P	1102	1124
PSM	KDYEIESQNPLASPTNTLLGSAKEQ	620	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=6578	26.029304844533332	3	2732.362057	2732.350469	S	R	617	642
PSM	KAAGCNIPVASVAAGFPAGQTHL	621	sp|Q9Y315|DEOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41	5-UNIMOD:4	ms_run[1]:scan=6535	25.922511907733334	3	2236.152579	2236.142272	L	K	114	137
PSM	KAEAAAEQSASVEVPSSNVQQHQ	622	sp|Q6PK81-2|ZN773_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4438	19.845	3	2394.1411	2394.1411	A	K	93	116
PSM	KAIEPPPLDAVIEAEHTL	623	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7446	29.476	3	1942.0411	1942.0411	A	R	819	837
PSM	KAISTPIITAQLDKDDDADYA	624	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6176	24.915	3	2263.122	2263.1220	S	R	1078	1099
PSM	KDFAMDGLVNIVGGCCGSTPDHI	625	sp|Q99707-2|METH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:35,15-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6854	26.893	3	2478.0978	2478.0978	L	R	309	332
PSM	KDLSAGAVSAVQCIANPIKLA	626	sp|Q7L266|ASGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	13-UNIMOD:4	ms_run[2]:scan=7083	27.771	3	2125.1565	2125.1565	G	R	85	106
PSM	KDVETLEAPEGRPDSGVPSL	627	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5832	24.012	3	2095.0433	2095.0433	D	R	30	50
PSM	KEAASSSSGTQPAPPAPASPWDSK	628	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4887	21.556	3	2353.1186	2353.1186	A	K	530	554
PSM	KEAPEPGMEVVKVGGPVY	629	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	8-UNIMOD:35	ms_run[2]:scan=5323	22.819	3	1900.9604	1900.9605	S	R	440	458
PSM	KEDEPPEQAEPEPTEAWK	630	sp|P11171-4|EPB41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4877	21.52	3	2108.9538	2108.9538	K	K	389	407
PSM	KESSPLFDDGQPWGEETEDGIMHN	631	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	22-UNIMOD:35	ms_run[2]:scan=6526	25.899	3	2733.1501	2733.1501	M	K	199	223
PSM	KEVELNELEPEKQPMNAASGAAMSLAGAE	632	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	23-UNIMOD:35	ms_run[2]:scan=6427	25.614	3	3029.4322	3029.4322	M	K	10	39
PSM	KEVIPVNVPEAQEEMKEVA	633	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	15-UNIMOD:35	ms_run[2]:scan=5488	23.228	3	2154.0878	2154.0878	K	K	513	532
PSM	KEVMNADDPDLQRPDEEAI	634	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	4-UNIMOD:35	ms_run[2]:scan=5008	21.916	3	2199.9954	2199.9954	P	K	122	141
PSM	KIGPILDNSTLQSEVKPILE	635	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7037	27.591	3	2193.2256	2193.2256	Q	K	546	566
PSM	KIQIAPDSGGLPERSCMLTGTPESVQSA	636	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=5670	23.635	3	2944.427	2944.4270	C	K	133	161
PSM	KLEPNLGEDDEDKDLEPGPSGTS	637	sp|Q92797-2|SYMPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5138	22.301	3	2441.1082	2441.1082	M	K	361	384
PSM	KLEVAPISDIIAIKSPDTFV	638	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7518	29.804	3	2155.214	2155.2140	A	R	77	97
PSM	KLLVDVDESTLSPEEQKE	639	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5839	24.031	3	2058.0368	2058.0368	D	R	477	495
PSM	KMIDAGDALIYMEPEKQVMS	640	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	2-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=6534	25.921	3	2300.0738	2300.0738	K	R	443	463
PSM	KMILIQDGSQNTNVDKPL	641	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5784	23.908	3	2013.0565	2013.0565	V	R	266	284
PSM	KNVDLLSDMVQEHDEPIL	642	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	9-UNIMOD:35	ms_run[2]:scan=6477	25.752	3	2110.0252	2110.0252	F	K	108	126
PSM	KNVMLLPVGSADDGAHSQNE	643	sp|Q96KP4-2|CNDP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	4-UNIMOD:35	ms_run[2]:scan=5136	22.296	3	2096.9797	2096.9797	G	K	346	366
PSM	KPLPGEEPLFTIPHTQEAF	644	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7102	27.846	3	2150.1048	2150.1048	V	R	14	33
PSM	KPTDPDDPLADQNIKD	645	sp|Q9NW64-2|RBM22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4870	21.49	3	1780.8479	1780.8479	E	R	136	152
PSM	KQGTAVEVEAESLDPTVKPVDVGGDEPEE	646	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6250	25.123	3	3023.4459	3023.4459	E	K	288	317
PSM	KQMNMSPPPGNAGPVIMSIEEKMEADA	647	sp|Q86U42-2|PABP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35,5-UNIMOD:35,17-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=6174	24.908	3	2935.3072	2935.3072	E	R	145	172
PSM	KQMNMSPPPGNAGPVIMSIEEKMEADA	648	sp|Q86U42-2|PABP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35,5-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=6395	25.522	3	2919.3123	2919.3123	E	R	145	172
PSM	KSLSVPAASTAKPPPLP	649	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5461	23.172	3	1659.956	1659.9560	Y	R	1159	1176
PSM	KSTMDNPTTTQYASLMHSFIL	650	sp|Q9NP97|DLRB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	4-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6928	27.162	3	2417.1243	2417.1243	I	K	31	52
PSM	KSVEYEGDLKSGTAETEPVEQDSSQPSLPLV	651	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6471	25.735	3	3318.5991	3318.5991	E	R	808	839
PSM	KTCNVLVALEQQSPDIAQGVHLD	652	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=7322	28.872	3	2534.2799	2534.2799	Y	R	39	62
PSM	KTEELIESPKLESSEGEIIQTVD	653	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6523	25.891	3	2573.296	2573.2960	L	R	286	309
PSM	KTGSILPSVGSSVGSVNGYHTC	654	sp|Q9UPN3-5|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	22-UNIMOD:4	ms_run[2]:scan=5853	24.062	3	2206.0688	2206.0688	G	K	2843	2865
PSM	KTSDPTQDLHFTPLLSPSSSTSASSTA	655	sp|Q9C0D5-2|TANC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6660	26.27	3	2762.3246	2762.3246	P	K	344	371
PSM	KTVMDEGPQVFAPLSEESKN	656	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	4-UNIMOD:35	ms_run[2]:scan=5796	23.94	3	2221.0573	2221.0573	C	K	687	707
PSM	KTVMDEGPQVFAPLSEESKN	657	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6390	25.507	3	2205.0623	2205.0623	C	K	687	707
PSM	KVEDPPLDPWLVPHSCGQVCE	658	sp|Q6ZNB6-2|NFXL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=6785	26.653	3	2461.1406	2461.1406	G	R	238	259
PSM	KVESPGTYQQDPWAMTDEEKA	659	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5743	23.814	3	2409.0795	2409.0795	L	K	156	177
PSM	KVLVYNNTSIVQDEILAH	660	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6619	26.148	3	2055.1001	2055.1001	E	R	91	109
PSM	KVLYEMGPEYSSNVELASFHSTS	661	sp|Q8TD30-2|ALAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:35	ms_run[2]:scan=6148	24.834	3	2590.1897	2590.1897	K	K	218	241
PSM	KVTEGLTDVILYHQPDD	662	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6533	25.92	3	1941.9684	1941.9684	S	K	265	282
PSM	RAQLEQGEPVLETPVESQQHEIES	663	sp|P52630-4|STAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5562	23.381	3	2732.3253	2732.3253	Q	R	120	144
PSM	RESAPLTPSSAPVSQESLAVKE	664	sp|Q9Y485|DMXL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5291	22.736	3	2282.1754	2282.1754	C	K	2401	2423
PSM	RETPLPIDPSMFPTWPAKSEQQ	665	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:35	ms_run[2]:scan=7106	27.856	3	2570.2475	2570.2475	F	R	96	118
PSM	RGPQSNYGGPYPAAPTFGSQPGPPQPLPPK	666	sp|P53992|SC24C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5989	24.406	4	3059.5254	3059.5254	A	R	290	320
PSM	RGVLLEDPEQGGEDPGKPSDAML	667	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	22-UNIMOD:35	ms_run[2]:scan=5806	23.958	3	2425.1431	2425.1431	K	K	65	88
PSM	RPLVQATVPATPEQPVLDLK	668	sp|P47985|UCRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6299	25.254	3	2171.2314	2171.2314	L	R	27	47
PSM	RSYDVPPPPMEPDHPFYSNIS	669	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6365	25.443	3	2444.1107	2444.1107	R	K	117	138
PSM	RTLSPTPASATAPTSQGIPTSDEESTPK	670	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4864	21.466	3	2826.3883	2826.3883	P	K	194	222
PSM	RTTPPEAAQNGQSPMAALILVADNAGGSHAS	671	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7488	29.667	3	3031.4781	3031.4781	N	K	395	426
PSM	RVETPLLLVVNGKPQGSSSQAVATVAS	672	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6681	26.335	3	2707.4868	2707.4868	V	R	409	436
PSM	RVLLLTVPGMEETTSEADKNLS	673	sp|Q6UUV9-3|CRTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	10-UNIMOD:35	ms_run[2]:scan=6321	25.31	3	2418.2312	2418.2312	K	K	179	201
PSM	RVLQALGSEPIQYAVPVVKYD	674	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6953	27.256	3	2344.2791	2344.2791	P	R	874	895
PSM	KFQPASAPAEDCISSSTEPKPD	675	sp|Q14008|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	40	12-UNIMOD:4	ms_run[1]:scan=4821	21.3274529408	3	2361.0843	2361.0789	A	P	1102	1124
PSM	RPGVATPLVSSSDYMPMAPQNVSASK	676	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	15-UNIMOD:35	ms_run[1]:scan=5661	23.6131233272	3	2706.335396	2705.315287	M	K	704	730
PSM	KNEFVSLINCSSQPPLISHGIG	677	sp|O95793|STAU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	10-UNIMOD:4	ms_run[1]:scan=7136	27.983508536	3	2396.186593	2396.215831	N	K	514	536
PSM	KCLAPIANTTNGQGCTDYVSEVVK	678	sp|Q7Z333|SETX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	2-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=5854	24.0650350352	3	2624.222527	2624.257438	K	K	1109	1133
PSM	KPSPAPPSTTTAPDASGPQK	679	sp|P40855|PEX19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=3826	16.964525846933334	3	1933.976131	1933.974521	A	R	33	53
PSM	REPVSVGTPSEGEGLGADGQEH	680	sp|Q8IX01|SUGP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=4710	20.9421097472	3	2207.012588	2207.009068	I	K	1038	1060
PSM	KVLDGLTAGSSSASQQQQQQHPPGN	681	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=4629	20.645795433599996	3	2562.240091	2562.242256	R	R	8	33
PSM	KTEEDETSEDANCLALSGHD	682	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	13-UNIMOD:4	ms_run[1]:scan=4858	21.445142145600002	3	2219.913158	2219.912451	T	K	665	685
PSM	KDLGLSESGEDVNAAILDESGK	683	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=6041	24.530875302933335	3	2247.080008	2246.091401	V	K	463	485
PSM	KVMPFSTACNTPLSNFESHQNY	684	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	3-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=6480	25.761065024266667	3	2587.150807	2587.147159	V	K	177	199
PSM	RVTIAQGGVLPNIQAVLLPK	685	sp|P04908|H2A1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7396	29.229537589333333	3	2087.267082	2086.262645	G	K	100	120
PSM	KTETQAEDTEPDPGESKGEP	686	sp|Q92793|CBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=3838	17.0183131024	3	2143.942164	2143.939317	M	R	998	1018
PSM	MKPPGGESSNLFGSPEEATPSSRPN	687	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:35	ms_run[1]:scan=5146	22.321821913333334	3	2588.189954	2588.181296	-	R	1	26
PSM	KAATGEEVSAEDLGGADLHC	688	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	20-UNIMOD:4	ms_run[2]:scan=5243	22.591	3	2028.9058	2028.9058	V	R	210	230
PSM	KAEDPSQPDSAGYTALHYAS	689	sp|Q53RE8|ANR39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5276	22.701	3	2106.9494	2106.9494	Q	R	53	73
PSM	KAEVPGATGGDSPHLQPAEPPGEP	690	sp|Q9P2K5-4|MYEF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4997	21.889	3	2337.1237	2337.1237	N	R	6	30
PSM	KAIEDEGGNPDEIEITSEGNK	691	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4842	21.394	3	2244.0394	2244.0394	K	K	63	84
PSM	KAIGTEPDSDVLSEIMHSFA	692	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	16-UNIMOD:35	ms_run[2]:scan=7403	29.267	3	2162.0201	2162.0202	I	K	695	715
PSM	KAPQEVEEDDGRSGAGEDPPMPAS	693	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	21-UNIMOD:35	ms_run[2]:scan=4085	18.204	3	2484.0711	2484.0711	Q	R	376	400
PSM	KAQDSYQTPQNPGIVPRPSELYYS	694	sp|Q96Q15-2|SMG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6206	25.004	3	2737.3348	2737.3348	Q	K	2092	2116
PSM	KAVAGQQQASVTAGKVPEVVALGAAE	695	sp|Q15025-7|TNIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6033	24.515	3	2478.3442	2478.3442	K	K	275	301
PSM	KCEYPAACNALETLLIH	696	sp|P54886-2|P5CS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7400	29.251	3	2001.9652	2001.9652	S	R	603	620
PSM	KDMQPSMESDMALVKDMELPTE	697	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35,11-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5640	23.549	3	2572.1053	2572.1053	A	K	290	312
PSM	KDMQPSMESDMALVKDMELPTE	698	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6896	27.04	3	2556.1104	2556.1104	A	K	290	312
PSM	KDTYPPSASVVGASVGGH	699	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5005	21.906	3	1727.8479	1727.8479	D	R	219	237
PSM	KDVEFEVVGDAPEKVGP	700	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5909	24.2	3	1813.9098	1813.9098	G	K	444	461
PSM	KDVSPDLSCADEISECYH	701	sp|Q96S66-4|CLCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	9-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5625	23.524	3	2123.8776	2123.8776	E	K	52	70
PSM	KEDEPPEQAEPEPTEAWK	702	sp|P11171-4|EPB41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4893	21.573	3	2108.9538	2108.9538	K	K	389	407
PSM	KEELMSSDLEETAGSTSIPK	703	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5684	23.672	3	2151.0253	2151.0253	S	R	514	534
PSM	KEEPLSEEEPCTSTAIASPEK	704	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:4	ms_run[2]:scan=4859	21.448	3	2331.0788	2331.0788	I	K	497	518
PSM	KELVYPPDYNPEGKVT	705	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5290	22.735	3	1847.9305	1847.9305	F	K	485	501
PSM	KEQQEPSSGGSVVPTVQEPKDVLE	706	sp|Q96JJ7|TMX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5588	23.439	3	2566.2762	2566.2762	S	K	427	451
PSM	KETDGTEGTVEIETVKLA	707	sp|Q8WY54|PPM1E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5851	24.058	3	1918.9735	1918.9735	P	R	185	203
PSM	KETLPSSPSQGPQASITHP	708	sp|Q9UI36|DACH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4850	21.419	3	1960.9854	1960.9854	D	R	384	403
PSM	KFTASAGIQVVGDDLTVTNPK	709	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6384	25.491	3	2160.1426	2160.1426	Q	R	213	234
PSM	KGSPLNAAPYGIESMSQDTEVRS	710	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6097	24.702	3	2436.1591	2436.1591	E	R	350	373
PSM	KGTEPIVVDPFDPRGSGSLL	711	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7290	28.716	3	2083.095	2083.0950	I	R	424	444
PSM	KIDLPAENSNSETIIITGK	712	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6035	24.519	3	2042.0895	2042.0895	T	R	581	600
PSM	KIGGDAATTVNNSTPDFGFGGQK	713	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5739	23.808	3	2281.0975	2281.0975	A	R	87	110
PSM	KILPVFDEPPNPTNVEESLK	714	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6981	27.361	3	2265.1893	2265.1893	E	R	172	192
PSM	KLAQGPELAEDDANLLH	715	sp|Q92558|WASF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5850	24.056	3	1832.9268	1832.9268	Q	K	206	223
PSM	KLEAIEDDSVKETDSSSASAATPS	716	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4721	20.979	3	2437.1344	2437.1344	Q	K	179	203
PSM	KLLELTSSYSPDVSDYKEG	717	sp|P38432|COIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6151	24.843	3	2130.0368	2130.0368	F	R	480	499
PSM	KLNATNIELATVQPGQNFHMFT	718	sp|P28066-2|PSA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	20-UNIMOD:35	ms_run[2]:scan=6644	26.219	3	2489.2373	2489.2373	E	K	151	173
PSM	KMQMLEDEDDLAYAETEK	719	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=5181	22.419	3	2189.9344	2189.9344	L	K	4345	4363
PSM	KNQSPTEAEKPASSSLPSSPPPQLLT	720	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5578	23.419	3	2690.3763	2690.3763	L	R	32	58
PSM	KPLSSQPQAIVTEDKTDISSG	721	sp|P40692-2|MLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5036	21.994	3	2200.1223	2200.1223	S	R	161	182
PSM	KPQEAAVAPEKPPASDET	722	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3972	17.663	3	1863.9214	1863.9214	A	K	238	256
PSM	KPVPADALGLSGNDTPGPSHNTALA	723	sp|Q2M3G4-2|SHRM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5636	23.542	3	2399.2081	2399.2081	L	R	501	526
PSM	KQECDSLGPQMASSTTSKPSSSSSGP	724	sp|Q9C091-3|GRB1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=4037	17.959	3	2656.1592	2656.1592	L	R	1074	1100
PSM	KQETEVELYNEFPEPIKLD	725	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7173	28.164	3	2320.1475	2320.1475	L	K	175	194
PSM	KQEVAPVQYNIVEQNKLN	726	sp|Q9Y6N7-6|ROBO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5482	23.218	3	2113.1168	2113.1168	Q	K	1006	1024
PSM	KQQDPSLPLLHTPIPLVSENPQ	727	sp|Q9GZN2|TGIF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7298	28.757	3	2450.3169	2450.3169	Q	-	216	238
PSM	KSGLTLLGPLPHAAVPCSGPEPTAQ	728	sp|Q6ZVH7-3|ESPNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=6649	26.239	3	2497.2999	2497.2999	R	R	574	599
PSM	KSLDDDLDGVPLDATEDSK	729	sp|O15042-3|SR140_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5930	24.263	3	2031.9484	2031.9484	I	K	321	340
PSM	KSPMVEQAVQTGSADNLNAK	730	sp|Q9BX40-3|LS14B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:35	ms_run[2]:scan=4548	20.332	3	2103.0266	2103.0266	G	K	109	129
PSM	KSSQQPSTPQQAPPGQPQQGTFVAH	731	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4517	20.196	3	2630.2837	2630.2837	G	K	789	814
PSM	KTPALIVYGDQDPMGQTSFEHL	732	sp|Q96IU4-2|ABHEB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	14-UNIMOD:35	ms_run[2]:scan=6651	26.244	3	2462.1788	2462.1788	V	K	113	135
PSM	KTSVPVLDAELFIPPKIN	733	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7358	29.042	3	1980.1296	1980.1296	Q	R	1304	1322
PSM	KTTECISEESEPEDQKLTLE	734	sp|Q8TAA5|GRPE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:4	ms_run[2]:scan=5232	22.558	3	2365.0843	2365.0843	E	K	122	142
PSM	KTTGTPPDSSLVTYELHS	735	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5727	23.769	3	1931.9476	1931.9476	G	R	194	212
PSM	KTTNIELQGVPNDEVHPLLGV	736	sp|Q15291-2|RBBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6788	26.666	3	2272.2063	2272.2063	P	K	453	474
PSM	KTTYDSSLSSYTVPLEKDNSEEF	737	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6616	26.139	3	2639.2126	2639.2126	V	R	267	290
PSM	KVAMAPDGNGGLYCALEDH	738	sp|Q3KQV9-2|UAP1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=5740	23.809	3	2032.8983	2032.8983	D	K	95	114
PSM	KVDSSTNSSPSPQQSESLSPAHTSDF	739	sp|Q9BQE9-2|BCL7B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5039	22.004	3	2719.2209	2719.2209	L	R	44	70
PSM	KVLAPQISFAPEIASEEER	740	sp|P16083|NQO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6635	26.195	3	2113.1055	2113.1055	F	K	183	202
PSM	KVQDIPTGADSCVTSLSCDSH	741	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=5268	22.672	3	2276.0049	2276.0049	M	R	999	1020
PSM	RAYAPGGPAYQPVVEAFGTDILH	742	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7398	29.24	3	2428.2175	2428.2175	H	K	394	417
PSM	RDAEDAMDAMDGAVLDGREL	743	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5339	22.864	3	2180.9314	2180.9314	K	R	66	86
PSM	RDEEQSEADAGSGPPTPGPTTLGPK	744	sp|Q6ZRS2-3|SRCAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4752	21.092	3	2493.1619	2493.1619	A	K	557	582
PSM	REEEQEDLTKDMDEPSPVPNVEEVTLP	745	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:35	ms_run[2]:scan=6765	26.584	3	3140.4343	3140.4343	H	K	332	359
PSM	REGSTQQLQTTSPKPLVQQPILPVV	746	sp|Q5T8P6-5|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6742	26.509	3	2743.5232	2743.5232	H	K	159	184
PSM	RFLVPLEQSPVLEQSTLQHNNQT	747	sp|Q9UBZ4|APEX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6836	26.829	3	2677.3824	2677.3824	L	R	341	364
PSM	RGLYDGPVCEVSVTPKTVTPASSA	748	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	9-UNIMOD:4	ms_run[2]:scan=5778	23.89	3	2490.2424	2490.2424	P	K	460	484
PSM	RIQQALTSPLPMTPILEGSH	749	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7016	27.498	3	2188.1674	2188.1674	I	R	404	424
PSM	RNVTEDLVPIEDIPDVHPDLQ	750	sp|Q8N8A6|DDX51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7224	28.392	3	2413.2125	2413.2125	R	K	190	211
PSM	RQPPPDSSEEAPPATQNFIIPK	751	sp|Q15257-4|PTPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5705	23.716	3	2418.2179	2418.2179	E	K	6	28
PSM	RSAEVQAAQSTEPAAEAGAPEGEGH	752	sp|Q9H7X3|ZN696_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4244	18.956	3	2449.1106	2449.1106	S	R	36	61
PSM	RSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSS	753	sp|Q9HCD5|NCOA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6360	25.43	4	3804.835	3804.8350	Q	R	476	515
PSM	RTPSASILEEPLTEQNHADCLDSAGP	754	sp|Q96L73-2|NSD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	20-UNIMOD:4	ms_run[2]:scan=6346	25.391	3	2807.3032	2807.3032	H	R	938	964
PSM	RTSTSAVPNLFVPLNTNPKEVQEM	755	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	24-UNIMOD:35	ms_run[2]:scan=6732	26.482	3	2687.3589	2687.3589	H	R	479	503
PSM	RALMLQGVDLLADAVAVTMGPKG	756	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	4-UNIMOD:35,19-UNIMOD:35	ms_run[1]:scan=7061	27.685133399466668	3	2358.235222	2357.244688	A	R	37	60
PSM	KEIEMASEERPPAQALEIMMGL	757	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	5-UNIMOD:35,19-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=6069	24.624720646933334	3	2521.207258	2520.190998	A	K	224	246
PSM	RALQSGQCAGAALDVFTEEPPRD	758	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	8-UNIMOD:4	ms_run[1]:scan=6517	25.871758060533335	3	2489.158906	2487.181236	L	R	247	270
PSM	KQPGPVTNGQLQQPTTGAASGGYIK	759	sp|O00161|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=4999	21.8942619192	3	2497.294015	2497.292501	S	R	117	142
PSM	KSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	760	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5199	22.475695551999998	3	3974.822463	3974.825357	V	K	35	77
PSM	KELSESVQQQSTPVPLISPK	761	sp|Q9ULU4|PKCB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5535	23.328502105600002	3	2194.186549	2194.184513	L	R	530	550
PSM	KGLLGLPEEETELDNLTEFNTAHN	762	sp|Q12972|PP1R8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7404	29.272385335466666	3	2684.306588	2683.297705	L	K	151	175
PSM	KVEYPIMYSTDPENGHIFNCIQ	763	sp|O14880|MGST3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	20-UNIMOD:4	ms_run[1]:scan=6950	27.246282432266664	3	2655.220988	2654.214510	Y	R	37	59
PSM	RESELELPVPGAGGDGADPGLSK	764	sp|O43251-6|RFOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6149	24.837614910666666	3	2251.121385	2250.112805	K	R	24	47
PSM	KAQDSYQTPQNPGIVPRPSELYYS	765	sp|Q96Q15-2|SMG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6191	24.958	3	2737.3348	2737.3348	Q	K	2092	2116
PSM	KCMVEVPQELETSTGHSLE	766	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4	ms_run[2]:scan=6036	24.521	3	2173.0031	2173.0031	D	K	399	418
PSM	KDEDEEDEEDKEEDEEEDVPGQA	767	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4426	19.788	3	2707.0264	2707.0264	D	K	391	414
PSM	KDGDGTITTKELGTVM	768	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:35	ms_run[2]:scan=4913	21.632	3	1680.824	1680.8240	D	R	22	38
PSM	KDGDSVMVLPTIPEEEAK	769	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	7-UNIMOD:35	ms_run[2]:scan=5762	23.853	3	1972.9663	1972.9663	W	K	182	200
PSM	KDGLNQTTIPVSPPSTTKPS	770	sp|Q71RC2-2|LARP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5031	21.978	3	2067.0848	2067.0848	Q	R	473	493
PSM	KDMVTELFDPLVQGEVQH	771	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7524	29.833	3	2084.0248	2084.0248	M	R	41	59
PSM	KDTTLFDLSQFGSSNTSHENLQ	772	sp|P20585|MSH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7018	27.507	3	2468.1456	2468.1456	Q	K	193	215
PSM	KDVETLEAPEGRPDSGVPSL	773	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5849	24.054	3	2095.0433	2095.0433	D	R	30	50
PSM	KEEETSIDVAGKPNEVT	774	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4565	20.4	3	1844.9004	1844.9004	S	K	462	479
PSM	KEESDDEAAVEEEEEEK	775	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4270	19.07	3	1993.8124	1993.8124	E	K	303	320
PSM	KEIEELQSQAQALSQEGKSTDEVDS	776	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5790	23.926	3	2748.2937	2748.2937	K	K	1421	1446
PSM	KEPIIVNGQETYDSPASHSS	777	sp|Q96QZ7-4|MAGI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4784	21.205	3	2158.0178	2158.0178	D	K	578	598
PSM	KESDLPAADPSTPIPLKYEDESS	778	sp|Q3B7T1-3|EDRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5984	24.389	3	2488.1857	2488.1857	K	R	621	644
PSM	KETVYCLNDDDETEVLKEDIIQGF	779	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:4	ms_run[2]:scan=7509	29.759	3	2872.3324	2872.3324	Q	R	291	315
PSM	KEYYSTESEPLTNGGQKPSSSDTFF	780	sp|A0JNW5|UH1BL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6196	24.975	3	2798.2559	2798.2559	L	R	770	795
PSM	KGGAAPEGPNEAEVTSGKPEQEVPDAEEE	781	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4918	21.649	3	2950.3316	2950.3316	A	K	214	243
PSM	KGSSPLPTATTPKPLIPTEASI	782	sp|Q9BUK6-7|MSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6344	25.383	3	2205.2256	2205.2256	H	R	105	127
PSM	KILPVFDEPPNPTNVEESLK	783	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6939	27.207	3	2265.1893	2265.1893	E	R	172	192
PSM	KIPNIYAIGDVVAGPMLAH	784	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:35	ms_run[2]:scan=7135	27.979	3	1994.0659	1994.0659	T	K	247	266
PSM	KIVEQPTVSVTEPKLATPAGL	785	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6257	25.14	3	2177.2307	2177.2307	E	K	155	176
PSM	KIVGPSGAAVPCKVEPGLGADNSVV	786	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	12-UNIMOD:4	ms_run[2]:scan=5738	23.805	3	2420.2733	2420.2733	S	R	1007	1032
PSM	KLDDAIEDCTNAVKLDDTYI	787	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:4	ms_run[2]:scan=6906	27.076	3	2311.089	2311.0890	R	K	253	273
PSM	KLDPDSIPSPIQVIENDRAS	788	sp|O94855|SC24D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7177	28.186	3	2193.1277	2193.1277	K	R	258	278
PSM	KLEALMCTNPEIKQEDPTNVGPEV	789	sp|Q96EK7-2|F120B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=5730	23.779	3	2727.3095	2727.3095	F	K	541	565
PSM	KLGLQDGSTSLLPEQLLSAPKQ	790	sp|Q5T7V8-2|GORAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7129	27.951	3	2322.2795	2322.2795	Q	R	75	97
PSM	KMEEESGAPGVPSGNGAPGPKGEGE	791	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:35	ms_run[2]:scan=4176	18.625	3	2383.0598	2383.0598	I	R	17	42
PSM	KMVMIQDGPQNTGADKPL	792	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=4632	20.657	3	1973.955	1973.9550	V	R	218	236
PSM	KNLPPSGAVPVTGIPPHVV	793	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6277	25.19	3	1878.0727	1878.0727	S	K	257	276
PSM	KNVDLLSDMVQEHDEPIL	794	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7074	27.734	3	2094.0303	2094.0303	F	K	108	126
PSM	KPEDFLVPELQATEEEKS	795	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6724	26.456	3	2088.0263	2088.0263	I	K	481	499
PSM	KPGDGEVSPSTEDAPFQHSPLG	796	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5753	23.836	3	2251.0393	2251.0393	K	K	520	542
PSM	KQPGPVTNGQLQQPTTGAASGGYIK	797	sp|O00161|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5002	21.901	3	2497.2925	2497.2925	S	R	117	142
PSM	KQVSQPALVIPPQPPTTGPPR	798	sp|Q03164-2|KMT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5536	23.33	3	2207.2426	2207.2426	S	K	1296	1317
PSM	KSEDGTPAEDGTPAATGGSQPPSMGR	799	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	24-UNIMOD:35	ms_run[2]:scan=3844	17.049	3	2516.1085	2516.1085	R	K	1185	1211
PSM	KSEYSELDEDESQAPYDPNGKPE	800	sp|P19387|RPB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5100	22.199	3	2626.1195	2626.1195	P	R	205	228
PSM	KSLTGVVNAQALTSAFSPHT	801	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6874	26.959	3	2028.064	2028.0640	G	K	310	330
PSM	KSPSDLSPESPMLSSPPK	802	sp|Q9NZ72-2|STMN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	12-UNIMOD:35	ms_run[2]:scan=4767	21.148	3	1898.9295	1898.9295	L	K	48	66
PSM	KTEDSDDIHFEPVVQMPE	803	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:35	ms_run[2]:scan=5698	23.699	3	2130.9416	2130.9416	Y	K	2004	2022
PSM	KTLPLENASILSEGSLQEGH	804	sp|Q96H35|RBM18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6448	25.677	3	2122.0906	2122.0906	T	R	6	26
PSM	KTPLSTGGTLAFVSPSLAVH	805	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6827	26.798	3	1982.0837	1982.0837	K	K	560	580
PSM	KTTEPGVTGLLLAVEGPAAK	806	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7195	28.265	3	1951.099	1951.0990	L	R	981	1001
PSM	KTVMIPGPQLKPEEEYEEAQGEAQ	807	sp|Q9BRJ2|RM45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	4-UNIMOD:35	ms_run[2]:scan=5872	24.114	3	2716.2902	2716.2902	L	K	278	302
PSM	KVESPGTYQQDPWAMTDEEKA	808	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:35	ms_run[2]:scan=5224	22.537	3	2425.0744	2425.0744	L	K	156	177
PSM	KVVLVSSASDIPVQSH	809	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5212	22.511	3	1664.9097	1664.9097	Q	R	2205	2221
PSM	RAEEYEFLTPVEEAPKGMLA	810	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	18-UNIMOD:35	ms_run[2]:scan=6674	26.311	3	2295.1093	2295.1093	P	R	152	172
PSM	RDVEPEDPMFLMDPFAIH	811	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=7234	28.442	3	2189.9762	2189.9762	M	R	6	24
PSM	RIQDPVLQAVTSQTSLPGH	812	sp|Q9UBP6|TRMB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6579	26.032	3	2046.0858	2046.0858	R	-	258	277
PSM	RNSSAQAFLGPENPEEPYLDGINYNCVAPGK	813	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	26-UNIMOD:4	ms_run[2]:scan=6896	27.04	4	3406.5888	3406.5888	S	R	1090	1121
PSM	RQGQDAIPPPDPGEQIFNLPK	814	sp|Q15555-2|MARE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6688	26.351	3	2316.1862	2316.1862	A	K	173	194
PSM	RSYDVPPPPMEPDHPFYSNIS	815	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	10-UNIMOD:35	ms_run[2]:scan=5958	24.324	3	2460.1056	2460.1056	R	K	117	138
PSM	RTGDVQTASYCMLQGSPLDVLKDE	816	sp|Q9NXC5|MIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=6919	27.125	3	2698.2578	2698.2578	D	R	668	692
PSM	RTTELPAADPFALAPFPSKSG	817	sp|Q6ZSR9|YJ005_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7125	27.937	3	2172.1215	2172.1215	S	K	332	353
PSM	RVPAEGLEEVLTTPETVLTGHTE	818	sp|P57737-2|CORO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7511	29.77	3	2477.2649	2477.2649	W	K	488	511
PSM	KIPCESPPLEVVDTTASTK	819	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	4-UNIMOD:4	ms_run[1]:scan=5628	23.5282445424	3	2072.066730	2071.050722	T	R	2703	2722
PSM	KIIDPLPPIDHSEIDYPPFE	820	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7302	28.77290736213333	3	2335.185439	2334.178365	K	K	195	215
PSM	KGIVDQSQQAYQEAFEISK	821	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6466	25.721765344266664	3	2168.065704	2168.074963	K	K	139	158
PSM	KDGSDEPGTAACPNGSFHCTNTGY	822	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	12-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=4770	21.1568499736	3	2543.000176	2542.012516	C	K	59	83
PSM	KDPLPPLDPQAIKPIL	823	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7155	28.084266191466668	3	1754.034933	1754.034208	N	K	2579	2595
PSM	RGSPLLGPVVPGPSPIPSVTEK	824	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6568	26.00277588533333	3	2183.236786	2183.231404	S	R	2898	2920
PSM	REEIDLSSVPSLPVPHPAQTQ	825	sp|Q12968|NFAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6798	26.6997066488	3	2299.187204	2299.180825	H	R	707	728
PSM	KLPLSPPLVEDSAFEPSR	826	sp|O96007|MOC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=6748	26.534576683733334	3	1982.084458	1981.052043	T	K	16	34
PSM	KADTTSTVTPVPGQEKGSALEG	827	sp|Q9H9B1-4|EHMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4594	20.513	3	2172.091	2172.0910	A	R	644	666
PSM	KDGDSVMVLPTIPEEEAK	828	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6420	25.594	3	1956.9714	1956.9714	W	K	182	200
PSM	KDVATVAFCDAQSTQEIHE	829	sp|Q13363-2|CTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:4	ms_run[2]:scan=5795	23.938	3	2147.9793	2147.9793	L	K	35	54
PSM	KEAEDDDTGPEEGSPPKEE	830	sp|O43493-6|TGON2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=3685	16.266	3	2057.8549	2057.8549	P	K	168	187
PSM	KEPEGEEQEPQEMDIDEILK	831	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6737	26.498	3	2385.0894	2385.0894	F	R	978	998
PSM	KEPSPPIDEVINTPRVVD	832	sp|O60684|IMA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6110	24.734	3	2004.0528	2004.0528	S	R	110	128
PSM	KGDVEEDEAVPDSEQDIKP	833	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4862	21.458	3	2098.9542	2098.9542	L	R	317	336
PSM	KGTILISSEEGETEANNH	834	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4726	20.997	3	1927.9123	1927.9123	G	K	390	408
PSM	KILGADLDVVMSLNNLDEESNK	835	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=7151	28.063	3	2432.2105	2432.2105	G	K	336	358
PSM	KISLQPIATVPNGGTTPKIS	836	sp|Q9HCI7-2|MSL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5931	24.264	3	2021.1521	2021.1521	S	K	305	325
PSM	KLESPTVSTLTPSSPGKLLT	837	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6146	24.83	3	2055.1463	2055.1463	V	R	291	311
PSM	KLLDPEDVAVQLPDK	838	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6416	25.584	3	1678.9142	1678.9142	E	K	226	241
PSM	KLPAEPPALLQTHPPC	839	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:4	ms_run[2]:scan=5892	24.163	3	1767.9342	1767.9342	S	R	87	103
PSM	KLSDTTEYQPILSSYSH	840	sp|Q5VT52-2|RPRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5936	24.274	3	1967.9476	1967.9476	S	R	825	842
PSM	KMAVTFIGNSTAIQELFK	841	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35	ms_run[2]:scan=7356	29.033	3	2013.0605	2013.0605	L	R	362	380
PSM	KMIDAGDALIYMEPEKQVMS	842	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35	ms_run[2]:scan=6833	26.816	3	2284.0789	2284.0789	K	R	443	463
PSM	KMSLDPADLTHDTTGLTA	843	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35	ms_run[2]:scan=6079	24.661	3	1901.9041	1901.9041	A	K	102	120
PSM	KMVMIQDGPLPTGADKPL	844	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=5463	23.176	3	1941.9904	1941.9904	V	R	135	153
PSM	KNLPPSGAVPVTGIPPHVV	845	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6409	25.567	3	1878.0727	1878.0727	S	K	257	276
PSM	KQELITYPQPQKTSIPAPLE	846	sp|P78332-2|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6169	24.892	3	2280.2365	2280.2365	A	K	47	67
PSM	KQESPAPEPPTQHSYTYNVSNLDV	847	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5960	24.328	3	2700.2667	2700.2667	L	R	4880	4904
PSM	KQLESLWSDSPAPPGPQAGPPSRPP	848	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6228	25.057	3	2595.3082	2595.3082	T	R	44	69
PSM	KTATPEIVDNKDGTVTV	849	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5003	21.903	3	1786.9313	1786.9313	G	R	1770	1787
PSM	KTELAEPIAIRPTSETVMYPAYA	850	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6691	26.359	3	2550.304	2550.3040	G	K	1109	1132
PSM	KTLPLENASILSEGSLQEGH	851	sp|Q96H35|RBM18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6456	25.695	3	2122.0906	2122.0906	T	R	6	26
PSM	KVAAPEIVSGVSGESEQKL	852	sp|O15381-3|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5553	23.357	3	1927.0262	1927.0262	L	R	131	150
PSM	KVEPEEPSQMPPLPQSHQ	853	sp|Q8IX15|HOMEZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:35	ms_run[2]:scan=4474	20.004	3	2072.9837	2072.9837	L	K	182	200
PSM	KVGDFGDAINWPTPGEIAH	854	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7073	27.728	3	2022.9799	2022.9799	S	K	166	185
PSM	KVVVLSPGTLQEDQATLLSK	855	sp|O43299-3|AP5Z1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6711	26.41	3	2125.1994	2125.1994	A	R	3	23
PSM	KYDEATGLCPEGDECPFLH	856	sp|Q9C0B0|UNK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6157	24.859	3	2236.9405	2236.9405	T	R	92	111
PSM	KYEQGFITDPVVLSPKD	857	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6338	25.365	3	1934.9989	1934.9989	K	R	109	126
PSM	PAYHSSLMDPDTKLIGNMALLPI	858	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=7172	28.159	3	2528.2655	2528.2655	M	R	2	25
PSM	RAEETSSPVIGELWSPDQTAEASHVS	859	sp|Q86XL3-2|ANKL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6728	26.472	3	2782.3046	2782.3046	L	R	482	508
PSM	RCALSSPSLAFTPPIKTLGTPTQPGSTP	860	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:4	ms_run[2]:scan=6868	26.938	3	2881.5008	2881.5008	D	R	237	265
PSM	RDGMELVPQPEDSTAICQCH	861	sp|Q7Z4H8-2|PLGT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,17-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=5170	22.389	3	2358.0039	2358.0039	V	R	423	443
PSM	RDTMDLESSSSEEEKEDDDDALVPDS	862	sp|Q5JRA6-3|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35	ms_run[2]:scan=5095	22.181	3	2929.1778	2929.1778	T	K	398	424
PSM	REPEEINADDEIEDTCDH	863	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:4	ms_run[2]:scan=4910	21.623	3	2185.8706	2185.8706	A	K	338	356
PSM	RGEPETFLPLDYLEVKPTDE	864	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7514	29.783	3	2347.1584	2347.1584	Q	K	564	584
PSM	RGVLIAVLDTGVDPGAPGMQVTTDGKP	865	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	19-UNIMOD:35	ms_run[2]:scan=6975	27.337	3	2679.3902	2679.3902	G	K	36	63
PSM	RIPNSYEVSSAPDVPSMGLVSSH	866	sp|Q8NEZ4-2|KMT2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:35	ms_run[2]:scan=5646	23.565	3	2444.1642	2444.1642	V	R	3226	3249
PSM	RIQQALTSPLPMTPILEGSH	867	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:35	ms_run[2]:scan=6437	25.645	3	2204.1623	2204.1623	I	R	404	424
PSM	RLPATAAEPEAAVISNGEH	868	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5282	22.715	3	1931.9701	1931.9701	P	-	502	521
PSM	RPYQPLGALVVTTPQAVSVGDVR	869	sp|Q9Y5Y2|NUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6887	27.007	3	2422.3332	2422.3332	L	R	149	172
PSM	RSLETPQPAASLPDNTMVTHLFQ	870	sp|O75170-6|PP6R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:35	ms_run[2]:scan=6708	26.4	3	2568.2642	2568.2642	N	K	399	422
PSM	RTPVANQSSNLTATQMSFPVQGVHTVAQTVS	871	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:35	ms_run[2]:scan=6073	24.639	3	3271.6255	3271.6255	Q	R	652	683
PSM	RVTMPGEPVDVACGVDHMVTLA	872	sp|Q96I51|RCC1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,13-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=5879	24.131	3	2385.1127	2385.1127	W	K	439	461
PSM	KLLVDVDESTLSPEEQKE	873	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5822	23.989981273333335	3	2058.039175	2058.036846	D	R	477	495
PSM	KVVPSFLPVDQGGSLVGRNGVGGMA	874	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	24-UNIMOD:35	ms_run[1]:scan=6712	26.41293150186667	3	2457.272063	2456.284579	D	K	667	692
PSM	KTPVVQNAASIVQPSPAHVGQQGLS	875	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5398	23.005860726133335	3	2512.344552	2512.339785	Q	K	199	224
PSM	KASLQSQLPEGVPQHQLPPQYQ	876	sp|Q15750|TAB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5581	23.428047293866666	3	2472.282083	2472.276122	E	K	128	150
PSM	KVTFFEPGSGDENGTSNKEDEF	877	sp|O95793|STAU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=6335	25.352365613333333	3	2434.048886	2433.060829	R	R	382	404
PSM	KPSTDLSAPVNGEATSQKGESAED	878	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4385	19.592233361866665	3	2418.113070	2417.119407	D	K	593	617
PSM	KPSTDLSAPVNGEATSQKGESAED	879	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4531	20.257324972266666	3	2418.112655	2417.119407	D	K	593	617
PSM	KVMPFSTACNTPLSNFESHQNY	880	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	9-UNIMOD:4	ms_run[1]:scan=6735	26.49040382826667	3	2571.155249	2571.152244	V	K	177	199
PSM	KSGFEPPGDIEFEDYTQPMK	881	sp|Q96RU3|FNBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	19-UNIMOD:35	ms_run[1]:scan=6398	25.53411896	3	2330.040800	2330.041280	Y	R	273	293
PSM	KGSAPPGPVPEGSIRIYSM	882	sp|P78417|GSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	19-UNIMOD:35	ms_run[1]:scan=5485	23.2227945016	3	1957.988926	1957.993148	G	R	11	30
PSM	KSTNQQTATDVSTSSNIEESVNHMDGESL	883	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	24-UNIMOD:35	ms_run[1]:scan=5347	22.882511353066665	3	3124.375817	3124.373860	L	K	862	891
PSM	KDFAMDGLVNIVGGCCGSTPDHI	884	sp|Q99707|METH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	5-UNIMOD:35,15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=6841	26.844653584	3	2478.099535	2478.097766	L	R	309	332
PSM	KLGLGLDDESNNQQAAATQSPGDSR	885	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5054	22.064958450666666	3	2572.239527	2571.216101	E	R	1707	1732
PSM	KFASYCLTEPGSGSDAASLLTSAK	886	sp|Q9UKU7|ACAD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	37	6-UNIMOD:4	ms_run[1]:scan=6572	26.014765372266666	3	2461.2022	2460.1842	E	K	154	178
PSM	KAEAQQVEALPGPSLDQWH	887	sp|Q66PJ3-7|AR6P4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6253	25.131	3	2103.0385	2103.0385	E	R	117	136
PSM	KALVVPEPEPDSDSNQER	888	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4719	20.973	3	2008.9702	2008.9702	R	K	125	143
PSM	KAMIVPSSPSKTPEEVSTPAEEE	889	sp|Q01484-7|ANK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:35	ms_run[2]:scan=4743	21.057	3	2458.1785	2458.1785	Q	K	353	376
PSM	KANELPQPPVPEPANAGK	890	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5017	21.944	3	1855.9792	1855.9792	P	R	285	303
PSM	KDCEVVMMIGLPGAGKTTWVT	891	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=6637	26.2	3	2324.1215	2324.1215	K	K	476	497
PSM	KDQQEAALVDMVNDGVEDLRC	892	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=6652	26.246	3	2420.0948	2420.0948	G	K	82	103
PSM	KDSIPVTELSASGPFESHDLL	893	sp|Q9Y244|POMP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7131	27.962	3	2241.1165	2241.1165	L	R	11	32
PSM	KDSQVGTVNYMPPEAIKDMSSS	894	sp|P33981-2|TTK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=4959	21.768	3	2415.0934	2415.0934	V	R	679	701
PSM	KDYEIESQNPLASPTNTLLGSAKEQ	895	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6526	25.899	3	2732.3505	2732.3505	S	R	617	642
PSM	KELEPEMEFEIEPDKEC	896	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4	ms_run[2]:scan=6366	25.445	3	2150.9388	2150.9388	S	K	423	440
PSM	KELPTDMELSAHDDGAPAGV	897	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:35	ms_run[2]:scan=5115	22.24	3	2067.9419	2067.9419	A	R	1193	1213
PSM	KEPSGPSELIPSSTFSAHN	898	sp|Q96GA3|LTV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5838	24.029	3	1983.9538	1983.9538	L	R	73	92
PSM	KEVAETSAGPSVVSVKTDGGDPSGLL	899	sp|P13196|HEM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6081	24.667	3	2499.2704	2499.2704	R	K	142	168
PSM	KGFESPSDNSSAMLLQWHE	900	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:35	ms_run[2]:scan=6431	25.627	3	2177.9688	2177.9688	Y	K	112	131
PSM	KIPENEVPAPVKPVTDSTSAPAP	901	sp|Q15811-13|ITSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5203	22.487	3	2343.2322	2343.2322	E	K	798	821
PSM	KIQEDPSLCGDKPSISAVTVELS	902	sp|Q9P000-2|COMD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:4	ms_run[2]:scan=6469	25.73	3	2472.2418	2472.2418	M	K	110	133
PSM	KLAGANPAVITCDELLLGHE	903	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:4	ms_run[2]:scan=6994	27.401	3	2120.0936	2120.0936	R	K	4019	4039
PSM	KLLGPDAAINLTDPDGALAK	904	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6525	25.895	3	1992.0892	1992.0892	E	R	156	176
PSM	KMASAPASYGSTTTKPMGLLS	905	sp|Q8WVM8-2|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=4926	21.672	3	2130.0337	2130.0337	T	R	409	430
PSM	KNLPPSGAVPVTGIPPHVV	906	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5691	23.686	3	1878.0727	1878.0727	S	K	257	276
PSM	KPGSPEPETEPVSSVQENHENE	907	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4268	19.059	3	2419.0775	2419.0775	G	R	547	569
PSM	KPLLIGELAPEEPSQDHG	908	sp|O95864-3|FADS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6212	25.016	3	1928.9844	1928.9844	L	K	87	105
PSM	KPQPNFPSPEYMIFDHEFT	909	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:35	ms_run[2]:scan=7120	27.918	3	2339.0569	2339.0569	Q	K	596	615
PSM	KQVAVAELLENVGQVNEHDGGAQPGPVP	910	sp|O76024|WFS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7237	28.457	3	2851.4464	2851.4464	K	K	193	221
PSM	KSAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPST	911	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:35,37-UNIMOD:4	ms_run[2]:scan=5349	22.888	4	4327.9903	4327.9903	V	R	226	268
PSM	KSIAIGSQPVLTVGTTHIS	912	sp|Q96DZ1-3|ERLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5954	24.315	3	1908.068	1908.0680	H	K	309	328
PSM	KSPGDFTSAAQLASTPFH	913	sp|O43683-2|BUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6423	25.601	3	1860.9006	1860.9006	P	K	595	613
PSM	KSVESTSPEPSKIMLVEPPVA	914	sp|P18583-6|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6223	25.043	3	2224.1661	2224.1661	L	K	277	298
PSM	KTASPEDSDMPDHDLEPP	915	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:35	ms_run[2]:scan=4729	21.003	3	1995.8368	1995.8368	R	R	1305	1323
PSM	KTITLEVEPSDTIENVKA	916	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5937	24.277	3	1986.0521	1986.0521	G	K	11	29
PSM	KTSASDVTNIYPGDAGKAGDQLVPDNL	917	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6532	25.919	3	2745.3457	2745.3457	K	K	491	518
PSM	KTYEVNEVGVLNPNEQPTH	918	sp|Q8N442|GUF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5343	22.873	3	2167.0546	2167.0546	Q	K	293	312
PSM	KVAPQNDSFGTQLPPMHQQQ	919	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:35	ms_run[2]:scan=4708	20.935	3	2266.0801	2266.0801	K	R	77	97
PSM	KVLDSGAPIKIPVGPETLG	920	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6634	26.193	3	1890.0826	1890.0826	Q	R	124	143
PSM	KVPEVPTAPATDAAPK	921	sp|Q9UHD8-3|SEPT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4646	20.714	2	1590.8617	1590.8617	S	R	7	23
PSM	KVPPAVIIPPAAPLSGR	922	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5934	24.27	3	1682.0243	1682.0243	G	R	1860	1877
PSM	KVSEEAESQQQWDTSKGEQVSQNGLPAEQGSP	923	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5158	22.361	4	3457.587	3457.5870	T	R	2095	2127
PSM	MHSLATAAPVPTTLAQVDRE	924	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:35	ms_run[2]:scan=5819	23.984	3	2123.0681	2123.0681	-	K	1	21
PSM	RALTVPELTQQVFDAKNMMAACDP	925	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	18-UNIMOD:35,19-UNIMOD:35,22-UNIMOD:4	ms_run[2]:scan=6908	27.082	3	2737.2874	2737.2874	Y	R	282	306
PSM	REAAGPVGPALEPPTLPLH	926	sp|O00459|P85B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6504	25.834	3	1921.0421	1921.0421	L	R	199	218
PSM	RIEPGVSVSLVNPQPSNGHFST	927	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5985	24.391	3	2321.1764	2321.1764	F	K	1008	1030
PSM	RILEDQEENPLPAALVQPHTG	928	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6311	25.284	3	2326.1917	2326.1917	K	K	214	235
PSM	RTDIVGGVPIITPTQKEEVNECGESID	929	sp|Q9HB21-2|PKHA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	22-UNIMOD:4	ms_run[2]:scan=6385	25.493	3	2955.4495	2955.4495	Y	R	142	169
PSM	RVSMASSGSSQPELVTIPLIKGP	930	sp|Q5TCQ9-3|MAGI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:35	ms_run[2]:scan=6858	26.905	3	2369.2624	2369.2624	Q	K	563	586
PSM	RVVSWLVSSDNPQPEMAPPVHEP	931	sp|O14641|DVL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:35	ms_run[2]:scan=6245	25.11	3	2586.2537	2586.2537	G	R	84	107
PSM	SAVGAATPYLHHPGDSHSG	932	sp|Q9GZQ3|COMD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5179	22.415	3	1901.8656	1901.8656	M	R	2	21
PSM	KANDGGLAAGAPAMHMASYGPEPCTDNSDSLIA	933	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	24-UNIMOD:4	ms_run[1]:scan=6605	26.10887521973333	3	3289.454178	3288.448562	A	K	62	95
PSM	KSDALETLGFLNHYQM	934	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	16-UNIMOD:35	ms_run[1]:scan=7206	28.314789618133332	3	1881.898878	1881.893100	S	K	552	568
PSM	RAEYVPSTPSPVPPSTPLLSAHS	935	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6158	24.86092122053333	3	2390.230527	2389.227775	Y	K	833	856
PSM	KGADDAADADTAIINAEGGQNNSEEK	936	sp|Q9BY67|CADM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5194	22.45899955546667	3	2606.118112	2603.158311	A	K	412	438
PSM	KGSLESPATDVFGSTEEGEK	937	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5511	23.278398258666666	3	2067.984326	2066.964410	R	R	330	350
PSM	KGSSEQAESDNMDVPPEDDSKEGAGEQ	938	sp|Q12906|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=3798	16.829110075466666	3	2835.144244	2835.162470	E	K	54	81
PSM	KTSTPLAPLPVQSQSDTKD	939	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5028	21.9685487272	3	2012.031229	2012.042600	A	R	1288	1307
PSM	KYDEATGLCPEGDECPFLH	940	sp|Q9C0B0|UNK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	9-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=6147	24.832029973066668	3	2236.943527	2236.940520	T	R	92	111
PSM	RQTPQVNINPFTPDSLLLHSSGQC	941	sp|P30291|WEE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	24-UNIMOD:4	ms_run[1]:scan=7230	28.423978432266665	3	2709.366028	2708.334048	V	R	228	252
PSM	KFSDDAAEPNNDAEALVNGFEHGGLA	942	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6569	26.004598757333333	3	2687.204816	2687.209953	L	K	284	310
PSM	KAAGLATMISTMRPDIDNMDEYV	943	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:35,12-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=5883	24.139	3	2589.1761	2589.1761	A	R	602	625
PSM	KATNESEDEIPQLVPIGK	944	sp|O76021-2|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6178	24.92	3	1967.0211	1967.0211	V	K	136	154
PSM	KDMQPSMESDMALVKDMELPTE	945	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=6490	25.787	3	2556.1104	2556.1104	A	K	290	312
PSM	KEAEEEELEIPPQYQAGGSGIH	946	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6308	25.278	3	2410.1288	2410.1288	Q	R	1099	1121
PSM	KELEGWEPDDDPIEEH	947	sp|O15392-5|BIRC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5882	24.137	3	1936.8327	1936.8327	F	K	62	78
PSM	KEPIPVLPTVHYNMGGIPTNY	948	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=6677	26.317	3	2355.1933	2355.1933	T	K	252	273
PSM	KEPVNLEGDDTSLIHG	949	sp|Q9H2J7-3|S6A15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5493	23.236	3	1722.8424	1722.8424	L	K	557	573
PSM	KEPVPSALPPSLIPPSK	950	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5992	24.412	3	1756.0135	1756.0135	E	R	197	214
PSM	KEVIIMATNCENCGH	951	sp|O75312|ZPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4269	19.064	3	1790.775	1790.7750	F	R	279	294
PSM	KEVIPVNVPEAQEEMKEVA	952	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6599	26.092	3	2138.0929	2138.0929	K	K	513	532
PSM	KGVPATNPAPGKGTGSGLIGASGATMPTDTS	953	sp|Q14781|CBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	26-UNIMOD:35	ms_run[2]:scan=4831	21.354	3	2813.3865	2813.3865	T	K	379	410
PSM	KIDISPAPENPHYCLTPELLQV	954	sp|Q96N67-7|DOCK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=7204	28.304	3	2533.2887	2533.2887	L	K	510	532
PSM	KLGDVGMAELCPGLLHPSS	955	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6258	25.142	3	1995.9758	1995.9758	N	R	238	257
PSM	KLGLPPLTPEQQEALQKA	956	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6389	25.505	3	1960.0993	1960.0993	A	K	10	28
PSM	KLLSALCPEEPPVHSSAQIVS	957	sp|Q9NR50-3|EI2BG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4	ms_run[2]:scan=6060	24.596	3	2261.1726	2261.1726	P	K	328	349
PSM	KLSEGSQPAEEEEDQETPSRNL	958	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4622	20.619	3	2472.1252	2472.1252	A	R	238	260
PSM	KMEIGDTLSTAEESSPPKS	959	sp|Q9BYW2-3|SETD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:35	ms_run[2]:scan=4776	21.177	3	2021.9463	2021.9463	M	R	117	136
PSM	KMGLVDQLVEPLGPGLKPPEE	960	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7223	28.388	3	2245.2028	2245.2028	K	R	214	235
PSM	KNLPPSGAVPVTGIPPHVV	961	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6002	24.446	3	1878.0727	1878.0727	S	K	257	276
PSM	KPAPGYTPNVVVGQVPPGTNHIS	962	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5426	23.076	3	2328.2226	2328.2226	S	K	481	504
PSM	KQDQPIDFSEDARPSPCYQLAQ	963	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:4	ms_run[2]:scan=6022	24.486	3	2592.1915	2592.1915	F	R	274	296
PSM	KQQQMPPPPPPPPPPPPAGGTGGKG	964	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:35	ms_run[2]:scan=4480	20.033	3	2427.2369	2427.2369	S	K	623	648
PSM	KSGDAAIVDMVPGKPMCVESFSDYPPLG	965	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	10-UNIMOD:35,16-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=6807	26.728	3	2998.3762	2998.3762	L	R	395	423
PSM	KSGSPIVLALPHSQLPQAQ	966	sp|Q6MZP7-5|LIN54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6318	25.304	3	1970.0949	1970.0949	G	K	147	166
PSM	KSMPPSLETSPITDTDLAK	967	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:35	ms_run[2]:scan=5520	23.297	3	2046.0191	2046.0191	M	R	3451	3470
PSM	KSQETECTYFSTPLLLGK	968	sp|P40926-2|MDHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4	ms_run[2]:scan=6861	26.912	3	2101.0402	2101.0402	V	K	237	255
PSM	KSSVLIAQQTDTSDPEKVVSAFL	969	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7478	29.617	3	2462.2904	2462.2904	P	K	452	475
PSM	KSTPPPNNLVNPVQELETER	970	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6319	25.306	3	2261.1652	2261.1652	P	R	341	361
PSM	KTITLEVEPSDTIENVKA	971	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5789	23.925	3	1986.0521	1986.0521	G	K	11	29
PSM	KTSEVPYAGINIGPVH	972	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6014	24.468	3	1680.8835	1680.8835	L	K	999	1015
PSM	KVENSLEPADDTVHESAEPS	973	sp|P52803|EFNA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4572	20.427	3	2152.976	2152.9760	D	R	180	200
PSM	KVILNPVNAGQPLHASNYELSDNAGC	974	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	26-UNIMOD:4	ms_run[2]:scan=6061	24.598	3	2780.3552	2780.3552	D	K	182	208
PSM	KVLSVETPLSIQAHPN	975	sp|P34949-2|MPI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5785	23.911	3	1731.9519	1731.9519	F	K	99	115
PSM	KVMPFSTACNTPLSNFESHQNY	976	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=6753	26.549	3	2571.1522	2571.1522	V	K	177	199
PSM	KVSVTPPEESQNSDTPPRPD	977	sp|Q05209-2|PTN12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4524	20.227	3	2179.0393	2179.0393	N	R	375	395
PSM	KVYTDVQQVASSLTHP	978	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6462	25.713	3	1771.9105	1771.9105	F	R	306	322
PSM	MEEELQHSHCVNCVSR	979	sp|Q8TB52|FBX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4453	19.908	3	2071.851	2071.8510	-	R	1	17
PSM	RAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAAT	980	sp|Q9UKY7-2|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4146	18.487	5	3696.7185	3696.7185	N	K	27	76
PSM	RASTDEPPADTQGMSIPAQPHAST	981	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=4310	19.247	3	2480.1238	2480.1238	S	R	1725	1749
PSM	RATSEVPGSQASPNPVPGDGLH	982	sp|Q96GM8-2|TOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4803	21.273	3	2172.056	2172.0560	D	R	337	359
PSM	RCPEALFQPSFLGMESCGIHETTFNSIM	983	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4,17-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=7487	29.661	3	3274.4556	3274.4556	F	K	256	284
PSM	REECPVFTPPGGETLDQVKM	984	sp|Q9NQ88|TIGAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=5855	24.068	3	2305.0719	2305.0719	A	R	111	131
PSM	REEEVTGPVIAPLFPQK	985	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6592	26.074	3	1909.0309	1909.0309	E	R	2043	2060
PSM	RLAPPPPPAAAPGTPHLLS	986	sp|Q9HAH7|FBRS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5686	23.675	3	1859.0418	1859.0418	S	K	408	427
PSM	RPGVATPLVSSSDYMPMAPQNVSASK	987	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6296	25.245	3	2689.3204	2689.3204	M	K	704	730
PSM	RSLELSSLAGPGEDPLSADSLGKPT	988	sp|Q13615-3|MTMR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6810	26.74	3	2496.2708	2496.2708	R	R	646	671
PSM	RSPLLAGGSPPQPVVPAH	989	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5364	22.925	3	1778.9792	1778.9792	M	K	48	66
PSM	RTEVEVEELPPIDHGIPITD	990	sp|Q9P2X3-2|IMPCT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6719	26.437	3	2258.143	2258.1430	T	R	44	64
PSM	RTNLYWPGTAEPLLVSSPEHP	991	sp|P51688|SPHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7146	28.033	3	2363.191	2363.1910	G	K	282	303
PSM	RTTVTELPQTSHVSFSEPDIPSS	992	sp|Q9NYP3-2|DONS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6062	24.603	3	2514.2238	2514.2238	E	K	126	149
PSM	KTASDVVQPAAVQAQGQVNDENR	993	sp|Q9BX40|LS14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4787	21.215795517333333	3	2425.200344	2424.199329	S	R	195	218
PSM	RDGPNALTPPPTTPEWIKFC	994	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	20-UNIMOD:4	ms_run[1]:scan=7077	27.749685278666668	3	2296.139182	2296.131038	A	R	74	94
PSM	KLIDIFYPGDQQSVTFGTKS	995	sp|P54886|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7208	28.324123074133336	3	2244.153295	2243.147400	A	R	282	302
PSM	KGVNLPGAAVDLPAVSEKDIQDL	996	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7203	28.299658475466668	3	2348.262990	2348.258741	K	K	207	230
PSM	KEPEAAAPAPGTGGDSVCGETH	997	sp|Q08379|GOGA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	18-UNIMOD:4	ms_run[1]:scan=4089	18.226088686399997	3	2136.946016	2136.938212	Q	R	777	799
PSM	KMGLVDQLVEPLGPGLKPPEE	998	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7208	28.324123074133336	3	2245.208020	2245.202806	K	R	214	235
PSM	KQAQVPISSEPPEEGEKEDL	999	sp|Q9P2N6-3|KANL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4937	21.702275883466665	3	2210.067515	2209.075023	H	R	577	597
PSM	KTSPVVAPTSEPSSPLHTQLL	1000	sp|O75044|SRGP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6084	24.6751224256	3	2188.182865	2188.173949	L	K	981	1002
PSM	KAEAQQVEALPGPSLDQWH	1001	sp|Q66PJ3-7|AR6P4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6229	25.06	3	2103.0385	2103.0385	E	R	117	136
PSM	KAEVDMDTDAPQVSH	1002	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:35	ms_run[2]:scan=3835	17.009	3	1657.7254	1657.7254	D	K	933	948
PSM	KALIQTCLNSPDSPPRSDPTTDQ	1003	sp|P11831|SRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=5127	22.272	3	2540.2177	2540.2177	G	R	212	235
PSM	KAPEPVCAAPGPPHGPAGAASNFYSAVG	1004	sp|P31277|HXD11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=5962	24.332	3	2676.2755	2676.2755	F	R	142	170
PSM	KASSEGTIPQVQREEPAPEEEEPLLLQ	1005	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6382	25.485	3	3003.5037	3003.5037	Q	R	309	336
PSM	KDDQLLDDGKTLGECGFTSQTA	1006	sp|Q15370|ELOB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	15-UNIMOD:4	ms_run[2]:scan=6137	24.807	3	2398.0958	2398.0958	Y	R	46	68
PSM	KDLLEPGCSVLLNH	1007	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:4	ms_run[2]:scan=6160	24.867	3	1593.8185	1593.8185	D	K	68	82
PSM	KDMQPSMESDMALVKDMELPTE	1008	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=6769	26.601	3	2556.1104	2556.1104	A	K	290	312
PSM	KEAAASGLPLMVIIH	1009	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=6563	25.989	3	1564.8647	1564.8647	K	K	48	63
PSM	KEAELENSGLALYDGKDGTDGETEVGEIQQN	1010	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6179	24.922	3	3308.5168	3308.5168	L	K	86	117
PSM	KEAQSSQATPVQTSQPDSSNIVKVSP	1011	sp|Q8IZH2-2|XRN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4965	21.79	3	2712.3566	2712.3566	N	R	1609	1635
PSM	KELEPEMEFEIEPDKEC	1012	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=5744	23.816	3	2166.9337	2166.9337	S	K	423	440
PSM	KENGPVVETVQVPLSK	1013	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5342	22.87	3	1722.9516	1722.9516	R	R	601	617
PSM	KEVSIEDTGVDVDPEKLEMES	1014	sp|Q8WWK9-6|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6549	25.95	3	2348.0941	2348.0941	V	K	482	503
PSM	KIIDINYYPVPEACLSNK	1015	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:4	ms_run[2]:scan=6647	26.233	3	2136.0925	2136.0925	N	R	479	497
PSM	KINVPELPTPDEDNKLEVQ	1016	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6291	25.232	3	2177.1216	2177.1216	S	K	430	449
PSM	KIPDVAPIVSDQKPSVS	1017	sp|P30414|NKTR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5518	23.293	3	1778.9778	1778.9778	P	K	311	328
PSM	KISSIQSIVPALEIANAH	1018	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7124	27.935	3	1890.0575	1890.0575	K	R	250	268
PSM	KISSIQSIVPALEIANAH	1019	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7248	28.508	3	1890.0575	1890.0575	K	R	250	268
PSM	KLLTSVEVDNIEPSAFH	1020	sp|Q70EL1-9|UBP54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6557	25.971	3	1897.9785	1897.9785	L	R	42	59
PSM	KLMNESLMLVTALNPHIGYD	1021	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=7128	27.947	3	2290.1337	2290.1337	N	K	404	424
PSM	KMADCGGLPQVVQPGKLTEAF	1022	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=6763	26.579	3	2261.1184	2261.1184	L	K	197	218
PSM	KMVMIQDGPLPTGADKPL	1023	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:35	ms_run[2]:scan=5870	24.109	3	1925.9955	1925.9955	V	R	135	153
PSM	KMVMIQDGPLPTGADKPL	1024	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6208	25.009	3	1910.0005	1910.0005	V	R	135	153
PSM	KNLPPSGAVPVTGIPPHVV	1025	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5848	24.052	3	1878.0727	1878.0727	S	K	257	276
PSM	KNLPPSGAVPVTGIPPHVV	1026	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6544	25.94	3	1878.0727	1878.0727	S	K	257	276
PSM	KNLPPSGAVPVTGIPPHVV	1027	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6676	26.315	3	1878.0727	1878.0727	S	K	257	276
PSM	KNMVIMPGYCVQGTVGH	1028	sp|Q5TA45-2|INT11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35,6-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=4904	21.602	3	1921.8849	1921.8849	E	K	244	261
PSM	KPAPPATPGAPTSPAEH	1029	sp|Q96GE9-2|DMAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3990	17.739	3	1624.8209	1624.8209	A	R	25	42
PSM	KPYPMYPATTSLVNVVPKLNATG	1030	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:35	ms_run[2]:scan=6841	26.845	3	2476.3036	2476.3036	Y	R	205	228
PSM	KPYPMYPATTSLVNVVPKLNATG	1031	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7118	27.907	3	2460.3087	2460.3087	Y	R	205	228
PSM	KSLEPEDEVEDDPKVTLEA	1032	sp|Q13207|TBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5600	23.465	3	2142.0216	2142.0216	L	K	93	112
PSM	KSQACEPSEPEIEIKLP	1033	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=6524	25.893	3	1953.9717	1953.9717	P	K	785	802
PSM	KTIAQTTAPVSWKPQDSSEQPQE	1034	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5193	22.456	3	2555.2504	2555.2504	G	K	646	669
PSM	KTPADGGSVDLPPVGHDELS	1035	sp|Q96DT7-3|ZBT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5452	23.151	3	1989.9643	1989.9643	Q	R	104	124
PSM	KTVTYEDPQAVGGLASALDNR	1036	sp|Q6ZVM7-4|TM1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6344	25.383	3	2204.1073	2204.1073	R	K	133	154
PSM	KVIYVLPMLTIKED	1037	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=6920	27.129	3	1676.9423	1676.9423	Y	K	316	330
PSM	KVMLMASPSMEDLYH	1038	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5235	22.565	3	1782.7991	1782.7991	A	K	433	448
PSM	KVQVLYPDGQAQMIHP	1039	sp|Q96HW7-4|INT4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=5391	22.988	3	1838.9349	1838.9349	V	K	237	253
PSM	RDVDELPSLQPSVGSPSRPSSS	1040	sp|O43815-2|STRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5538	23.333	3	2296.1295	2296.1295	L	R	313	335
PSM	REEIIPVAAEYDKTGEYPVPLI	1041	sp|P11310|ACADM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7359	29.047	3	2501.3054	2501.3054	A	R	57	79
PSM	RELESVCVVEAGPGTCTFDH	1042	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5811	23.967	3	2262.0045	2262.0045	S	R	262	282
PSM	RLPATAAEPEAAVISNGEH	1043	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5188	22.441	3	1931.9701	1931.9701	P	-	502	521
PSM	RPEGLTSVLELGPEADQPEAAKF	1044	sp|Q9H6R4-3|NOL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7170	28.15	3	2453.2438	2453.2438	L	R	557	580
PSM	RPNAPVPLVIDMPEHNPGNLGGTM	1045	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=5961	24.33	3	2557.2417	2557.2417	F	R	425	449
PSM	RPSPDYPMLPTIPLSAFSDPK	1046	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=7330	28.91	3	2344.1773	2344.1773	S	K	153	174
PSM	RSVIDPVPAPVGDSHVDGAA	1047	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5334	22.848	3	1957.9858	1957.9858	T	K	196	216
PSM	RSYDVPPPPMEPDHPFYSNIS	1048	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6497	25.808	3	2444.1107	2444.1107	R	K	117	138
PSM	RTPTGNAPSSESDIDISSPNVSHDESIA	1049	sp|O95251-4|KAT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5371	22.942	3	2882.3166	2882.3166	P	K	127	155
PSM	RYIMVPSGNMGVFDPTEIHN	1050	sp|Q9P003|CNIH4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:35	ms_run[2]:scan=6762	26.577	3	2292.0667	2292.0667	Y	R	84	104
PSM	KLASQGDSISSQLGPIHPPP	1051	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5876	24.124928046933334	3	2028.070065	2028.064004	K	R	122	142
PSM	KIPCESPPLEVVDTTASTK	1052	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	4-UNIMOD:4	ms_run[1]:scan=5560	23.378035268799998	3	2072.066730	2071.050722	T	R	2703	2722
PSM	KSLTGVVNAQALTSAFSPHT	1053	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7042	27.60817559306667	3	2030.051935	2028.064004	G	K	310	330
PSM	KPLLPIPITQKPQGAPETL	1054	sp|Q14119|VEZF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6697	26.374977956000002	3	2040.199402	2040.198313	Q	K	41	60
PSM	KNLPPSGAVPVTGIPPHVV	1055	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6145	24.827410911466664	3	1878.074218	1878.072718	S	K	257	276
PSM	KLNNDDNVDGLLVQLPLPEHIDE	1056	sp|P13995|MTDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7495	29.700403441333332	3	2599.319377	2599.312962	N	R	119	142
PSM	KTDGDDTETVPSEQSHASG	1057	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3628	15.996255209600001	3	1959.831739	1959.829373	S	K	105	124
PSM	RIEDLNEGMDFDTMDIDLPPSKN	1058	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	9-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=6193	24.964103672	3	2696.189985	2696.194563	G	R	1181	1204
PSM	KLTETVVTEYLNSGNANEAVNGVREM	1059	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	26-UNIMOD:35	ms_run[1]:scan=6612	26.127545964	3	2855.395610	2853.381452	L	R	546	572
PSM	KDGVPEGAQLQGPVH	1060	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4675	20.817	3	1530.7791	1530.7791	M	R	199	214
PSM	KDIADVTAVAEAILPKGSA	1061	sp|Q96L91-3|EP400_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7399	29.246	3	1868.0255	1868.0255	A	R	982	1001
PSM	KDSLASNIVNLTPQNQPHPTAT	1062	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5965	24.342	3	2345.1975	2345.1975	S	K	223	245
PSM	KEEQQPEEEEALVQH	1063	sp|A4D1P6-3|WDR91_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4609	20.569	3	1821.8381	1821.8381	K	K	211	226
PSM	KEFQEAGEPITDDSTSLH	1064	sp|Q9BQS8-3|FYCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5032	21.981	3	2002.912	2002.9120	S	K	26	44
PSM	KEIEIDIEPTDKVE	1065	sp|Q15843|NEDD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5611	23.486	3	1656.8458	1656.8458	G	R	11	25
PSM	KESLPVSGEESQLTPEKSP	1066	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5025	21.963	3	2041.0215	2041.0215	Y	K	968	987
PSM	KETPDTLSDPQTVPEEEREA	1067	sp|O94822-2|LTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4782	21.199	3	2270.055	2270.0550	I	K	200	220
PSM	KGDVEEDETIPDSEQDIRP	1068	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5142	22.313	3	2170.9866	2170.9866	L	R	277	296
PSM	KGFVPSPTSQPGGHESLVD	1069	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5296	22.749	3	1937.9483	1937.9483	G	R	966	985
PSM	KGPTLPTGLELVNRPPSSTELG	1070	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6666	26.285	3	2262.222	2262.2220	T	R	2953	2975
PSM	KGTVPDDAVEALADSLGK	1071	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7213	28.343	3	1784.9156	1784.9156	L	K	308	326
PSM	KLEEGGPVYSPPAEVVVK	1072	sp|O95202-2|LETM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5447	23.136	3	1897.0197	1897.0197	K	K	93	111
PSM	KLEPNLGEDDEDKDLEPGPSGTS	1073	sp|Q92797-2|SYMPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5215	22.515	3	2441.1082	2441.1082	M	K	361	384
PSM	KLTEVPVEPVLTVHPES	1074	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6101	24.714	3	1873.0197	1873.0197	V	K	536	553
PSM	KMDGPGYGDEEEPLHTILG	1075	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=6632	26.188	3	2072.9361	2072.9361	W	K	137	156
PSM	KMIDAGDALIYMEPEKQVMS	1076	sp|Q9P2J5-2|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=6007	24.453	3	2300.0738	2300.0738	K	R	443	463
PSM	KMILIQDGSQNTNVDKPL	1077	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=5294	22.742	3	2029.0514	2029.0514	V	R	266	284
PSM	KMPCQSLQPEPINTPTHT	1078	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=4716	20.963	3	2093.9874	2093.9874	T	K	644	662
PSM	KNDQDTWDYTNPNLSGQGDPGSNPNK	1079	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5424	23.071	3	2861.2489	2861.2489	F	R	144	170
PSM	KNMDPLNDNIATLLHQSSD	1080	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35	ms_run[2]:scan=6923	27.144	3	2141.0059	2141.0059	M	K	587	606
PSM	KNMDPLNDNVATLLHQSSD	1081	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35	ms_run[2]:scan=6556	25.968	3	2126.9902	2126.9902	M	R	594	613
PSM	KPAVPTVASSTDMLHS	1082	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5316	22.802	3	1639.824	1639.8240	S	K	1905	1921
PSM	KPLLPLFSPIKPVQTS	1083	sp|Q9Y467|SALL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7109	27.867	3	1764.0549	1764.0549	T	K	236	252
PSM	KPQDGDVIAPLITPQK	1084	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5844	24.043	3	1718.9567	1718.9567	T	K	510	526
PSM	KPVVFSPTLMLTDEEKA	1085	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=6283	25.209	3	1919.9914	1919.9914	T	R	370	387
PSM	KQGAPTSFLPPEASQLKPD	1086	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6180	24.925	3	2010.0422	2010.0422	M	R	103	122
PSM	KQSTLNFDSPLYVGGMPGKSNVASL	1087	sp|O94813-3|SLIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:35	ms_run[2]:scan=6779	26.636	3	2625.3109	2625.3109	S	R	1261	1286
PSM	KSAVPGDLLTLPGTTEHL	1088	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6951	27.249	3	1847.9993	1847.9993	Q	R	290	308
PSM	KSEDVPYTAALTAVRPS	1089	sp|Q15904|VAS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5899	24.181	3	1803.9367	1803.9367	L	R	211	228
PSM	KSGCIVNNLAEFTVDPKDAG	1090	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4	ms_run[2]:scan=6699	26.378	3	2134.0365	2134.0365	E	K	657	677
PSM	KSLDDDLDGVPLDATEDSK	1091	sp|O15042-3|SR140_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5645	23.564	3	2031.9484	2031.9484	I	K	321	340
PSM	KTALVPPSADYSTPPH	1092	sp|Q8TBE0-3|BAHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4977	21.837	3	1679.8519	1679.8519	R	R	731	747
PSM	KTASFSSLEPQDQEDLEPVK	1093	sp|Q96EP1-5|CHFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5718	23.747	3	2247.0907	2247.0907	R	K	146	166
PSM	KTIQNLYDLDEDDDGIASVPTKQM	1094	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	24-UNIMOD:35	ms_run[2]:scan=6383	25.488	3	2724.28	2724.2800	T	K	147	171
PSM	KTLTETDLYCEPPEVQPPPK	1095	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4	ms_run[2]:scan=5543	23.341	3	2341.1512	2341.1512	M	R	1140	1160
PSM	KTPMQPPPSSQDPYGSVSQASR	1096	sp|Q8NEZ4-2|KMT2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35	ms_run[2]:scan=4446	19.879	3	2360.1067	2360.1067	F	R	1105	1127
PSM	KTVIPGMPTVIPPGLTREQE	1097	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:35	ms_run[2]:scan=6015	24.469	3	2178.1718	2178.1718	Q	R	30	50
PSM	KTVNELQNLTAAEVVVPRDQTPDENDQVIV	1098	sp|Q9NZI8-2|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7040	27.599	3	3333.7052	3333.7052	G	K	369	399
PSM	KTYNTDVPLVLMNSFNTDEDTK	1099	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7294	28.735	3	2544.2054	2544.2054	N	K	140	162
PSM	KVMLMASPSMEDLYH	1100	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5202	22.483	3	1782.7991	1782.7991	A	K	433	448
PSM	KVMPTVPTSQVTGPPPQPPPIR	1101	sp|Q8NFD5-4|ARI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35	ms_run[2]:scan=5306	22.772	3	2339.2671	2339.2671	Q	R	819	841
PSM	KYLIATSEQPIAALH	1102	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5938	24.278	3	1653.909	1653.9090	E	R	266	281
PSM	MKPGATGESDLAEVLPQH	1103	sp|Q709F0-2|ACD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:35	ms_run[2]:scan=5657	23.599	3	1894.9095	1894.9095	-	K	1	19
PSM	RDEPSVAAMVYPFTGDH	1104	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35	ms_run[2]:scan=6009	24.458	3	1906.852	1906.8520	S	K	250	267
PSM	RDQPAFTPSGILTPHALGS	1105	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6690	26.356	3	1964.0116	1964.0116	K	R	351	370
PSM	RDTIVLLCKPEPELNAAIPSANPA	1106	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4	ms_run[2]:scan=6731	26.48	3	2588.3632	2588.3632	H	K	517	541
PSM	RESGATIPSFMNIIPTKETPPT	1107	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=6682	26.338	3	2402.2152	2402.2152	S	R	347	369
PSM	RPQPDPNAEFDPDLPGGGLH	1108	sp|O00488|ZN593_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5956	24.321	3	2127.9974	2127.9974	A	R	42	62
PSM	RTPTDPGLDSALEPSGDPHG	1109	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5191	22.451	3	2017.9341	2017.9341	P	K	865	885
PSM	TDRYTIHSQLEHLQS	1110	sp|Q9BWJ5|SF3B5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=5708	23.726	3	1868.9017	1868.9017	M	K	2	17
PSM	KMSATFIGNSTAIQELFK	1111	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	2-UNIMOD:35	ms_run[1]:scan=7451	29.496940154666667	3	2002.0092	2001.0232	L	R	362	380
PSM	KIPCESPPLEVVDTTASTK	1112	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	4-UNIMOD:4	ms_run[1]:scan=5577	23.417966057599997	3	2072.066730	2071.050722	T	R	2703	2722
PSM	KAPQEVEEDDGRSGAGED	1113	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=3625	15.980186903733333	3	1887.8088	1887.8077	Q	P	376	394
PSM	KGALDTTDGYMGVNQAPEKLD	1114	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	11-UNIMOD:35	ms_run[1]:scan=5090	22.167708001066668	3	2238.049853	2238.047428	E	K	3786	3807
PSM	KEFQEAGEPITDDSTSLH	1115	sp|Q9BQS8|FYCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4991	21.875953797866668	3	2002.913908	2002.911980	S	K	26	44
PSM	KGTEPIIVDPFDPRDEGS	1116	sp|Q13191|CBLB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=6789	26.670102717066666	3	1970.961059	1970.958536	I	R	416	434
PSM	KVESPGTYQQDPWAMTDEEKA	1117	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:35	ms_run[1]:scan=4996	21.886065902666665	3	2428.129079	2425.074371	L	K	156	177
PSM	KAAPEASSPPASPLQHLLPG	1118	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6559	25.978	3	1967.0476	1967.0476	P	K	672	692
PSM	KAPSTPVPPSPAPAPGLTK	1119	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4805	21.277	3	1812.0145	1812.0145	S	R	86	105
PSM	KAPVQPQQSPAAAPGGTDEKPSG	1120	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3980	17.698	3	2217.1026	2217.1026	D	K	8	31
PSM	KASGLPPTESNCEVPRPSTAPQ	1121	sp|Q7KZI7-12|MARK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:4	ms_run[2]:scan=4635	20.673	3	2322.1274	2322.1274	N	R	509	531
PSM	KCELENCQPFVVETLHG	1122	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=6327	25.332	3	2058.9503	2058.9503	G	K	99	116
PSM	KDEILPTTPISEQKGG	1123	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5118	22.247	3	1711.8992	1711.8992	P	K	214	230
PSM	KEAAASGLPLMVIIH	1124	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=6549	25.95	2	1564.8647	1564.8647	K	K	48	63
PSM	KESDLPSAILQTSGVSEFTK	1125	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7005	27.45	3	2136.095	2136.0950	K	K	271	291
PSM	KEVTPVSSIPVETH	1126	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4897	21.583	2	1521.8039	1521.8039	G	R	437	451
PSM	KGDVEEDETIPDSEQDIRP	1127	sp|Q92973-3|TNPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5157	22.359	3	2170.9866	2170.9866	L	R	277	296
PSM	KGLTTTGNSSLNSTSNTKVSAVPTNMAA	1128	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	26-UNIMOD:35	ms_run[2]:scan=4696	20.89	3	2767.3658	2767.3658	M	K	467	495
PSM	KILDATDQESLELKPTS	1129	sp|Q8IZA0-3|K319L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5480	23.215	3	1886.9837	1886.9837	Y	R	411	428
PSM	KIPILLIQQPGKVTGED	1130	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6589	26.063	3	1848.072	1848.0720	S	R	594	611
PSM	KIPNIYAIGDVVAGPMLAH	1131	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7496	29.706	3	1978.071	1978.0710	T	K	247	266
PSM	KISQMPVILTPLHFD	1132	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:35	ms_run[2]:scan=6907	27.079	3	1753.9437	1753.9437	G	R	508	523
PSM	KIYGADDIELLPEAQH	1133	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6417	25.586	3	1810.9101	1810.9101	Q	K	832	848
PSM	KLGDVGMAELCPGLLHPSS	1134	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:4	ms_run[2]:scan=6876	26.964	3	1979.9809	1979.9809	N	R	238	257
PSM	KLPGGELNPGEDEVEGLK	1135	sp|O43809|CPSF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5544	23.342	3	1879.9527	1879.9527	F	R	105	123
PSM	KLPVPAAAPTPWETH	1136	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6011	24.461	3	1613.8566	1613.8566	M	K	789	804
PSM	KLQPSSSPENSLDPFPPRIL	1137	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6909	27.085	3	2221.1743	2221.1743	F	K	553	573
PSM	KMVAVDPGAPTPEEHAQGAVT	1138	sp|Q96DU7|IP3KC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=4520	20.207	3	2120.0208	2120.0208	E	K	513	534
PSM	KMVMIQDGPLPTGADKPL	1139	sp|Q96I24-2|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:35	ms_run[2]:scan=5701	23.705	3	1925.9955	1925.9955	V	R	135	153
PSM	KPAVPTVASSTDMLHS	1140	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35	ms_run[2]:scan=4811	21.294	3	1655.8189	1655.8189	S	K	1905	1921
PSM	KPLPTPIGTVHTDLPSQPQL	1141	sp|P78368|KC1G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6411	25.57	3	2138.1736	2138.1736	G	R	332	352
PSM	KPSTFAYPAPLEVPKE	1142	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6074	24.643	3	1772.9349	1772.9349	C	K	807	823
PSM	KQEILVEPEPLFGAPK	1143	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6571	26.011	3	1793.9927	1793.9927	Q	R	84	100
PSM	KQGILGAQPQLIFQPH	1144	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6675	26.314	3	1773.989	1773.9890	Q	R	138	154
PSM	KQIQELVEAIVLPMNH	1145	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=7320	28.865	3	1877.0081	1877.0081	D	K	193	209
PSM	KQLPLTSICLETDSPALGPEKQV	1146	sp|Q17R31-4|TATD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:4	ms_run[2]:scan=6754	26.552	3	2523.3254	2523.3254	V	R	185	208
PSM	KQLQEETPPGGPLTEALPPAR	1147	sp|Q9Y6M9|NDUB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5764	23.855	3	2228.1801	2228.1801	V	K	138	159
PSM	KQMPIGGDVPALQLQYDHC	1148	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=6215	25.021	3	2185.0296	2185.0296	K	K	2584	2603
PSM	KQPEPVIPVKDATSDLAIIA	1149	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6883	26.992	3	2104.178	2104.1780	T	R	425	445
PSM	KSAIDLTPIVVEDKEE	1150	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6156	24.856	3	1784.9408	1784.9408	E	K	1647	1663
PSM	KTGNLDPLSCISTADLH	1151	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:4	ms_run[2]:scan=6581	26.04	3	1840.8989	1840.8989	S	K	815	832
PSM	KTPSSSQPERLPIGNTIQPSQAATFMNDAIE	1152	sp|O43395-3|PRPF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	26-UNIMOD:35	ms_run[2]:scan=6394	25.517	3	3343.6354	3343.6354	P	K	36	67
PSM	KVEPVPVTKQPTPPSEAAAS	1153	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4433	19.818	3	2032.0841	2032.0841	K	K	142	162
PSM	KVFEPNEEALGVVLH	1154	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6570	26.008	3	1679.8883	1679.8883	E	K	222	237
PSM	KVPLAPPVWTAPTFTH	1155	sp|Q15572-5|TAF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6913	27.103	3	1760.9614	1760.9614	L	R	236	252
PSM	KYGGPPPDSVYSGVQPGIGTEVFVGKIP	1156	sp|O43390|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7162	28.114	3	2844.4698	2844.4698	R	R	146	174
PSM	RAPTVPPPLPPTPPQPAR	1157	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5124	22.264	3	1888.0683	1888.0683	L	R	615	633
PSM	RDGEEEEEEEEPLDESSVK	1158	sp|Q8WYA6-4|CTBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4669	20.802	3	2233.9346	2233.9346	D	K	38	57
PSM	RDLATPVMQPCTALDSH	1159	sp|Q9NUQ3-2|TXLNG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=5013	21.928	3	1926.8928	1926.8928	N	K	338	355
PSM	RESALPCQASPLHPALAYSLPQSPIV	1160	sp|Q8WWB7-2|GLMP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:4	ms_run[2]:scan=7127	27.943	3	2801.4534	2801.4534	G	R	213	239
PSM	RETPLPIDPSMFPTWPAKSEQQ	1161	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7350	29.007	3	2554.2526	2554.2526	F	R	96	118
PSM	RMGGEAPELALDPVPQDASTK	1162	sp|Q07812-5|BAX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=5637	23.543	3	2197.0685	2197.0685	G	K	37	58
PSM	RMVEPENAVTITPLRPEDDYSP	1163	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=6117	24.753	3	2544.2166	2544.2166	E	R	734	756
PSM	RPSLPAPESPGLPAHPSNPQLPEA	1164	sp|O43379|WDR62_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5860	24.079	3	2458.2605	2458.2605	F	R	1340	1364
PSM	RQEDAPMIEPLVPEEKMET	1165	sp|Q9Y2J2-3|E41L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5458	23.165	3	2273.0555	2273.0556	A	K	588	607
PSM	RTDTAVQATGSVPSTPIAH	1166	sp|Q9NXR1|NDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4693	20.883	3	1907.9701	1907.9701	E	R	201	220
PSM	RTLLATVDETIPLLPASTH	1167	sp|Q05397-6|FAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7452	29.503	3	2047.1314	2047.1314	L	R	270	289
PSM	RTPESQPDTPPGTPLVSQDEK	1168	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4723	20.986	3	2278.1077	2278.1077	T	R	71	92
PSM	RYIMVPSGNMGVFDPTEIHN	1169	sp|Q9P003|CNIH4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7009	27.468	3	2276.0718	2276.0718	Y	R	84	104
PSM	KDMQPSMESDMALVKDMELPTE	1170	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=6357	25.425058905333334	3	2572.106892	2572.105279	A	K	290	312
PSM	KDLGVTDVLCEACDQLGWTKPT	1171	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=7481	29.633262097066666	3	2505.183331	2505.187961	F	K	27	49
PSM	RPQSLQQPATSTTETPASPAHTTPQTQSTSG	1172	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4317	19.284125003466666	3	3193.538089	3192.528327	S	R	311	342
PSM	RCPVMLVVGDQAPHEDAVVECNS	1173	sp|Q9UN36|NDRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	2-UNIMOD:4,5-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=5570	23.404795393866667	3	2597.164877	2597.167243	L	K	254	277
PSM	KAPSTPVPPSPAPAPGLTK	1174	sp|Q96EZ8|MCRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4793	21.237183207999998	3	1812.015850	1812.014535	S	R	99	118
PSM	KAEAGPEGVAPAPEGEK	1175	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3941	17.51551180186667	3	1636.814594	1635.810415	E	K	669	686
PSM	KTPNSTLPPAGRPSEEPEPDYEAIQTLN	1176	sp|Q9NWQ8|PHAG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5875	24.121973882933332	3	3051.493825	3050.483274	E	R	367	395
PSM	KAIGQAPSNLTMNPSNFATPQTH	1177	sp|Q14686|NCOA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5831	24.0098579376	3	2425.145708	2424.185593	L	K	1281	1304
PSM	KNLEAVETLGSTSTICSDKTGTLTQN	1178	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	16-UNIMOD:4	ms_run[1]:scan=5724	23.76185140773333	3	2768.359974	2767.354569	V	R	359	385
PSM	KAAELVTQNCEAYEAHM	1179	sp|Q96I15|SCLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=4684	20.85	3	1979.8717	1979.8717	G	R	307	324
PSM	KAIGDSSVPSECPGTLDHQ	1180	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:4	ms_run[2]:scan=4653	20.733	3	1996.916	1996.9160	C	R	1305	1324
PSM	KALVLDCHYPEDEVGQEDEAESDIFSI	1181	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:4	ms_run[2]:scan=7402	29.262	3	3107.3917	3107.3917	K	R	180	207
PSM	KCQVDETEEPDVHLPQPYAVA	1182	sp|Q86W33|TPRA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4	ms_run[2]:scan=6194	24.968	3	2424.1267	2424.1267	Y	R	295	316
PSM	KDCEVVMMIGLPGAGKTTWVT	1183	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=7110	27.872	3	2308.1265	2308.1265	K	K	476	497
PSM	KDMQPSMESDMALVKDMELPTE	1184	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,7-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=5797	23.941	3	2572.1053	2572.1053	A	K	290	312
PSM	KDPAEGDGAQPEETPRDGD	1185	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3641	16.059	3	1982.8454	1982.8454	S	K	191	210
PSM	KDPTGMDPDDIWQLSSSLK	1186	sp|Q15005|SPCS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35	ms_run[2]:scan=6985	27.371	3	2148.0045	2148.0045	R	R	146	165
PSM	KEEMEMDPKPDLDSDSWCLLGTDSC	1187	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35,6-UNIMOD:35,18-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=6843	26.853	3	2989.1973	2989.1973	A	R	951	976
PSM	KEFGDTGEGWETVEMHPAYTEEEL	1188	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=6615	26.137	3	2799.1858	2799.1858	R	R	324	348
PSM	KELPTVTTNVQNSQDKSIE	1189	sp|Q96B01-3|R51A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4788	21.219	3	2130.0804	2130.0804	V	K	108	127
PSM	KESPEIEPLPFTLAHE	1190	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6915	27.109	3	1835.9305	1835.9305	A	R	2311	2327
PSM	KEVALDITSSEEKPDVSFD	1191	sp|Q9Y375|CIA30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6139	24.812	3	2108.0161	2108.0161	Q	K	65	84
PSM	KGPTEQLVSPEPEVHDIE	1192	sp|P35813-2|PPM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5419	23.062	3	2002.9848	2002.9848	G	R	208	226
PSM	KILPVLCGLTVDPEKSV	1193	sp|Q96KG9-5|SCYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:4	ms_run[2]:scan=7096	27.822	3	1867.0489	1867.0489	Q	R	506	523
PSM	KLPVPASAPIPFFH	1194	sp|Q8WWI5-3|CTL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7139	27.999	3	1519.8551	1519.8551	P	R	161	175
PSM	KLSIFDANESGFESYEALPQH	1195	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7045	27.623	3	2381.1176	2381.1176	E	K	49	70
PSM	KMASAPASYGSTTTKPMGLLS	1196	sp|Q8WVM8-2|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=5482	23.218	3	2114.0388	2114.0388	T	R	409	430
PSM	KPAPSAQPAPPPHPPS	1197	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3915	17.383	3	1574.8205	1574.8205	S	R	127	143
PSM	KPAVPTVASSTDMLHS	1198	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:35	ms_run[2]:scan=4698	20.897	3	1655.8189	1655.8189	S	K	1905	1921
PSM	KPEIVFFGENLPEQFH	1199	sp|Q96EB6-2|SIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7295	28.741	3	1929.9625	1929.9625	M	R	408	424
PSM	KPIVNIDPQTAELNHL	1200	sp|O95239-2|KIF4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6372	25.46	3	1800.9734	1800.9734	N	K	339	355
PSM	KSEPEPVYIDEDKMD	1201	sp|O75886-2|STAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=4649	20.723	3	1809.7979	1809.7979	K	R	284	299
PSM	KSILCQYPASLPDAH	1202	sp|Q7Z4H7-2|HAUS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4	ms_run[2]:scan=5817	23.98	3	1698.8399	1698.8399	A	K	420	435
PSM	KSPTMEQAVQTASAHLPAPAAVG	1203	sp|Q8ND56-3|LS14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=5500	23.254	3	2277.1423	2277.1423	R	R	150	173
PSM	KTATGTQPLQPAPVTQPPKEST	1204	sp|B7ZAP0|RBG10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4515	20.19	3	2276.2012	2276.2012	I	-	232	254
PSM	KTDYIPLLDVDEKTGNSES	1205	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6577	26.027	3	2123.027	2123.0270	G	K	44	63
PSM	KTPTTTPPETQQSPHLSL	1206	sp|Q5FBB7-6|SGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5292	22.738	3	1962.0058	1962.0058	T	K	424	442
PSM	KVAPQNDSFGTQLPPMHQQQS	1207	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:35	ms_run[2]:scan=4715	20.961	3	2353.1121	2353.1121	K	R	77	98
PSM	KVAQPTITDNKDGTVTV	1208	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4827	21.342	3	1785.9472	1785.9472	G	R	1806	1823
PSM	KVEPLEEAIPLPPTK	1209	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6197	24.98	3	1659.9447	1659.9447	V	K	314	329
PSM	KVMLMASPSMEDLYH	1210	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=5746	23.821	3	1782.7991	1782.7991	A	K	433	448
PSM	RDPPDPYVSLLLLPDKN	1211	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7339	28.956	3	1951.0415	1951.0415	G	R	1003	1020
PSM	RGGGGNFGPGPGSNF	1212	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5378	22.959	2	1376.6222	1376.6222	S	R	213	228
PSM	RILESSPGVTEVTIIEKPPAE	1213	sp|Q68CL5-3|TPGS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6176	24.915	3	2264.2264	2264.2264	T	R	26	47
PSM	RSLETPQPAASLPDNTMVTHLFQ	1214	sp|O75170-6|PP6R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:35	ms_run[2]:scan=6735	26.49	3	2568.2642	2568.2642	N	K	399	422
PSM	RSLFSPQNTLAAPTGHPPTSGVE	1215	sp|Q5VT52-2|RPRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5944	24.29	3	2363.187	2363.1870	H	K	935	958
PSM	RVEGSFPVTMLPGDGVGPELMHAV	1216	sp|O43837-2|IDH3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=6875	26.962	3	2526.2247	2526.2247	V	K	44	68
PSM	KLASQGDSISSQLGPIHPPP	1217	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5688	23.679568568533334	3	2028.070065	2028.064004	K	R	122	142
PSM	KTPDDDPEQGKSEEPTEVGD	1218	sp|Q12830|BPTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4064	18.09565200213333	3	2171.919001	2171.934232	D	K	609	629
PSM	KMADPQSIQESQNLSMFLANHN	1219	sp|Q7L576|CYFP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:35	ms_run[1]:scan=6734	26.488174720533333	3	2520.169872	2518.158058	R	K	197	219
PSM	KDEMDDDTMFTTLGEEDKS	1220	sp|Q9P2D3|HTR5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=5090	22.167708001066668	3	2238.916593	2237.882790	K	K	1219	1238
PSM	RPNAPVPLVIDMPEHNPGNLGGTM	1221	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	24-UNIMOD:35	ms_run[1]:scan=6594	26.080752589866666	3	2543.252114	2541.246813	F	R	425	449
PSM	KQTTVSNSQQAYQEAFEISK	1222	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5906	24.195129858666668	3	2287.096098	2286.112805	N	K	140	160
PSM	KALAILSQPTPSLVVDHE	1223	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6541	25.933549269066667	3	1917.059641	1917.057128	E	R	1314	1332
PSM	KQEEEEEEELLPVNGSQEEAKPQV	1224	sp|Q9NZ53|PDXL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31		ms_run[1]:scan=5724	23.76185140773333	3	2768.3592	2767.3032	E	R	180	204
PSM	KGQSVNMTDVNGQTPLMLSAH	1225	sp|Q8IUH4|ZDH13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:35,17-UNIMOD:35	ms_run[1]:scan=5060	22.078577198666668	3	2259.062306	2259.062367	S	K	171	192
PSM	KMSSTFIGNSTAIQELFK	1226	sp|Q13509|TBB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7451	29.496940154666667	3	2002.010117	2001.024113	L	R	362	380
PSM	MKPLVVFVLGGPGAGKGTQCA	1227	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=6717	26.43147533653333	3	2102.106508	2102.101653	-	R	1	22
PSM	RVIISAPSADAPMFVMGVNHE	1228	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=6539	25.930413864	3	2274.069057	2272.098024	K	K	118	139
PSM	KEELQANGSAPAADKEEPAAAGSGAASPSAAE	1229	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4430	19.8045069488	3	2982.375430	2981.385017	A	K	55	87
PSM	KALIEVLQPLIAEHQA	1230	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7326	28.889	3	1772.0196	1772.0196	K	R	391	407
PSM	KAPPPGLPAETIKDLM	1231	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:35	ms_run[2]:scan=5877	24.127	3	1692.912	1692.9120	D	R	106	122
PSM	KAPQEVEEDDGRSGAGEDPPMPAS	1232	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4529	20.248	3	2468.0762	2468.0762	Q	R	376	400
PSM	KATNESEDEIPQLVPIGK	1233	sp|O76021-2|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6217	25.026	2	1967.0211	1967.0211	V	K	136	154
PSM	KDEEMIGPIIDKLE	1234	sp|Q9NTK5-3|OLA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=6405	25.553	3	1644.828	1644.8280	L	K	155	169
PSM	KDLEGENIEIVFAKPPDQ	1235	sp|O60506-4|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6697	26.375	3	2041.0368	2041.0368	G	K	359	377
PSM	KDSLLEPALASVVIH	1236	sp|Q6PIW4-2|FIGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7113	27.882	3	1590.8981	1590.8981	F	K	15	30
PSM	KDYAVSTVPVADGLHL	1237	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6665	26.283	3	1683.8832	1683.8832	F	K	56	72
PSM	KEADTDVQVCPNYSIPQKTDSYFNP	1238	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:4	ms_run[2]:scan=6317	25.301	3	2915.3284	2915.3284	L	K	230	255
PSM	KELATTSTMPYQYPALTPEQK	1239	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=5405	23.028	3	2412.1883	2412.1883	G	K	47	68
PSM	KEQSICAAEEQPAEDGQGETNKN	1240	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=4068	18.116	3	2532.1034	2532.1034	E	R	485	508
PSM	KGDDLLPAGTEDYIHI	1241	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7032	27.572	3	1755.8679	1755.8679	S	R	18	34
PSM	KGEQLFLEPELVIPH	1242	sp|Q9NXE4-9|NSMA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7337	28.946	3	1747.9509	1747.9509	Q	R	159	174
PSM	KLDITTLTGVPEEHI	1243	sp|O43181|NDUS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6840	26.841	3	1664.8985	1664.8985	E	K	58	73
PSM	KLPCEDPELDDDFDAH	1244	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=5725	23.765	3	1914.7942	1914.7942	G	K	2985	3001
PSM	KLVQDVANNTNEEAGDGTTTATVLA	1245	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5145	22.319	3	2531.2351	2531.2351	A	R	96	121
PSM	KMFLGELPEPLLTH	1246	sp|Q14CB8-5|RHG19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=6970	27.32	3	1639.8644	1639.8644	L	K	181	195
PSM	KNLPPSGAVPVTGIPPHVV	1247	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6500	25.818	2	1878.0727	1878.0727	S	K	257	276
PSM	KPIFLNTIDPSHPMA	1248	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=6130	24.792	3	1695.8654	1695.8654	F	K	50	65
PSM	KPLMGVIYVPLTDKE	1249	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35	ms_run[2]:scan=6225	25.046	3	1717.9324	1717.9324	M	K	206	221
PSM	KQIQELVEAIVLPMNH	1250	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7528	29.851	3	1861.0132	1861.0132	D	K	193	209
PSM	KSGDAAIVDMVPGKPMCVESFSDYPPLG	1251	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=7095	27.819	3	2982.3813	2982.3813	L	R	395	423
PSM	KSVQLYGPTNFAPVINHVA	1252	sp|Q86YQ8-2|CPNE8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6758	26.566	3	2054.0949	2054.0949	L	R	74	93
PSM	KVMLMASPSMEDLYH	1253	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5446	23.134	3	1782.7991	1782.7991	A	K	433	448
PSM	KWGQPPSPTPVPRPPDADPNTPSP	1254	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5464	23.179	3	2534.2554	2534.2554	W	K	509	533
PSM	RAEQPSPPNSDSGQDAHPDPDANPDAA	1255	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4108	18.319	3	2755.1706	2755.1706	V	R	143	170
PSM	RAPTAAPPPPPPSRPSVAVPPPPPN	1256	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5004	21.904	3	2463.3387	2463.3387	S	R	316	341
PSM	RDLATPVMQPCTALDSH	1257	sp|Q9NUQ3-2|TXLNG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=5610	23.484	3	1910.8979	1910.8979	N	K	338	355
PSM	RFEEPVVLPDLDDQTDH	1258	sp|P46531|NOTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6759	26.569	3	2023.9487	2023.9487	F	R	1824	1841
PSM	RILEDQEENPLPAALVQPHTG	1259	sp|O95336|6PGL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6447	25.675	3	2326.1917	2326.1917	K	K	214	235
PSM	RPGNGPEILLGQGPPQQPPQQH	1260	sp|Q9NSY1-2|BMP2K_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5685	23.674	3	2344.2036	2344.2036	L	R	414	436
PSM	RSPEPDTLPLAAGSDHPLP	1261	sp|Q6PCT2-2|FXL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6086	24.681	3	1968.9905	1968.9905	P	R	364	383
PSM	RSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGS	1262	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6659	26.265	3	3499.6703	3499.6703	L	K	101	137
PSM	KTITLEVEPSDTIENVKA	1263	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6120	24.76431540533333	3	1987.042908	1986.052102	G	K	11	29
PSM	KTYNTDVPLVLMNSFNTDEDTK	1264	sp|Q16851|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=7271	28.6241604648	3	2544.2114	2544.2049	N	K	151	173
PSM	KAIGTEPDSDVLSEIMHSFA	1265	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	16-UNIMOD:35	ms_run[1]:scan=7477	29.611835336266665	3	2162.023037	2162.020151	I	K	755	775
PSM	KDLSLGGVLLFPVDDKES	1266	sp|Q86WJ1|CHD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7436	29.427284753333332	3	1931.028306	1931.025159	M	R	773	791
PSM	KFVINYDYPNSSEDYVH	1267	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6352	25.415361337066667	3	2089.928949	2088.942886	V	R	488	505
PSM	KDAPSLEEVEGHVADGSATEMGTT	1268	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	21-UNIMOD:35	ms_run[1]:scan=5575	23.415455973866663	3	2449.092616	2446.080579	G	K	185	209
PSM	KEAPGPNGATEEDGVPSKVQ	1269	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4235	18.91718781946667	3	2009.956605	2008.970164	R	R	16	36
PSM	RAEPLTAPPTNGLPHTQD	1270	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4963	21.782495769866667	3	1914.947466	1913.959539	P	R	984	1002
PSM	KDAGVQPEEISYINAHATSTPLGDAAEN	1271	sp|Q9NWU1|OXSM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6259	25.14307332026667	3	2897.377123	2897.367910	L	K	333	361
PSM	KDLGLAFEIPPHM	1272	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=6491	25.789	3	1482.7541	1482.7541	G	K	82	95
PSM	KDLGLAFEIPPHM	1273	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=6545	25.941	3	1482.7541	1482.7541	G	K	82	95
PSM	KDLGLAFEIPPHM	1274	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=7122	27.929	3	1482.7541	1482.7541	G	K	82	95
PSM	KDPLPPLDPQAIKPIL	1275	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7182	28.208	2	1754.0342	1754.0342	N	K	2579	2595
PSM	KDVMEGVTVDDHMM	1276	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35,13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4011	17.831	3	1653.6684	1653.6684	E	K	181	195
PSM	KDYAVSTVPVADGLHL	1277	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6520	25.879	3	1683.8832	1683.8832	F	K	56	72
PSM	KDYAVSTVPVADGLHL	1278	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6648	26.236	2	1683.8832	1683.8832	F	K	56	72
PSM	KEAADAIDAEGASAPLMELLHS	1279	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7535	29.885	3	2238.0838	2238.0838	D	R	615	637
PSM	KEESQIPVDEVFFH	1280	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6828	26.801	3	1702.8203	1702.8203	A	R	802	816
PSM	KEPPLYYGVCPVYEDVPARNE	1281	sp|Q86XL3-2|ANKL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:4	ms_run[2]:scan=6412	25.572	3	2494.1839	2494.1839	S	R	194	215
PSM	KGLGTDEDTIIDIITH	1282	sp|P08133-2|ANXA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7460	29.539	3	1739.8941	1739.8941	M	R	345	361
PSM	KGTVIVQPEPVLNEDKDDF	1283	sp|P46100-3|ATRX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6063	24.606	3	2142.0845	2142.0845	P	K	6	25
PSM	KIAILTCPFEPPKP	1284	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4	ms_run[2]:scan=6596	26.085	3	1609.8902	1609.8902	A	K	154	168
PSM	KIGIIGGTGLDDPEILEGRTE	1285	sp|Q13126-7|MTAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6864	26.926	3	2182.1481	2182.1481	V	K	11	32
PSM	KIPQMESSTNSSSQDYSTSQEPSVASSHGV	1286	sp|Q96RU2-2|UBP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5086	22.157	3	3154.3997	3154.3997	C	R	702	732
PSM	KISQMPVILTPLHFD	1287	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7314	28.833	3	1737.9488	1737.9488	G	R	508	523
PSM	KLGDVYVNDAFGTAH	1288	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5981	24.382	3	1605.7787	1605.7787	S	R	128	143
PSM	KLQPQEISPPPTANLDRSND	1289	sp|Q05397-6|FAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5139	22.303	3	2219.1182	2219.1182	V	K	211	231
PSM	KMPCQSLQPEPINTPTHT	1290	sp|P46013-2|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4	ms_run[2]:scan=5020	21.952	3	2077.9925	2077.9925	T	K	644	662
PSM	KNALPPVLTTVNGQSPPEHSAPA	1291	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5745	23.818	3	2324.2125	2324.2125	T	K	129	152
PSM	KPLMGVIYVPLTDKE	1292	sp|P22061|PIMT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6852	26.889	3	1701.9375	1701.9375	M	K	206	221
PSM	KQTDPSTPQQESSKPLGGIQPSSQTIQP	1293	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5263	22.654	3	2963.4836	2963.4836	E	K	1081	1109
PSM	KSGLNQGAISTLQSSDILNLTKEQPQA	1294	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6977	27.345	3	2840.488	2840.4880	T	K	1960	1987
PSM	KSGPPEGGSVAVQDADIEK	1295	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4612	20.585	3	1882.9272	1882.9272	L	R	1389	1408
PSM	KTLADIICEYPDIHQSS	1296	sp|P56282-2|DPOE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:4	ms_run[2]:scan=6932	27.177	3	1988.9513	1988.9513	L	R	317	334
PSM	KTTAPVPEPTKPGDP	1297	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4140	18.465	3	1533.8039	1533.8039	T	R	651	666
PSM	KTTTTLIEPIRLGGISSTEEMDL	1298	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	21-UNIMOD:35	ms_run[2]:scan=6941	27.212	3	2520.2993	2520.2993	E	K	27	50
PSM	KTVEVLEPEVTKLM	1299	sp|Q96F07-2|CYFP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=5652	23.582	3	1630.8852	1630.8852	E	K	110	124
PSM	KVANEPVLAFTQGSPERDALQ	1300	sp|P30038-3|AL4A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6371	25.458	3	2269.1703	2269.1703	L	K	31	52
PSM	KVPEVPTAPATDAAPK	1301	sp|Q9UHD8-3|SEPT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4630	20.649	3	1590.8617	1590.8617	S	R	7	23
PSM	RDVEPEDPMFLMDPFAIH	1302	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=7485	29.651	3	2173.9813	2173.9813	M	R	6	24
PSM	RGSVISPTELEAPILVPHTAQ	1303	sp|Q8N1B4-2|VPS52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6853	26.892	3	2214.2008	2214.2008	T	R	225	246
PSM	RIEEVPELPLVVEDKVEGY	1304	sp|P36578|RL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7148	28.042	3	2212.1627	2212.1627	H	K	143	162
PSM	RNLPLPPPPPPRGGDLMAYD	1305	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:35	ms_run[2]:scan=5812	23.969	3	2188.1099	2188.1099	A	R	281	301
PSM	RPAAMISQPPTPPTGQPVREDA	1306	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5094	22.178	3	2315.1692	2315.1692	S	K	1061	1083
PSM	RPGAPAAPAAGPPRPDAPADPAPLAP	1307	sp|Q96IQ9-2|ZN414_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5340	22.867	3	2397.2553	2397.2553	H	K	348	374
PSM	RQPGLPQPLMPTQPPAHALQQ	1308	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35	ms_run[2]:scan=5438	23.113	3	2320.211	2320.2110	A	R	3321	3342
PSM	RSAAVPLINPAGLGPGGPGHLLL	1309	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7411	29.306	3	2176.2481	2176.2481	P	K	1897	1920
PSM	RSLYQSAGVAPESFEYIEAHGTGT	1310	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6708	26.4	3	2569.2085	2569.2085	I	K	274	298
PSM	RVFPVYNPATGEQVCEVQEADKADID	1311	sp|O94788-2|AL1A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:4	ms_run[2]:scan=6402	25.543	3	2949.3815	2949.3815	G	K	53	79
PSM	RVPFSPGPAPPPHMGELDQE	1312	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=5307	22.775	3	2173.0262	2173.0262	G	R	583	603
PSM	KAEVDMDTDAPQVSH	1313	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:35	ms_run[1]:scan=3898	17.309006953866668	3	1657.725293	1657.725365	D	K	933	948
PSM	KGTVPDDAVEALADSLGK	1314	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7190	28.2463212984	3	1784.918110	1784.915609	L	K	426	444
PSM	KALFEEVPELLTEAEK	1315	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7461	29.544300143999997	3	1844.978864	1844.977146	W	K	509	525
PSM	KCEYPAACNALETLLIH	1316	sp|P54886|P5CS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	2-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=7378	29.141802734400002	3	2001.9650	2001.9647	S	R	605	622
PSM	KEDLPAENGETKTEESPASDEAGE	1317	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4298	19.189459193333334	3	2533.084901	2532.098731	T	K	71	95
PSM	KTITLEVEPSDTIENVKA	1318	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5332	22.8432808984	3	1986.019341	1986.052102	G	K	11	29
PSM	KMEEESGAPGVPSGNGAPGPKGEGE	1319	sp|P52272|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:35	ms_run[1]:scan=4234	18.911833838933333	3	2384.050741	2383.059784	I	R	17	42
PSM	KAPEPVCAAPGPPHGPAGAASNFYSAVG	1320	sp|P31277|HXD11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=5943	24.287249874666667	3	2676.278732	2676.275471	F	R	142	170
PSM	RSSIEDAQCPGLPDLIEENHVVN	1321	sp|Q15398|DLGP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:4	ms_run[1]:scan=6731	26.479606071733333	3	2591.232326	2591.228580	S	K	688	711
PSM	KVSIDGSESVAGTGMIGENEQEK	1322	sp|P52747|ZN143_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	15-UNIMOD:35	ms_run[1]:scan=4799	21.257759736	3	2380.111471	2380.106400	A	K	190	213
PSM	KAAILETAPKEVPMVVVPPVGA	1323	sp|Q9P2E9|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6853	26.892	3	2215.265	2215.2650	S	K	166	188
PSM	KAELLDNEKPAAVVAPITTGYTV	1324	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6636	26.197	3	2399.2948	2399.2948	K	K	8	31
PSM	KEIEPFLPPLKPDYCV	1325	sp|Q8IZV5|RDH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:4	ms_run[2]:scan=7043	27.614	3	1944.0067	1944.0067	R	K	258	274
PSM	KETEQINGNPVPDENGHIPGWVPVE	1326	sp|Q8N999|CL029_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6550	25.953	3	2754.3249	2754.3249	A	K	122	147
PSM	KEVEPEPTEDKDLEADEEDT	1327	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4518	20.2	3	2316.9969	2316.9969	T	R	42	62
PSM	KEVTPVSSIPVETH	1328	sp|Q9HD20-2|AT131_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4908	21.614	3	1521.8039	1521.8039	G	R	437	451
PSM	KGISAFLVPMPTPGLTLGK	1329	sp|P16219|ACADS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=7043	27.614	3	1942.0962	1942.0962	N	K	208	227
PSM	KILDSVGIEADDDRLN	1330	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5813	23.97	3	1771.8952	1771.8952	K	K	25	41
PSM	KIPILLIQQPGKVTGED	1331	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6582	26.044	2	1848.072	1848.0720	S	R	594	611
PSM	KIQIAPDSGGLPERSCMLTGTPESVQSA	1332	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4	ms_run[2]:scan=6141	24.818	3	2928.4321	2928.4321	C	K	133	161
PSM	KLSLDVEQAPSGQHSQAQLSGQQQ	1333	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5097	22.19	3	2563.2627	2563.2627	G	R	201	225
PSM	KNLTVILSDASAPGEGEH	1334	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5721	23.753	3	1836.9218	1836.9218	W	K	113	131
PSM	KQGGLGPMNIPLVSDPK	1335	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35	ms_run[2]:scan=5608	23.48	3	1765.9397	1765.9397	K	R	93	110
PSM	KQLLGLQPISTVSPLH	1336	sp|Q9UKK3|PARP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6656	26.255	3	1730.0091	1730.0091	T	R	1701	1717
PSM	KQSVDGKAPLATGEDDDDEVPDLVENFDEAS	1337	sp|P20290-2|BTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7133	27.973	3	3304.4743	3304.4743	P	K	127	158
PSM	KTSTVAPTIHTTVPSPTTTPTP	1338	sp|P13473-2|LAMP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5192	22.454	3	2234.1794	2234.1794	D	K	193	215
PSM	KVATLNSEEESDPPTYKDAFPPLPE	1339	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6582	26.044	3	2773.3334	2773.3334	I	K	61	86
PSM	KVEAPEYIPISDDPKASA	1340	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5510	23.277	3	1928.9731	1928.9731	V	K	249	267
PSM	KVGDGDLSAEEIPENEVSLR	1341	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5898	24.178	3	2156.0597	2156.0597	T	R	220	240
PSM	KVGTGEPCCDWVGDEGAGHFV	1342	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6227	25.054	3	2275.9627	2275.9627	A	K	150	171
PSM	RDDIIENAPTTHTEEYSGEE	1343	sp|O14744-3|ANM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4929	21.679	3	2304.9982	2304.9982	L	K	103	123
PSM	RSYDVPPPPMEPDHPFYSNIS	1344	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=6241	25.1	3	2460.1056	2460.1056	R	K	117	138
PSM	RTLVSAVPEESEMDPHV	1345	sp|Q96N67-7|DOCK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:35	ms_run[2]:scan=5252	22.62	3	1910.9044	1910.9044	C	R	97	114
PSM	KVQISPDSGGLPERSVSLTGAPESVQ	1346	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5928	24.259793785333333	3	2637.363411	2637.360974	C	K	177	203
PSM	RPNTQPPPAPAPHATLP	1347	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4826	21.339278188799998	3	1761.937367	1760.932202	L	R	405	422
PSM	KPGTTGSGAGSGGPGGLTSAAPAGGDK	1348	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4096	18.259810988	3	2212.075376	2212.072003	T	K	26	53
PSM	KVAPQNDSFGTQLPPMHQQQ	1349	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:35	ms_run[1]:scan=4855	21.43707933146667	3	2266.082633	2266.080066	K	R	77	97
PSM	KTGQATVASGIPAGWMGLDCGPESS	1350	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=6764	26.581268021866666	3	2494.129882	2492.131175	A	K	297	322
PSM	KAFLASPEYVNLPINGNGKQ	1351	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6565	25.9953350864	3	2160.122454	2159.137504	L	-	191	211
PSM	KAFLASPEYVNLPINGNGKQ	1352	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6685	26.344471620533334	3	2160.122454	2159.137504	L	-	191	211
PSM	KTETVEEPMEEEEAAKEE	1353	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:35	ms_run[1]:scan=4107	18.3136462296	3	2123.891839	2122.909991	S	K	285	303
PSM	KALVDPGPDFVVCDEGHIL	1354	sp|P46100|ATRX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:4	ms_run[1]:scan=6997	27.413551946933335	3	2080.032983	2080.029927	N	K	1706	1725
PSM	RQILLGPNTGLSGGMPGALPSLPGKI	1355	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7294	28.7352472008	3	2543.429351	2543.425764	Q	-	117	143
PSM	RVIISAPSADAPMFVMGVNHE	1356	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7721	30.599070103466666	3	2274.101984	2272.098024	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1357	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6201	24.99288688	3	2240.092550	2240.108194	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1358	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=6135	24.803729893333333	3	2273.086203	2272.098024	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1359	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7717	30.584684954933334	3	2273.103521	2272.098024	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1360	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7619	30.230016382133332	3	2273.104086	2272.098024	K	K	118	139
PSM	KDLMENCIPNNQLSKPDALV	1361	sp|Q8N5G2|MACOI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=5734	23.7909739912	3	2314.134240	2314.129718	H	R	365	385
PSM	RPSGPGPELSGPSTPQKLPVPAPGG	1362	sp|P51531|SMCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5614	23.492446948	3	2379.252198	2379.254659	N	R	261	286
PSM	RDDIIENAPTTHTEEYSGEE	1363	sp|O14744|ANM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=4987	21.867499343466665	3	2304.9985	2304.9977	L	K	164	184
PSM	KNEDIPNVAVYPHNGMIDL	1364	sp|P54709|AT1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:35	ms_run[1]:scan=6730	26.477327293866665	3	2155.028100	2154.041555	S	K	194	213
PSM	KDMGSCEIYPQTIQHNPNG	1365	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35,6-UNIMOD:4	ms_run[1]:scan=4710	20.9421097472	3	2203.968527	2203.962653	V	R	346	365
PSM	RALTVPELTQQVFDAKNMMAACDP	1366	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	18-UNIMOD:35,19-UNIMOD:35,22-UNIMOD:4	ms_run[1]:scan=6888	27.00977955973333	3	2737.291005	2737.287358	Y	R	282	306
PSM	KASPPSLEQPYLTH	1367	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5218	22.521	3	1566.8042	1566.8042	G	R	431	445
PSM	KDPDPEFPTVKYPNPEEG	1368	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5822	23.99	3	2057.9582	2057.9582	Q	K	143	161
PSM	KDTEEPLPVKESDQTLAALLSP	1369	sp|P18583-6|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7430	29.399	3	2380.2373	2380.2373	S	K	1677	1699
PSM	KDVQEIATVVVPKP	1370	sp|Q9BRT6|LLPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5863	24.086	3	1521.8766	1521.8766	M	K	42	56
PSM	KEIPTDVKPSSLELPYTPPLES	1371	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6792	26.682	3	2439.2785	2439.2785	K	K	1474	1496
PSM	KEITALAPSTM	1372	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=4764	21.139	2	1176.606	1176.6060	Q	K	315	326
PSM	KELVYPPDYNPEGKVT	1373	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5459	23.167	3	1847.9305	1847.9305	F	K	485	501
PSM	KESPVFAPVYFPEELH	1374	sp|P09601|HMOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7124	27.935	3	1887.9407	1887.9407	N	R	69	85
PSM	KIGSNNSTTPTVPLKPPPPLTLG	1375	sp|Q96CB8|INT12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6459	25.704	3	2328.3053	2328.3053	S	K	347	370
PSM	KISSIQSIVPALEIANAH	1376	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7317	28.849	3	1890.0575	1890.0575	K	R	250	268
PSM	KLLVDVDESTLSPEEQKE	1377	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5932	24.266	3	2058.0368	2058.0368	D	R	477	495
PSM	KLPAELQELPGLSHQYWSAPSD	1378	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7239	28.468	3	2465.2227	2465.2227	N	K	103	125
PSM	KLPGSIQPVYGAQHPPLDP	1379	sp|Q9NU19|TB22B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5963	24.335	3	2013.0684	2013.0684	A	R	15	34
PSM	KPEPELNAAIPSANPAKTMQGSEVVNVL	1380	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	19-UNIMOD:35	ms_run[2]:scan=6472	25.74	3	2919.5012	2919.5012	C	K	525	553
PSM	KTTGLVGLAVCNTPHE	1381	sp|Q16718|NDUA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4	ms_run[2]:scan=5563	23.384	3	1695.8614	1695.8614	K	R	7	23
PSM	KTVEVPTYDFVTHS	1382	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5941	24.281	3	1621.7988	1621.7988	G	R	108	122
PSM	KVMLMASPSMEDLYH	1383	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=4969	21.803	3	1798.794	1798.7940	A	K	433	448
PSM	KVPEPGVPTETIKDMMFQLL	1384	sp|Q00534|CDK6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6900	27.058	3	2304.1745	2304.1745	D	R	111	131
PSM	KVPMQTGILPGCEPCH	1385	sp|O94813-3|SLIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35,12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4888	21.56	3	1838.8477	1838.8477	Q	K	1314	1330
PSM	KVSDVEELTPPEHLSDLPPFS	1386	sp|Q86XI2|CNDG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7075	27.739	3	2335.1584	2335.1584	R	R	1025	1046
PSM	KVTESASVMPSQDVSGSEDTFPNK	1387	sp|Q9H040|SPRTN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35	ms_run[2]:scan=4774	21.169	3	2555.1697	2555.1697	S	R	384	408
PSM	KVVQVSAGDSHTAALTDDG	1388	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4621	20.614	3	1869.9068	1869.9068	E	R	120	139
PSM	KYPDLYPQEDEDEEEERE	1389	sp|Q8N4Q1|MIA40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5217	22.519	3	2311.9604	2311.9604	Q	K	100	118
PSM	RAAPPPPPPPPPPPGADRVV	1390	sp|P16298-2|PP2BB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5098	22.195	3	1981.0898	1981.0898	A	K	8	28
PSM	RDGPNALTPPPTTPEWIKFC	1391	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	20-UNIMOD:4	ms_run[2]:scan=7064	27.697	3	2296.131	2296.1310	A	R	74	94
PSM	RDTSVEGSEMVPGKVELQE	1392	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=5053	22.06	3	2104.9947	2104.9947	G	K	101	120
PSM	REEFNALPACPIQATCEAASKEEN	1393	sp|P18433-6|PTPRA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6044	24.543	3	2734.2327	2734.2327	F	K	233	257
PSM	RGAEGILAPQPPPPQQHQE	1394	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4822	21.33	3	2049.0392	2049.0392	R	R	71	90
PSM	RGCQDFGWDPCFQPDGYEQTYAEMPKAE	1395	sp|Q9BY32-3|ITPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,11-UNIMOD:4,24-UNIMOD:35	ms_run[2]:scan=6880	26.983	3	3397.3751	3397.3751	P	K	103	131
PSM	RPAAMISQPPTPPTGQPVREDA	1396	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=4735	21.028	3	2331.1641	2331.1641	S	K	1061	1083
PSM	KISSIQSIVPALEIANAH	1397	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7333	28.926160514666666	3	1891.044354	1890.057462	K	R	250	268
PSM	KYTPSGQAGAAASESLFVSNHAY	1398	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6016	24.470223582666666	3	2357.099350	2355.113139	G	-	342	365
PSM	KDLEGENIEIVFAKPPDQ	1399	sp|O60506|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6668	26.291888515733334	3	2041.042044	2041.036787	G	K	394	412
PSM	KNALPPVLTTVNGQSPPEHSAPA	1400	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5799	23.9451585896	3	2325.202787	2324.212460	T	K	129	152
PSM	KEIEGEEIEIVLAKPPD	1401	sp|O43390|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6689	26.353540281599997	3	1909.030484	1908.009175	G	K	397	414
PSM	KDAFPPLPEKAACLESAQEPSGAWGN	1402	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4	ms_run[1]:scan=6505	25.837060545333333	3	2770.326634	2769.306831	Y	K	41	67
PSM	KAFLASPEYVNLPINGNGKQ	1403	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6695	26.370763001066667	3	2161.108004	2159.137504	L	-	191	211
PSM	KPSPAPPSTTTAPDASGPQK	1404	sp|P40855|PEX19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3918	17.398948014933335	3	1933.976131	1933.974521	A	R	33	53
PSM	RNPDPGSGPGTLPDPSSKPLPGS	1405	sp|Q9NW07|ZN358_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5087	22.160995342133333	3	2229.114264	2229.102575	G	R	460	483
PSM	KDSQVGTVNYMPPEAIKDMSSS	1406	sp|P33981|TTK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	19-UNIMOD:35	ms_run[1]:scan=5340	22.866667826399997	3	2399.102188	2399.098477	V	R	680	702
PSM	RENENGEEEEEEAEFGEEDLFHQQGDP	1407	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6744	26.515351828266667	3	3192.261304	3191.271169	M	R	584	611
PSM	KDLYANTVLSGGSTMYPGIADRMQ	1408	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	15-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=6363	25.439523446666666	3	2620.2272	2619.2302	R	K	292	316
PSM	RTPQPPAEEPPHPLTYSQLP	1409	sp|Q8WXE0|CSKI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5874	24.1199760008	3	2254.145979	2254.138232	S	R	369	389
PSM	REFTTTVVSCCPAELQTEGSNGK	1410	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=5416	23.05438721466667	3	2571.171942	2570.174102	A	K	12	35
PSM	KESPVFAPVYFPEELH	1411	sp|P09601|HMOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7141	28.0097749592	2	1888.946507	1887.940701	N	R	69	85
PSM	RVPVNLLNSPDCDVKTDDSVVPCFM	1412	sp|P33981|TTK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=6930	27.167588954133333	3	2895.347920	2892.345601	G	K	273	298
PSM	RGAFMLEPEGMSPMEPAGVSPMPGTQKDTG	1413	sp|Q6IBW4|CNDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=5449	23.143124243466666	3	3168.423099	3168.387209	P	R	189	219
PSM	KAELGTDLLSQLSLEDQK	1414	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7150	28.058	3	1987.0474	1987.0474	L	R	778	796
PSM	KCIDLEPDNATTYVH	1415	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=5325	22.824	3	1774.8196	1774.8196	D	K	501	516
PSM	KEAPCVLIYIPDGHT	1416	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4	ms_run[2]:scan=6586	26.056	3	1711.8603	1711.8603	C	K	693	708
PSM	KEEASPVPLTSNVGSTVKGGQNSTAAST	1417	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4932	21.69	3	2716.3515	2716.3515	L	K	555	583
PSM	KEEDATLSSPAVVMPTMGR	1418	sp|Q02252-2|MMSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=4755	21.102	3	2049.9711	2049.9711	W	-	504	523
PSM	KEEQLIPQDIPDGH	1419	sp|Q6P1L5|F117B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5515	23.286	3	1617.7999	1617.7999	E	R	363	377
PSM	KELETFPPPEDLHD	1420	sp|Q9NSV4-1|DIAP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5486	23.225	3	1665.7886	1665.7886	E	K	671	685
PSM	KELETFPPPEDLHD	1421	sp|Q9NSV4-1|DIAP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5669	23.632	3	1665.7886	1665.7886	E	K	671	685
PSM	KEPVPSALPPSLIPPSK	1422	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6198	24.984	3	1756.0135	1756.0135	E	R	197	214
PSM	KILDAVVAQEPLH	1423	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5798	23.942	3	1431.8086	1431.8086	F	R	755	768
PSM	KLPSIPLVPVSAQK	1424	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6348	25.398	3	1475.9076	1475.9076	L	R	143	157
PSM	KLVQDVANNTNEEAGDGTTTATVLA	1425	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5103	22.208	3	2531.2351	2531.2351	A	R	96	121
PSM	KNTSTVVSPSLLEKDPAFQMITIA	1426	sp|Q6ZWJ1|STXB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:35	ms_run[2]:scan=7115	27.892	3	2605.3673	2605.3673	N	K	3	27
PSM	KPAPAVVSVTPAVKDPLV	1427	sp|Q96CB8|INT12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6049	24.554	3	1787.0557	1787.0557	Q	K	229	247
PSM	KQGAPTSFLPPEASQLKPD	1428	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6329	25.338	3	2010.0422	2010.0422	M	R	103	122
PSM	KQLFEIDSVDTEGKGDIQQA	1429	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6072	24.636	3	2220.091	2220.0910	T	R	48	68
PSM	KSAVPGDLLTLPGTTEHL	1430	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7017	27.502	3	1847.9993	1847.9993	Q	R	290	308
PSM	KTVIPGMPTVIPPGLTREQE	1431	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6865	26.929	3	2162.1769	2162.1769	Q	R	30	50
PSM	KTVQIPVYDFVSHS	1432	sp|Q9BZX2|UCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6709	26.402	3	1618.8355	1618.8355	G	R	105	119
PSM	KTVSEVSEQPKETSMTEPSEPGS	1433	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35	ms_run[2]:scan=4035	17.948	3	2479.1272	2479.1272	E	K	378	401
PSM	KVAVAIPNRPPDAVLTDTTSLNQAALY	1434	sp|P51659-3|DHB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6977	27.345	3	2837.5287	2837.5287	V	R	461	488
PSM	KVDVIPVTAINLYPDGPEK	1435	sp|Q9NU53|GINM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6867	26.934	3	2067.1252	2067.1252	D	R	301	320
PSM	KVEGDMQVPDLDIKGP	1436	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=5615	23.495	3	1755.8713	1755.8713	P	K	3897	3913
PSM	KVMLMASPSMEDLYH	1437	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=6306	25.272	3	1766.8041	1766.8042	A	K	433	448
PSM	KVNTFSALLLEPYKPPSAQ	1438	sp|O43681|GET3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7126	27.941	3	2102.1412	2102.1412	D	-	330	349
PSM	KVQAAVGTSAAPVPSDNH	1439	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4150	18.501	3	1747.8853	1747.8853	E	-	300	318
PSM	KVVPQTVMATVPVKAQTTAATVQ	1440	sp|Q6P4R8-3|NFRKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=4984	21.855	3	2383.3145	2383.3145	T	R	845	868
PSM	PEPAKSAPAP	1441	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3637	16.038	2	963.50255	963.5025	M	K	2	12
PSM	RAPLDIPIPDPPPKDDEMETD	1442	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	18-UNIMOD:35	ms_run[2]:scan=6219	25.034	3	2376.1155	2376.1155	L	K	61	82
PSM	RASAETPAEEQELLTQVCGDVLSTCEH	1443	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	18-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=7287	28.704	3	3029.3706	3029.3706	C	R	807	834
PSM	REGNVPNIIIAGPPGTGKTTSILCLA	1444	sp|P35250-2|RFC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	24-UNIMOD:4	ms_run[2]:scan=7269	28.613	3	2648.432	2648.4320	A	R	65	91
PSM	RGPGLNLPPPIGGAGPPLGLPKP	1445	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7125	27.937	3	2171.2579	2171.2579	P	K	116	139
PSM	RISTPQTNTVPIKPLISTPPVSSQP	1446	sp|Q9BTA9-5|WAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6214	25.02	3	2657.4752	2657.4752	P	K	351	376
PSM	RQVAGDAPVEQATAETASPVH	1447	sp|Q92766-4|RREB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4745	21.067	3	2133.0451	2133.0451	L	R	94	115
PSM	KQMNMSPPPGNAGPVIMSIEEKMEADA	1448	sp|Q86U42|PABP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35,5-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=6472	25.740233919466668	3	2919.316000	2919.312253	E	R	145	172
PSM	KEAEEEELEIPPQYQAGGSGIH	1449	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6098	24.7050324216	3	2412.106696	2410.128849	Q	R	1199	1221
PSM	KVEPEEPSQMPPLPQSHQ	1450	sp|Q8IX15|HOMEZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=4453	19.907712542133332	3	2072.987112	2072.983706	L	K	182	200
PSM	KEMLPPPPVSSSSQKPA	1451	sp|P51825|AFF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35	ms_run[1]:scan=4387	19.6033687136	3	1795.923234	1794.918586	K	K	862	879
PSM	KVNTFSALLLEPYKPPSAQ	1452	sp|O43681|GET3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7107	27.859136343733333	3	2102.142964	2102.141192	D	-	330	349
PSM	KAIEPPPLDAVIEAEHTL	1453	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7530	29.862	3	1942.0411	1942.0411	A	R	819	837
PSM	KAPVLAAPPVTVKDD	1454	sp|O75128-6|COBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5082	22.145	3	1519.861	1519.8610	G	R	441	456
PSM	KDLPTVLPPGFTIGAICK	1455	sp|P08397-4|HEM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:4	ms_run[2]:scan=7197	28.274	3	1926.0649	1926.0649	L	R	81	99
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLS	1456	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7346	28.986	3	3310.5268	3310.5268	R	K	122	154
PSM	KGIAFPTSISVNNCVCHFSPL	1457	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=7203	28.3	3	2347.1453	2347.1453	K	K	18	39
PSM	KGTILISSEEGETEANNH	1458	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4759	21.117	3	1927.9123	1927.9123	G	K	390	408
PSM	KGTVLLADNVICPGAPDFLAHV	1459	sp|P21964-2|COMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=7489	29.672	3	2306.2093	2306.2093	R	R	162	184
PSM	KISSIQSIVPALEIANAH	1460	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7212	28.341	3	1890.0575	1890.0575	K	R	250	268
PSM	KLEPSTSTDQPVTPEPTSQATRG	1461	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4427	19.794	3	2426.1925	2426.1925	P	R	1126	1149
PSM	KLMYDNTSEMPGKEDSIMEEESTPAVSDYS	1462	sp|Q8IWV7|UBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=5315	22.797	3	3430.4262	3430.4262	H	R	1049	1079
PSM	KLQSSQEPEAPPPRDVALLQG	1463	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5502	23.258	3	2259.1859	2259.1859	A	R	243	264
PSM	KMVMPSWFDLMGLSPDAPEDEAGIK	1464	sp|O95372|LYPA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,4-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=7270	28.619	3	2811.2805	2811.2805	M	K	69	94
PSM	KNALESYAFNM	1465	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=6043	24.54	2	1302.5914	1302.5914	A	K	484	495
PSM	KPGPYSSVPPPSAPPPK	1466	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4360	19.487	3	1701.909	1701.9090	N	K	285	302
PSM	KQAVPIVEPQEPEIKL	1467	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6315	25.297	3	1817.0299	1817.0299	T	K	1599	1615
PSM	KQQQMPPPPPPPPPPPPAGGTGGKG	1468	sp|O14654|IRS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=4427	19.794	3	2427.2369	2427.2369	S	K	623	648
PSM	KSDVSPIIQPVPSIKNVPQID	1469	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6625	26.17	3	2273.2631	2273.2631	S	R	311	332
PSM	KTAAYAIPMLQLLLH	1470	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=7391	29.207	3	1697.9538	1697.9538	G	R	57	72
PSM	KTLEPVKPPTVPNDYMTSPA	1471	sp|Q8IZP0-11|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:35	ms_run[2]:scan=5281	22.712	3	2200.1086	2200.1086	Y	R	135	155
PSM	KTPVEPEVAIH	1472	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4575	20.435	3	1218.6608	1218.6608	G	R	8	19
PSM	KTVPTPTVPSGSFSH	1473	sp|Q8TCU4-3|ALMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4962	21.777	3	1540.7886	1540.7886	Q	R	991	1006
PSM	KVMLMASPSMEDLYH	1474	sp|Q8IX12-2|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=5756	23.842	3	1766.8041	1766.8042	A	K	433	448
PSM	KVPPAVIIPPAAPLSGR	1475	sp|Q9H4A3-2|WNK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6313	25.289	3	1682.0243	1682.0243	G	R	1860	1877
PSM	RAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSF	1476	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6536	25.924	4	3337.6368	3337.6368	Y	R	1241	1274
PSM	RIPVSQPGMADPHQLFDDTSSAQS	1477	sp|Q5BJH7-4|YIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=5772	23.872	3	2599.1973	2599.1973	R	R	21	45
PSM	RQVEPLDPPAGSAPGEHVFV	1478	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6030	24.507	3	2101.0593	2101.0593	N	K	450	470
PSM	SEGDSVGESVHGKPSVVY	1479	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4815	21.304	3	1831.8588	1831.8588	M	R	2	20
PSM	KLGDVYVNDAFGTAH	1480	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5904	24.192973588799997	3	1606.764060	1605.778721	S	R	156	171
PSM	RIEPGVSVSLVNPQPSNGHFST	1481	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6107	24.724051276	3	2322.164407	2321.176408	F	K	1062	1084
PSM	RSAGQGEVLVYVEDPAGHQEEA	1482	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5917	24.22187969253333	3	2341.103661	2340.098218	T	K	309	331
PSM	RIPYQSPVSSSESAPGTIMNGHGGG	1483	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	19-UNIMOD:35	ms_run[1]:scan=4981	21.847345606666668	3	2502.141510	2501.160501	N	R	625	650
PSM	KLPISDSPPDTQEIHVIEQE	1484	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6235	25.081946948266665	3	2275.145786	2274.137957	E	K	1507	1527
PSM	KICEQFEAETPTDSETTQKA	1485	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4	ms_run[1]:scan=4792	21.234897346933334	3	2314.055522	2312.047822	C	R	227	247
PSM	KIVPMLNPDGVINGNH	1486	sp|Q9UPW5|CBPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:35	ms_run[1]:scan=5681	23.6650039488	3	1733.880649	1732.893040	F	R	954	970
PSM	RQVTSNSLSGTQEDGLDDPRLE	1487	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5368	22.934242266400002	3	2417.133560	2416.146624	A	K	131	153
PSM	KEGFGLSENPFASLSPDEQKDE	1488	sp|O15504|NUP42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7027	27.549378005599998	3	2425.118225	2423.112865	R	K	92	114
PSM	KDLFDPIIED	1489	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7097	27.826	2	1203.6023	1203.6023	F	R	86	96
PSM	KDLGSTEDGDGTDDFLTDKEDE	1490	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5505	23.264	3	2400.9929	2400.9929	R	K	179	201
PSM	KDLPELALDTPRAPQLVGQFIA	1491	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7466	29.565	3	2391.3162	2391.3162	L	R	234	256
PSM	KDSYVGDEAQS	1492	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3809	16.883	2	1197.515	1197.5150	Q	K	50	61
PSM	KEAEPIPETVKPEE	1493	sp|O75586|MED6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4580	20.458	3	1594.809	1594.8090	K	K	209	223
PSM	KEEDDSDQVEVPRDQENDVGD	1494	sp|Q9BRR8|GPTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4502	20.128	3	2417.0102	2417.0102	A	K	573	594
PSM	KEVPTADPTGVDRDDGP	1495	sp|Q96KN1|LRAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4291	19.16	3	1767.8275	1767.8275	Y	R	14	31
PSM	KIEEAMDGSETPQLFTVLPEK	1496	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6954	27.26	3	2361.1774	2361.1774	K	R	770	791
PSM	KILDAVVAQEPLH	1497	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5795	23.938	2	1431.8086	1431.8086	F	R	755	768
PSM	KMIPCDFLIPVQTQHPI	1498	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=7174	28.17	3	2036.0587	2036.0587	T	R	400	417
PSM	KTAFQEALDAAGD	1499	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6791	26.678	2	1335.6307	1335.6307	S	K	8	21
PSM	KTCLPGFPGAPCAIKIS	1500	sp|P51610-4|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=6588	26.061	3	1815.9375	1815.9375	F	K	1928	1945
PSM	KVLSVETPLSIQAHPN	1501	sp|P34949-2|MPI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5772	23.872	2	1731.9519	1731.9519	F	K	99	115
PSM	RAASAATAAPTATPAAQESGTIPK	1502	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4432	19.814	3	2238.1604	2238.1604	R	K	62	86
PSM	RADAPDAGAQSDSELPSYHQNDVSLD	1503	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5430	23.089	3	2757.2114	2757.2114	A	R	1288	1314
PSM	RDEAEDYYDVITHPMDFQTVQN	1504	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:35	ms_run[2]:scan=7033	27.576	3	2701.1602	2701.1602	T	K	1366	1388
PSM	RGSYGDLGGPIITTQVTIPKDLAGSIIG	1505	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7507	29.751	3	2798.5178	2798.5178	G	K	353	381
PSM	RSYDVPPPPMEPDHPFYSNIS	1506	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:35	ms_run[2]:scan=6091	24.694	3	2460.1056	2460.1056	R	K	117	138
PSM	KSYELPDGQVITIGNERF	1507	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=7472	29.592414342666665	3	2066.0332	2065.0472	E	R	238	256
PSM	KQSSTPGSLFLSPPAPAPKNGSSSDSSVGE	1508	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6066	24.618943458933334	3	2916.407387	2915.414861	E	K	8	38
PSM	KMMETMDQGDVIIRPSS	1509	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=4533	20.267722625066664	3	1984.892579	1984.890400	E	K	1345	1362
PSM	KNQVAMNPTNTVFDAK	1510	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:35	ms_run[1]:scan=4907	21.611646904	3	1793.862487	1792.877784	A	R	56	72
PSM	KTVLPTALPSSFSH	1511	sp|Q8TCU4|ALMS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6019	24.4770132152	3	1483.804834	1483.803479	Q	R	2131	2145
PSM	KSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	1512	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5267	22.6680692816	4	3974.822834	3974.825357	V	K	35	77
PSM	RVIISAPSADAPMFVMGVNHE	1513	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	16-UNIMOD:35	ms_run[1]:scan=6630	26.184273004266668	3	2257.088878	2256.103109	K	K	118	139
PSM	KTNGLPVQNGIDADVKDFS	1514	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6481	25.763158764266667	3	2017.997367	2017.011634	D	R	278	297
PSM	KTNGLPVQNGIDADVKDFS	1515	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6343	25.3810862184	3	2017.997878	2017.011634	D	R	278	297
PSM	RTVTQVVPAEGQENGQREEEEEE	1516	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4573	20.42952998666667	3	2643.193060	2642.205596	C	K	919	942
PSM	KVNGDASPAAAESGAKEELQANGSAPAAD	1517	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5038	21.999527888	3	2726.266752	2725.279095	V	K	40	69
PSM	KAMGIMNSFVNDIFE	1518	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7345	28.983	2	1746.7957	1746.7957	S	R	58	73
PSM	KDLTGQVPTPVVKQT	1519	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4804	21.275	3	1609.9039	1609.9039	Q	K	519	534
PSM	KDSGVASTEDSSSSHITAAAIAA	1520	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4998	21.891	3	2175.0291	2175.0291	K	K	220	243
PSM	KEAFEQPQTSSTPPRDLDS	1521	sp|P52564|MP2K6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4745	21.067	3	2132.0022	2132.0022	P	K	17	36
PSM	KEPNPPIDQVIQKPGVVQ	1522	sp|O15131|IMA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5514	23.284	3	1985.0946	1985.0946	S	R	110	128
PSM	KEVFLPSTPGLGMHVEV	1523	sp|Q7Z7H5-3|TMED4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35	ms_run[2]:scan=6401	25.541	3	1854.955	1854.9550	Q	K	65	82
PSM	KGDVEEDEAVPDSEQDIKP	1524	sp|O14787-2|TNPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4863	21.462	3	2098.9542	2098.9542	L	R	317	336
PSM	KNVPPVGILAPEANPKAEE	1525	sp|Q9UGU0-2|TCF20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5483	23.22	3	1972.0629	1972.0629	S	K	1495	1514
PSM	KPLQEDILMQNIETVHPF	1526	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=7049	27.635	3	2167.0983	2167.0983	A	R	1649	1667
PSM	KQICVVMLESPPKGVTIPY	1527	sp|Q15366-7|PCBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=6686	26.346	3	2174.1479	2174.1479	V	R	160	179
PSM	KSYCNDQSTGDIKVIGGDDLSTLTG	1528	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=6404	25.549	3	2643.2334	2643.2334	L	K	103	128
PSM	PEPTKSAPAP	1529	sp|P58876|H2B1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3662	16.159	2	993.51311	993.5131	M	K	2	12
PSM	RAPTVPPPLPPTPPQPAR	1530	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5208	22.502	3	1888.0683	1888.0683	L	R	615	633
PSM	RDDPQAEPQAPGRPTAPGLAAAAAAD	1531	sp|Q9UBU6|FA8A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5195	22.463	3	2513.2259	2513.2259	P	K	40	66
PSM	RDFVAEPMGEKPVGSLAGIGEVLG	1532	sp|O75531|BAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=7048	27.633	3	2443.2417	2443.2417	H	K	8	32
PSM	SGTKPDILWAPHHVD	1533	sp|Q9NXC5|MIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6010	24.459	3	1713.8475	1713.8475	M	R	2	17
PSM	KDQVTAQEIFQDNHEDGPTA	1534	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5603	23.4700491288	3	2243.003449	2242.013819	K	K	545	565
PSM	KPQEAAVAPEKPPASDET	1535	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=3946	17.537874192266667	3	1863.9212	1863.9209	A	K	238	256
PSM	KVSYIPDEQIAQGPENGR	1536	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5301	22.759091305066665	3	2000.980790	1999.996319	L	R	150	168
PSM	RQGAEGAPSPNYDDDDDERADDTLFMM	1537	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	26-UNIMOD:35,27-UNIMOD:35	ms_run[1]:scan=5709	23.727480891733332	3	3062.210515	3062.214189	L	K	444	471
PSM	KNQVAMNPTNTVFDAK	1538	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5422	23.067839234666668	3	1777.869233	1776.882869	A	R	56	72
PSM	RVIISAPSADAPMFVMGVNHE	1539	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7665	30.405346452	3	2274.103591	2272.098024	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1540	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7874	31.1289644368	3	2273.105038	2272.098024	K	K	118	139
PSM	RVIISAPSADAPMFVMGVNHE	1541	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7765	30.755854448266668	3	2273.105326	2272.098024	K	K	118	139
PSM	KVPAQANGTPTTKSPAPGAPT	1542	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4012	17.83327023493333	3	1991.034858	1990.048354	A	R	1219	1240
PSM	KVMLMASPSMEDLYH	1543	sp|Q8IX12|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35	ms_run[1]:scan=6029	24.50491302373333	3	1766.803027	1766.804150	A	K	448	463
PSM	KFALVAPVQAEEDSGNVNGK	1544	sp|O96028|NSD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5833	24.014878921866668	3	2073.039813	2072.053834	T	K	505	525
PSM	RQVEPLDPPAGSAPGEHVFV	1545	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5994	24.4181365472	3	2101.061706	2101.059253	N	K	450	470
PSM	RVEDYEPYPDDGMGYGDYPKLPD	1546	sp|O95169|NDUB8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35	ms_run[1]:scan=6339	25.367434312266667	3	2706.148924	2706.143179	M	R	58	81
PSM	KNVMVVSCVYPSSEKNNSNSLN	1547	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=4960	21.769754164266665	3	2486.149323	2485.157724	E	R	127	149
PSM	KNTEALPPPTSLDTVPSRDEL	1548	sp|Q8IYK4|GT252_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=6042	24.534766934666667	3	2280.1652	2279.1642	A	-	606	627
PSM	KTATPEIVDNKDGTVTV	1549	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4971	21.811760125333333	3	1788.952158	1786.931259	G	R	1770	1787
PSM	MHSLATAAPVPTTLAQVDRE	1550	sp|Q92600|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6054	24.57361463413333	3	2109.088860	2107.073189	-	K	1	21
PSM	KAGFAGDDAP	1551	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4277	19.099	2	947.43486	947.4349	C	R	18	28
PSM	KDGWSLWYSEY	1552	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7465	29.559	2	1432.6299	1432.6299	D	R	316	327
PSM	KDSEEEVSLLGSQDIEEGNHQVEDGC	1553	sp|Q9Y487|VPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	26-UNIMOD:4	ms_run[2]:scan=6020	24.48	3	2902.2411	2902.2411	R	R	693	719
PSM	KIYGADDIELLPEAQH	1554	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6561	25.984	3	1810.9101	1810.9101	Q	K	832	848
PSM	KLPPPPGSPLGHSPTASPPPTA	1555	sp|O95785-2|WIZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5109	22.228	3	2102.116	2102.1160	K	R	282	304
PSM	KTLDLSNNQLSEIPAELADCPKL	1556	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:4	ms_run[2]:scan=7328	28.9	3	2568.3105	2568.3105	L	K	205	228
PSM	KTVAPMPPAQDH	1557	sp|P22102-2|PUR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35	ms_run[2]:scan=3623	15.969	3	1306.634	1306.6340	G	K	207	219
PSM	KTVAPMPPAQDH	1558	sp|P22102-2|PUR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35	ms_run[2]:scan=3628	15.996	2	1306.634	1306.6340	G	K	207	219
PSM	KTVEVLEPEVTKLM	1559	sp|Q96F07-2|CYFP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:35	ms_run[2]:scan=5646	23.565	2	1630.8852	1630.8852	E	K	110	124
PSM	KTVLPTALPSSFSH	1560	sp|Q8TCU4-3|ALMS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6038	24.524	3	1483.8035	1483.8035	Q	R	2131	2145
PSM	KVGPMPWLGPQTDESIKGLCE	1561	sp|P22830|HEMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:4	ms_run[2]:scan=7008	27.465	3	2341.1446	2341.1446	S	R	304	325
PSM	KYMPAVTSTPTVNQHETSTS	1562	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35	ms_run[2]:scan=4257	19.007	3	2194.0212	2194.0212	K	K	788	808
PSM	RAVTTVTQSTPVPGPSVPKISSMTETAP	1563	sp|P51610-4|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	23-UNIMOD:35	ms_run[2]:scan=5501	23.255	3	2854.4746	2854.4746	T	R	1482	1510
PSM	RELLLLPGQPQTPVFPSTHDP	1564	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7008	27.465	3	2341.243	2341.2430	G	R	1504	1525
PSM	RGVFEAIVDQSPFVPEETMEEQKT	1565	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	19-UNIMOD:35	ms_run[2]:scan=7308	28.805	3	2781.3167	2781.3167	A	K	196	220
PSM	RILESITVSSLMATPQDPKGQGVGTG	1566	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:35	ms_run[2]:scan=6214	25.02	3	2657.3694	2657.3694	A	R	226	252
PSM	RTTPSYVAFTDTE	1567	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5764	23.855	2	1486.694	1486.6940	N	R	37	50
PSM	KNVPPVGILAPEANPKAEE	1568	sp|Q9UGU0|TCF20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5512	23.280231748800002	3	1972.068438	1972.062942	S	K	1495	1514
PSM	KLQNELDNVSTLLEEAEK	1569	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7415	29.327891149866666	3	2073.051287	2072.063730	S	K	1284	1302
PSM	KNQVALNPQNTVFDAK	1570	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5548	23.34809987546667	3	1786.924657	1785.937347	A	R	56	72
PSM	KAENNSEVGASGYGVPGPTWDRGANL	1571	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6359	25.4281568688	3	2646.239942	2645.247007	L	K	120	146
PSM	KNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP	1572	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	29-UNIMOD:35	ms_run[1]:scan=4624	20.628091054666665	4	3893.719183	3891.708947	K	-	537	576
PSM	RVIISAPSADAPMFVMGVNHE	1573	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7830	30.975921760533332	3	2273.098910	2272.098024	K	K	118	139
PSM	KTITLEVEPSDTIENVKA	1574	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6129	24.787931907466668	3	1986.052832	1986.052102	G	K	11	29
PSM	KTPGNGDGGSTSEAPQPPR	1575	sp|Q15014|MO4L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3830	16.985946598399998	3	1852.857107	1851.871118	Q	K	81	100
PSM	KLASQGDSISSQLGPIHPPP	1576	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6161	24.869820988266667	3	2028.070065	2028.064004	K	R	122	142
PSM	RVIISAPSADAPMFVMGVNHE	1577	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=6235	25.081946948266665	3	2273.086203	2272.098024	K	K	118	139
PSM	KQYNGVPLDGRPMNIQLVTSQIDAQ	1578	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:35	ms_run[1]:scan=6543	25.938039358666668	3	2801.408346	2800.417778	M	R	164	189
PSM	KDGMMYGPPVGTYHDPSAQEAG	1579	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4852	21.425	3	2338.9834	2338.9834	D	R	1140	1162
PSM	KEEEPGAPGKEGAAEGPLDPSGYNPA	1580	sp|P18858-2|DNLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5271	22.683	3	2566.1823	2566.1823	V	K	244	270
PSM	KEEPVIVTPPTKQSLV	1581	sp|Q8IX90-3|SKA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5545	23.344	3	1764.0033	1764.0033	Y	K	183	199
PSM	KGAEEMETVIPVDVMR	1582	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5250	22.613	3	1834.8805	1834.8805	A	R	12	28
PSM	KGLGTDEDTIIDIITH	1583	sp|P08133-2|ANXA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7543	29.922	3	1739.8941	1739.8941	M	R	345	361
PSM	KLVEVPNDGGPLGIHVVPFSA	1584	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7261	28.574	3	2144.163	2144.1630	V	R	273	294
PSM	KNIEDVIAQGIG	1585	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6967	27.307	2	1255.6772	1255.6772	G	K	49	61
PSM	KPQPLQQPSQPQQPPPTQQAVAR	1586	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4425	19.783	3	2548.351	2548.3510	L	R	3	26
PSM	KSLSFSEVFVPDLVNGPTNK	1587	sp|Q9UQ84-4|EXO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7260	28.568	3	2177.1368	2177.1368	N	K	451	471
PSM	KTETVEEPMEEEEAAKEE	1588	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:35	ms_run[2]:scan=3907	17.348	3	2122.91	2122.9100	S	K	285	303
PSM	KTPSSSQPERLPIGNTIQPSQAATFMNDAIE	1589	sp|O43395-3|PRPF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	26-UNIMOD:35	ms_run[2]:scan=6349	25.403	4	3343.6354	3343.6354	P	K	36	67
PSM	RAPTVPPPLPPTPPQPAR	1590	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5480	23.215	3	1888.0683	1888.0683	L	R	615	633
PSM	REANGLPIMESNCFDPSKIQLPEDE	1591	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:4	ms_run[2]:scan=7183	28.213	3	2888.3321	2888.3321	Y	-	129	154
PSM	RLLLPGELA	1592	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6707	26.398	2	980.60187	980.6019	V	K	100	109
PSM	RPVIVEPLEQLDDEDGLPEKLAQ	1593	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7186	28.229	3	2602.349	2602.3490	P	K	443	466
PSM	RVIGSGCNLDSA	1594	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4	ms_run[2]:scan=4546	20.322	2	1247.5928	1247.5928	H	R	158	170
PSM	RALTVPELTQQMFDAKNMMAACDP	1595	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	22-UNIMOD:4	ms_run[1]:scan=6888	27.00977955973333	3	2737.2902	2737.2692	Y	R	282	306
PSM	KISSIQSIVPALEIANAH	1596	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7657	30.3745591616	3	1891.055185	1890.057462	K	R	250	268
PSM	KQNGTVVQYLPTLQEK	1597	sp|P35658|NU214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6325	25.3236595976	3	1845.986393	1844.999613	G	K	211	227
PSM	RDPGVITYDLPTPPGEK	1598	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6032	24.512919125333333	3	1853.957899	1853.952329	K	K	273	290
PSM	KVAAPEIVSGVSGESEQKL	1599	sp|O15381|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5510	23.276821311733332	3	1927.029686	1927.026222	L	R	328	347
PSM	RQEDAPMIEPLVPEEKMET	1600	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	17-UNIMOD:35	ms_run[1]:scan=5949	24.3023561416	3	2259.0912	2257.0602	A	K	588	607
PSM	KLDVGEAMAPPSH	1601	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:35	ms_run[1]:scan=4214	18.8181552904	3	1366.655530	1366.655101	L	R	498	511
PSM	KANSGLSMESIHVPDPVISIAM	1602	sp|Q96RP9|EFGM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=6736	26.4938392536	3	2328.154194	2327.150119	D	K	434	456
PSM	KQGGQGDGIQVNSQFQQEFPSLQAAGDQEK	1603	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6521	25.882781397333336	3	3220.531196	3218.522848	N	K	125	155
PSM	KLQPSSSPENSLDPFPPRIL	1604	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7158	28.09674946133333	3	2224.175806	2221.174283	F	K	553	573
PSM	KTASNIIDVSAADSQGMEQHEYMD	1605	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=5172	22.394872950933333	3	2671.142010	2671.137776	A	R	60	84
PSM	KALEENNNFS	1606	sp|Q9NZ72-2|STMN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4150	18.501	2	1164.5411	1164.5411	H	R	109	119
PSM	KESELGDRPLQVGE	1607	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3967	17.64	3	1555.7842	1555.7842	E	R	36	50
PSM	KESYSVYVY	1608	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5719	23.749	2	1136.539	1136.5390	R	K	35	44
PSM	KGETEELQANACTNPAVHE	1609	sp|Q9NZJ6|COQ3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=4566	20.403	3	2096.9433	2096.9433	L	K	347	366
PSM	KISSIQSIVPALEIANAH	1610	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7791	30.844	3	1890.0575	1890.0575	K	R	250	268
PSM	KLLSPVVPQISAPQSNKE	1611	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5723	23.759	3	1934.0837	1934.0837	N	R	521	539
PSM	KLNSNTQVVLLSATMPSDVLEVTK	1612	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7281	28.672	3	2586.3939	2586.3939	Q	K	202	226
PSM	KNLQTVNVDEN	1613	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4232	18.901	2	1272.631	1272.6310	F	-	115	126
PSM	KPAVPTVASSTDMLHS	1614	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5356	22.904	3	1639.824	1639.8240	S	K	1905	1921
PSM	KSTVDGLQVTQLNVDHTTENEDELF	1615	sp|Q15750-2|TAB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6952	27.252	3	2831.3461	2831.3461	C	R	192	217
PSM	KTLDGPESNPLEVHEEPLSG	1616	sp|Q14699|RFTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5733	23.788	3	2147.0382	2147.0382	S	K	256	276
PSM	RAGLQFPVG	1617	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6080	24.663	2	943.52395	943.5240	S	R	21	30
PSM	RAQTTAQASTPGQPPPQPQAPSHAAGQSALPQ	1618	sp|Q96L91-3|EP400_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4618	20.605	4	3175.5759	3175.5759	L	R	1482	1514
PSM	RGAEEEPPPPLQAVLVADSFDR	1619	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7424	29.37	3	2392.2023	2392.2023	A	R	33	55
PSM	RPAAPANNPPPPSLMSTTQSRPPWMNSGPSES	1620	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=5439	23.116	4	3390.5721	3390.5721	P	R	345	377
PSM	RPAAPANNPPPPSLMSTTQSRPPWMNSGPSES	1621	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6450	25.683	4	3358.5823	3358.5823	P	R	345	377
PSM	RPTTPLSVGTIVPPPRPAS	1622	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5856	24.071	3	1942.1	1942.1000	A	R	417	436
PSM	RPVSSIIDVDILPETH	1623	sp|Q9BYG5|PAR6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7041	27.603	3	1789.9574	1789.9574	F	R	140	156
PSM	RTWEGWEPWM	1624	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=7192	28.254	2	1392.5921	1392.5921	G	-	4088	4098
PSM	RSGASGPENFQVGSMPPAQQQITSGQMH	1625	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4988	21.8705430776	3	2927.338330	2926.345024	M	R	454	482
PSM	RPNTQPPPAPAPHATLP	1626	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4900	21.59308865706667	3	1760.924428	1760.932202	L	R	405	422
PSM	KTGQATVASGIPAGWMGLDCGPESSK	1627	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=8183	32.25879647306667	3	2621.232382	2620.226138	A	K	297	323
PSM	RDLLEPSPADQLGNGH	1628	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5523	23.3025189296	3	1718.824837	1717.838361	E	R	772	788
PSM	KEIEMASEERPPAQALEIMMGL	1629	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:35,19-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=6105	24.7203218952	3	2521.207258	2520.190998	A	K	224	246
PSM	KDAFPPLPEKAACLESAQEPSGAWGN	1630	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4	ms_run[1]:scan=6470	25.732783987199998	3	2770.326634	2769.306831	Y	K	41	67
PSM	KAFLASPEYVNLPINGNGKQ	1631	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7678	30.454171016533333	3	2161.122946	2159.137504	L	-	191	211
PSM	KNQVALNPQNTVFDAK	1632	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=5503	23.2599484544	3	1786.9242	1785.9372	A	R	56	72
PSM	KFACNGTVIEHPEYGEVIQLQGDQ	1633	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	4-UNIMOD:4	ms_run[1]:scan=6578	26.029304844533332	3	2733.2722	2731.2902	K	R	66	90
PSM	KEMQADDELLHPLGPDD	1634	sp|Q9BVS4|RIOK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=5927	24.258648167999997	3	1939.872204	1937.867673	T	K	307	324
PSM	RPLLDSIQIQPPGGSSVGRPNGQS	1635	sp|Q6ICB0|DESI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6483	25.769827453866665	3	2460.274781	2459.288084	L	-	145	169
PSM	RPTTPLSVGTIVPPPRPAS	1636	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5865	24.09354297946667	3	1942.102498	1942.099996	A	R	450	469
PSM	KDSTGAADPPQPHIVGIQSPDQQAALA	1637	sp|Q9BQ95-3|ECSIT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5820	23.986	4	2711.3515	2711.3515	P	R	37	64
PSM	KEAAASGLPLMVIIH	1638	sp|O95881|TXD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7173	28.164	2	1548.8698	1548.8698	K	K	48	63
PSM	KEFAPATPPSTPHNSSVGSLSENEQNTIE	1639	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5318	22.809	3	3067.4371	3067.4371	A	K	1130	1159
PSM	KESYSIYVY	1640	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6140	24.814	2	1150.5546	1150.5546	R	K	35	44
PSM	KIDTIEIITD	1641	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6312	25.287	2	1159.6336	1159.6336	G	R	137	147
PSM	KTVQTAAANAASTAASSAAQNAFKGNQI	1642	sp|O15126|SCAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6362	25.437	3	2691.3576	2691.3576	N	-	311	339
PSM	REGDVLSNCEFTPAPTPQEHLT	1643	sp|Q6P3X3|TTC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4	ms_run[2]:scan=5903	24.191	3	2497.1544	2497.1544	R	K	291	313
PSM	RESGATIPSFMNIIPTKETPPT	1644	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7175	28.175	3	2386.2202	2386.2202	S	R	347	369
PSM	RFGSPADSWW	1645	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7199	28.283	2	1207.5411	1207.5411	D	R	106	116
PSM	RQDLPSSLPEPETQAPPRS	1646	sp|P49593-2|PPM1F_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5109	22.228	3	2104.0549	2104.0549	R	-	332	351
PSM	RTLYGFGG	1647	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5696	23.696	2	869.43955	869.4396	G	-	96	104
PSM	RTPAPEPEPCEASELPAK	1648	sp|Q9ULV3-5|CIZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:4	ms_run[2]:scan=4642	20.695	3	1977.9466	1977.9466	K	R	142	160
PSM	KFQPASAPAEDCISSSTEPKPDP	1649	sp|Q14008|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:4	ms_run[1]:scan=4922	21.663448686133332	4	2458.146027	2458.132220	A	K	1102	1125
PSM	KSADESGQALLAAGHYASDEV	1650	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6106	24.722169802133333	3	2117.950655	2117.986542	F	R	418	439
PSM	KVPQPVPLIAQKPVGEM	1651	sp|Q7Z333|SETX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	17-UNIMOD:35	ms_run[1]:scan=5459	23.167253169066665	3	1847.044636	1846.038642	L	K	1636	1653
PSM	RSPLLAGGSPPQPVVPAH	1652	sp|Q8NFH5|NUP35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5422	23.067839234666668	3	1778.980718	1778.979152	M	K	65	83
PSM	RAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSF	1653	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=6511	25.855147741333333	4	3337.6438	3337.6362	Y	R	1322	1355
PSM	AHNAGAAAAAGTHSAKSGGSEAAL	1654	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=4354	19.457600880799998	3	2119.0059	2119.0037	M	K	2	26
PSM	KIGSNNSTTPTVPLKPPPPLTLG	1655	sp|Q96CB8|INT12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6447	25.675442668533332	3	2328.307485	2328.305297	S	K	347	370
PSM	KPVPAAPVPSPVAPAPVPSR	1656	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5188	22.4411831424	3	1933.114730	1933.114918	E	R	122	142
PSM	KENIPSTDVSSPAMDAAGIHL	1657	sp|Q6PGQ7|BORA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	14-UNIMOD:35	ms_run[1]:scan=6119	24.761840424000003	3	2168.074129	2168.041949	D	R	365	386
PSM	KVAPQNDSFGTQLPPMHQQQ	1658	sp|Q96AE4-2|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:35	ms_run[1]:scan=5226	22.541221958133335	3	2269.057808	2266.080066	K	R	77	97
PSM	KDDAAPAPPVADAKAQD	1659	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4048	18.014	3	1678.8162	1678.8162	A	R	281	298
PSM	KEITALAPSTM	1660	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:35	ms_run[2]:scan=7630	30.272	2	1176.606	1176.6060	Q	K	315	326
PSM	KIDGAEPLTPEETEEKE	1661	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4679	20.835	3	1913.9106	1913.9106	K	K	822	839
PSM	KIGGIGTVPVG	1662	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5387	22.98	2	996.59678	996.5968	Y	R	255	266
PSM	KLVNTTITPEPEPKPQPNS	1663	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4760	21.124	3	2089.1055	2089.1055	A	R	672	691
PSM	KNAPAIIFIDELDAIAPK	1664	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7283	28.683	3	1938.0826	1938.0826	E	R	295	313
PSM	KNVLIVEDIIDTG	1665	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7377	29.136	2	1427.7872	1427.7872	G	K	128	141
PSM	KPVQNPLQTTSQSSKQPPPSI	1666	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5060	22.079	3	2261.2016	2261.2016	H	R	1938	1959
PSM	KSSQQPSTPQQAPPGQPQQGTFVAH	1667	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=4532	20.262	4	2630.2837	2630.2837	G	K	789	814
PSM	KTQTVTISDNANAVKSEIPT	1668	sp|P11171-4|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=5482	23.218	3	2116.1012	2116.1012	V	K	491	511
PSM	KVSILPDVVFDSPLH	1669	sp|Q9UMX1|SUFU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7327	28.894	3	1664.9138	1664.9138	L	-	470	485
PSM	RAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSF	1670	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6499	25.813	3	3337.6368	3337.6368	Y	R	1241	1274
PSM	RTWEGWEPWM	1671	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=7484	29.645	2	1376.5972	1376.5972	G	-	4088	4098
PSM	KMAVTFIGNSTAIQELFK	1672	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:35	ms_run[1]:scan=7540	29.9086330672	3	2014.045235	2013.060499	L	R	362	380
PSM	KNMDPLNDNIATLLHQSSD	1673	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6556	25.9683052384	3	2126.029595	2125.010983	M	K	587	606
PSM	RTWEGWEPWM	1674	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=7472	29.592414342666665	2	1376.598193	1376.597192	G	-	4119	4129
PSM	KVIAINVDD	1675	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=5156	22.354563016	2	985.5439	985.5439	W	P	155	164
PSM	RVIISAPSADAPMFVMGVNHE	1676	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7964	31.44103538106667	3	2272.091269	2272.098024	K	K	118	139
PSM	KETLLNGVGYLHEGLSPME	1677	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	18-UNIMOD:35	ms_run[1]:scan=6537	25.925549699999998	3	2103.024375	2102.035407	L	R	1610	1629
PSM	RNTNGSQFFITTVPTPHLDG	1678	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=7050	27.637885739733335	3	2202.073203	2201.086531	G	K	125	145
PSM	KPGETQEEETNSGEEPFIETPRQDGVS	1679	sp|Q14457|BECN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5360	22.914925674933333	3	2990.348288	2989.342483	A	R	53	80
PSM	KLPEPSASLPNPPSK	1680	sp|Q5TBB1|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=5035	21.990765592266666	3	1560.855511	1560.851158	L	K	233	248
PSM	KTVMDEGPQVFAPLSEESKN	1681	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=6344	25.383374001066667	3	2208.064987	2205.062349	C	K	687	707
PSM	KALVDPGPDFVVCDEGHIL	1682	sp|P46100-3|ATRX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	13-UNIMOD:4	ms_run[2]:scan=7019	27.512	3	2080.0299	2080.0299	N	K	1589	1608
PSM	KAPLDIPVPDPVKE	1683	sp|Q06323-3|PSME1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6192	24.96	3	1516.8501	1516.8501	L	K	58	72
PSM	KEAVAPVQEESDLEK	1684	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4508	20.153	3	1670.8363	1670.8363	K	K	41	56
PSM	KENAVPTIFLCTEPHD	1685	sp|Q9NVV9|THAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	11-UNIMOD:4	ms_run[2]:scan=6528	25.907	3	1869.8931	1869.8931	L	K	73	89
PSM	KGEGQLGPAE	1686	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=3888	17.265	2	984.48762	984.4876	A	R	239	249
PSM	KGEQLFLEPELVIPH	1687	sp|Q9NXE4-9|NSMA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7345	28.983	2	1747.9509	1747.9509	Q	R	159	174
PSM	KIVGPSGAAVPCKVEPGLGADNSVV	1688	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	12-UNIMOD:4	ms_run[2]:scan=5896	24.174	3	2420.2733	2420.2733	S	R	1007	1032
PSM	KLDEEGFVLPSTANEDIH	1689	sp|Q14CZ7|FAKD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6329	25.338	3	2012.9691	2012.9691	I	K	571	589
PSM	KLDFLPEMMVDHCSLNSSPVS	1690	sp|Q92879-4|CELF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	8-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6999	27.423	3	2421.1015	2421.1015	F	K	5	26
PSM	KLLCGLLAE	1691	sp|P14174|MIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:4	ms_run[2]:scan=6713	26.416	2	1015.5736	1015.5736	S	R	78	87
PSM	KLQPSSSPENSLDPFPPRIL	1692	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7171	28.156	3	2221.1743	2221.1743	F	K	553	573
PSM	KSPFPDVVPLQPEVSSYR	1693	sp|P31276|HXC13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6803	26.719	3	2044.0629	2044.0629	W	R	241	259
PSM	KTVIGELPPASSGSALAANVCK	1694	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	21-UNIMOD:4	ms_run[2]:scan=6119	24.762	3	2169.1464	2169.1464	L	K	111	133
PSM	KVTIAQGGVLPNIQAVLLPK	1695	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=7728	30.624	3	2058.2565	2058.2565	G	K	100	120
PSM	KWWTCFV	1696	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	5-UNIMOD:4	ms_run[2]:scan=7428	29.388	2	1025.4793	1025.4793	S	K	158	165
PSM	RCALSSPSLAFTPPIKTLGTPTQPGSTP	1697	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:4	ms_run[2]:scan=6865	26.929	4	2881.5008	2881.5008	D	R	237	265
PSM	RGGNFGFGDS	1698	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5257	22.631	2	1012.4363	1012.4363	G	R	203	213
PSM	RLWEAGW	1699	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6766	26.587	2	916.45554	916.4555	V	K	434	441
PSM	RPSQGLPVIQSPPSSPPH	1700	sp|Q9HCD6|TANC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5236	22.567	3	1879.9904	1879.9904	A	R	1432	1450
PSM	RPTYTNLN	1701	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=4226	18.876	2	977.49304	977.4930	E	R	186	194
PSM	RSGVSLAAL	1702	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=5842	24.035	2	872.50797	872.5080	E	K	54	63
PSM	KISSIQSIVPALEIANAH	1703	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=7955	31.409739693333332	3	1891.055197	1890.057462	K	R	250	268
PSM	KLGVENCYFPMFVSQSALEKE	1704	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=7023	27.532971976266666	3	2491.178560	2491.176334	K	K	1070	1091
PSM	RVIISAPSADAPMFVMGVNHE	1705	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=5991	24.4095969024	3	2242.0872	2240.1072	K	K	118	139
PSM	KIGSNNSTTPTVPLKPPPPLTLG	1706	sp|Q96CB8|INT12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=6613	26.131118739466668	3	2328.307485	2328.305297	S	K	347	370
PSM	RMQELYGDGKDGDTQTDAGGEPDSLGQQPTDTPYEWDLD	1707	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:35	ms_run[1]:scan=6834	26.817920413866666	4	4315.835090	4315.824765	L	K	17	56
PSM	RLPLSTPSPGNGSQGSHPLVS	1708	sp|Q6ZU65|UBN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=5479	23.212446614933334	3	2089.064445	2087.075966	Y	R	981	1002
PSM	KQEAVVEEDYNENAKNGEA	1709	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4314	19.268068856800003	3	2136.943534	2135.960721	T	K	67	86
PSM	KTSNGDLSDSTVSADPVVK	1710	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=4720	20.975961585866667	3	1919.936802	1918.948365	T	-	1155	1174
PSM	KTVTSGSIQPVTQAPQAGQMVDTK	1711	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	20-UNIMOD:35	ms_run[1]:scan=4645	20.709205139999998	3	2487.266622	2487.263903	L	R	560	584
PSM	KFEDENFIL	1712	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7059	27.678	2	1153.5655	1153.5655	E	K	22	31
PSM	KGMQELGVHPDQETYTDYVIPCFDSVNSA	1713	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:35,22-UNIMOD:4	ms_run[2]:scan=7086	27.783	3	3315.47	3315.4700	L	R	463	492
PSM	KHSALPSGSLQFRALS	1714	sp|Q9UPX0|TUTLB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4279	19.107	3	1697.9213	1697.9213	S	K	464	480
PSM	KLLQDFFNG	1715	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7091	27.806	2	1080.5604	1080.5604	Q	K	351	360
PSM	KLNIWDW	1716	sp|O60508|PRP17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7533	29.874	2	973.50215	973.5022	G	K	531	538
PSM	RALSDDGVSDLEDPTLTPLKDTE	1717	sp|O60443-2|GSDME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6517	25.872	3	2486.2024	2486.2024	L	R	26	49
PSM	RCPEALFQPSFLGMESCGIHETTFNSIM	1718	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	2-UNIMOD:4,14-UNIMOD:35,17-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=7297	28.751	3	3290.4505	3290.4505	F	K	256	284
PSM	RDAVLLVFAN	1719	sp|P61204-2|ARF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7176	28.181	2	1116.6291	1116.6291	L	K	80	90
PSM	RDNIQGIT	1720	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4396	19.648	2	915.47739	915.4774	L	K	24	32
PSM	RGVVDSEDLPLNIS	1721	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6692	26.362	2	1512.7784	1512.7784	I	R	378	392
PSM	RIAAQEVPIEIKPVNPSPLSQLQ	1722	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6875	26.962	3	2526.417	2526.4170	N	R	177	200
PSM	RISGLIYEET	1723	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5852	24.06	2	1179.6136	1179.6136	K	R	46	56
PSM	RISVYYNEATGG	1724	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5171	22.392	2	1328.6361	1328.6361	D	K	46	58
PSM	RSYDVPPPPMEPDHPFYSNIS	1725	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	10-UNIMOD:35	ms_run[2]:scan=7620	30.236	3	2460.1056	2460.1056	R	K	117	138
PSM	RSYDVPPPPMEPDHPFYSNIS	1726	sp|Q8N0Y7|PGAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	10-UNIMOD:35	ms_run[2]:scan=7649	30.347	3	2460.1056	2460.1056	R	K	117	138
PSM	RTLSDYNIQ	1727	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=4952	21.743	2	1108.5513	1108.5513	G	K	54	63
PSM	RWFTPWS	1728	sp|Q6IA69|NADE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7259	28.563	2	978.47119	978.4712	L	R	127	134
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLIS	1729	sp|P04350|TBB4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	6-UNIMOD:4,8-UNIMOD:4,26-UNIMOD:35	ms_run[1]:scan=7108	27.861613627733334	3	3326.526189	3326.521728	R	K	122	154
PSM	RGVLLEDPEQGGEDPGKPSDAML	1730	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	22-UNIMOD:35	ms_run[1]:scan=5831	24.0098579376	3	2425.1452	2425.1426	K	K	81	104
PSM	KINVPELPTPDEDNKLEVQ	1731	sp|O43264|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=6257	25.140353022933333	3	2177.1222	2177.1211	S	K	430	449
PSM	KLANGSLEPPAQAAPGPSK	1732	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=4641	20.692813468266667	3	1833.9672	1831.9782	E	R	464	483
PSM	RLLEDFGDGGAFPEIHVAQYPLDMG	1733	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	24-UNIMOD:35	ms_run[1]:scan=7455	29.518617020799997	3	2764.343106	2762.301017	P	R	53	78
PSM	KLTVIDTPGFGDHINNENCWQPIM	1734	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	19-UNIMOD:4,24-UNIMOD:35	ms_run[1]:scan=6899	27.052408467733336	3	2814.319685	2814.310536	M	K	357	381
PSM	KELSESVQQQSTPVPLISPK	1735	sp|Q9ULU4|PKCB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=5492	23.233807116266668	3	2194.1860	2194.1840	L	R	530	550
PSM	KTITLEVEPSDTIENVKA	1736	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=5163	22.374435578666667	3	1986.0212	1986.0512	G	K	11	29
PSM	KGDDLLETNNPEPEKCQSVSSAGELETENYE	1737	sp|Q96RS0|TGS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	16-UNIMOD:4	ms_run[1]:scan=5788	23.919525269066664	3	3483.543600	3481.531483	K	R	558	589
PSM	KVTIAQGGVLPNIQAVLLPK	1738	sp|P20671|H2A1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7602	30.1671877408	3	2059.268143	2058.256497	G	K	100	120
PSM	RSSGPYGGGGQYFA	1739	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7745	30.6854986808	2	1402.634617	1402.626578	G	K	284	298
PSM	KLPGELEPVQATQNKTG	1740	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=4982	21.8493328056	3	1809.9492	1808.9632	E	K	195	212
PSM	RLFPITVVYQPQEAEPTTSKSE	1741	sp|Q14147|DHX34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=6734	26.488174720533333	3	2520.2792	2519.2902	G	K	334	356
PSM	KSAYDPSSVDVTSQHSSGAQSAASS	1742	sp|Q5VT06|CE350_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=4409	19.705420147999998	3	2453.0842	2453.0942	R	R	1142	1167
PSM	KAFLASPEYVNLPINGNGKQ	1743	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=7821	30.9462864616	3	2160.119711	2159.137504	L	-	191	211
PSM	KAGGAAVVITEPEHT	1744	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=4547	20.32662424773333	3	1479.783331	1478.772908	G	K	77	92
PSM	KSEPHSLSSEALMR	1745	sp|Q9NR28|DBLOH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:35	ms_run[1]:scan=3973	17.667892045066665	3	1587.776223	1586.772256	Q	R	62	76
PSM	KENISQPRGIAVHPMA	1746	sp|P01133|EGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	15-UNIMOD:35	ms_run[1]:scan=4598	20.5291481072	3	1762.886338	1762.914838	T	K	594	610
PSM	KAPPVDDAEVDELVLQTK	1747	sp|Q9UIG0|BAZ1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=6626	26.173762229066664	3	1967.045281	1966.025888	P	R	1318	1336
PSM	KTETVEEPMEEEEAAKEE	1748	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:35	ms_run[1]:scan=4520	20.207377383733334	3	2122.910092	2122.909991	S	K	285	303
PSM	KEADPSNFANFSAYPSEEDMIEWAK	1749	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	20-UNIMOD:35	ms_run[1]:scan=6987	27.3761834744	3	2891.262338	2891.259606	N	R	836	861