MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F37.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F37.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69.0	null	201-UNIMOD:4,250-UNIMOD:35,251-UNIMOD:35	0.18	69.0	4	2	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67.0	null	111-UNIMOD:4	0.13	67.0	1	1	1
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	66.0	null		0.19	66.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	62.0	null		0.04	62.0	2	2	2
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60.0	null		0.08	60.0	1	1	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null	430-UNIMOD:35,433-UNIMOD:4,440-UNIMOD:35,441-UNIMOD:4	0.07	59.0	5	3	1
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	58.0	null		0.12	58.0	3	2	1
PRT	sp|P42771-2|CDN2A_HUMAN	Isoform 2 of Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null	21-UNIMOD:4	0.29	57.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	56.0	null	153-UNIMOD:35,143-UNIMOD:35,443-UNIMOD:35,746-UNIMOD:35	0.12	56.0	14	7	4
PRT	sp|Q6UUV9-3|CRTC1_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	160-UNIMOD:35	0.05	56.0	1	1	1
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56.0	null		0.05	56.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.18	54.0	2	1	0
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null	69-UNIMOD:4	0.23	54.0	1	1	1
PRT	sp|O95671-2|ASML_HUMAN	Isoform 2 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.05	54.0	1	1	1
PRT	sp|Q12849-5|GRSF1_HUMAN	Isoform 2 of G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	243-UNIMOD:35	0.13	53.0	3	2	1
PRT	sp|Q96EL2|RT24_HUMAN	28S ribosomal protein S24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.12	53.0	2	1	0
PRT	sp|Q96RS0|TGS1_HUMAN	Trimethylguanosine synthase OS=Homo sapiens OX=9606 GN=TGS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	339-UNIMOD:4	0.04	53.0	1	1	1
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	201-UNIMOD:4,204-UNIMOD:4	0.07	53.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null	951-UNIMOD:4	0.05	53.0	7	6	5
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.04	52.0	1	1	1
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	60-UNIMOD:35	0.10	52.0	2	1	0
PRT	sp|Q8IZH2-2|XRN1_HUMAN	Isoform 2 of 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.02	52.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	1008-UNIMOD:35	0.02	52.0	2	2	2
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	611-UNIMOD:4	0.03	52.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52.0	null	448-UNIMOD:35	0.06	52.0	1	1	1
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.02	51.0	1	1	1
PRT	sp|O95793|STAU1_HUMAN	Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51.0	null		0.07	51.0	2	2	1
PRT	sp|Q9GZT9-2|EGLN1_HUMAN	Isoform 2 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	58-UNIMOD:4	0.08	50.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	493-UNIMOD:35	0.05	50.0	3	2	1
PRT	sp|P61006|RAB8A_HUMAN	Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null		0.11	50.0	1	1	1
PRT	sp|Q15046-2|SYK_HUMAN	Isoform Mitochondrial of Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null		0.04	50.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null	654-UNIMOD:4,635-UNIMOD:4,741-UNIMOD:35	0.05	50.0	3	3	3
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	50.0	null	218-UNIMOD:35,198-UNIMOD:35	0.12	50.0	6	2	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	575-UNIMOD:35,582-UNIMOD:4,584-UNIMOD:35	0.05	49.0	2	2	2
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	59-UNIMOD:4	0.12	49.0	4	4	3
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	374-UNIMOD:35,373-UNIMOD:35	0.05	49.0	4	2	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	219-UNIMOD:35,67-UNIMOD:35	0.16	49.0	4	3	2
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49.0	null		0.04	49.0	1	1	1
PRT	sp|P09936|UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	132-UNIMOD:4,152-UNIMOD:4	0.17	48.0	3	2	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	34-UNIMOD:35	0.29	48.0	3	2	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	211-UNIMOD:35,157-UNIMOD:35,167-UNIMOD:35	0.08	48.0	3	2	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	1	1	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|Q8WXA9|SREK1_HUMAN	Splicing regulatory glutamine/lysine-rich protein 1 OS=Homo sapiens OX=9606 GN=SREK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	494-UNIMOD:4,150-UNIMOD:35	0.09	48.0	4	2	1
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.04	48.0	1	1	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	1154-UNIMOD:35,1159-UNIMOD:4	0.01	48.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	197-UNIMOD:35,206-UNIMOD:4	0.08	48.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	290-UNIMOD:4,293-UNIMOD:35	0.04	48.0	7	1	0
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	180-UNIMOD:35	0.04	48.0	1	1	1
PRT	sp|Q14141|SEPT6_HUMAN	Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null		0.05	48.0	1	1	1
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null		0.06	48.0	2	1	0
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	1389-UNIMOD:4,2579-UNIMOD:4	0.03	48.0	3	3	3
PRT	sp|Q96G74|OTUD5_HUMAN	OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	26-UNIMOD:35	0.08	48.0	2	2	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	2	1	0
PRT	sp|O75044|SRGP2_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	893-UNIMOD:4	0.04	47.0	2	2	2
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.11	47.0	6	4	2
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	162-UNIMOD:35,148-UNIMOD:35	0.12	47.0	4	2	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	482-UNIMOD:35,500-UNIMOD:4	0.07	47.0	5	4	3
PRT	sp|P49711|CTCF_HUMAN	Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	577-UNIMOD:4	0.03	47.0	2	1	0
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	293-UNIMOD:4,298-UNIMOD:4	0.06	47.0	1	1	1
PRT	sp|P13995|MTDC_HUMAN	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.06	47.0	2	1	0
PRT	sp|Q12765|SCRN1_HUMAN	Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	290-UNIMOD:4,293-UNIMOD:35	0.09	47.0	4	2	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null	395-UNIMOD:4	0.07	47.0	2	2	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null	132-UNIMOD:35	0.09	47.0	3	1	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null	363-UNIMOD:4,367-UNIMOD:35	0.04	47.0	1	1	1
PRT	sp|P57076|CF298_HUMAN	Cilia- and flagella-associated protein 298 OS=Homo sapiens OX=9606 GN=CFAP298 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47.0	null		0.08	47.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	355-UNIMOD:35	0.06	46.0	2	2	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	2	2	2
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	234-UNIMOD:4,294-UNIMOD:35	0.11	46.0	3	2	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	2	2	2
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	4	3	2
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.06	46.0	1	1	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null	64-UNIMOD:4	0.08	46.0	2	1	0
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	613-UNIMOD:4,619-UNIMOD:4,465-UNIMOD:35	0.06	46.0	6	4	2
PRT	sp|Q6NS38|ALKB2_HUMAN	DNA oxidative demethylase ALKBH2 OS=Homo sapiens OX=9606 GN=ALKBH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.09	46.0	1	1	1
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	299-UNIMOD:35,300-UNIMOD:35,303-UNIMOD:4,363-UNIMOD:35,267-UNIMOD:35	0.15	45.0	8	4	2
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	1801-UNIMOD:4,1804-UNIMOD:4	0.02	45.0	3	3	3
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	1	1	1
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	2	1	0
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.08	45.0	2	2	2
PRT	sp|Q96CW1|AP2M1_HUMAN	AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	246-UNIMOD:4,251-UNIMOD:4	0.11	45.0	3	3	3
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	85-UNIMOD:35	0.33	45.0	6	4	3
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	2	2	2
PRT	sp|Q92995-2|UBP13_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.01	45.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	318-UNIMOD:4,336-UNIMOD:4	0.05	45.0	7	4	2
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	128-UNIMOD:4,134-UNIMOD:4	0.14	45.0	3	3	3
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	173-UNIMOD:4,100-UNIMOD:35	0.24	45.0	4	3	2
PRT	sp|O14531|DPYL4_HUMAN	Dihydropyrimidinase-related protein 4 OS=Homo sapiens OX=9606 GN=DPYSL4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.09	45.0	1	1	1
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	151-UNIMOD:35	0.09	45.0	1	1	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	72-UNIMOD:35,75-UNIMOD:35	0.10	45.0	3	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	88-UNIMOD:35	0.12	45.0	1	1	1
PRT	sp|O15504|NUP42_HUMAN	Nucleoporin NUP42 OS=Homo sapiens OX=9606 GN=NUP42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.06	45.0	2	1	0
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.06	44.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	154-UNIMOD:35	0.08	44.0	5	4	3
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	239-UNIMOD:35	0.11	44.0	7	4	2
PRT	sp|Q9HAU5|RENT2_HUMAN	Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	2	2	2
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1313-UNIMOD:35,1178-UNIMOD:35	0.02	44.0	3	3	3
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	1	1	1
PRT	sp|Q9Y2L5-2|TPPC8_HUMAN	Isoform 2 of Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.08	44.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	362-UNIMOD:4,365-UNIMOD:4,368-UNIMOD:4	0.08	44.0	3	2	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	816-UNIMOD:4	0.01	44.0	1	1	1
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	507-UNIMOD:4	0.03	44.0	2	1	0
PRT	sp|Q9H832-2|UBE2Z_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	227-UNIMOD:35,189-UNIMOD:35	0.18	44.0	2	2	2
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null		0.08	44.0	4	3	2
PRT	sp|Q8TAF3-4|WDR48_HUMAN	Isoform 4 of WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	400-UNIMOD:35,284-UNIMOD:4	0.07	44.0	3	2	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	246-UNIMOD:4	0.12	44.0	4	4	4
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	74-UNIMOD:4	0.10	44.0	3	3	3
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	450-UNIMOD:35	0.09	44.0	3	3	3
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	293-UNIMOD:4,296-UNIMOD:4,546-UNIMOD:35,548-UNIMOD:35,552-UNIMOD:4	0.12	44.0	8	6	4
PRT	sp|Q96HR8|NAF1_HUMAN	H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.06	44.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null		0.16	44.0	2	2	2
PRT	sp|Q8N335|GPD1L_HUMAN	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.06	44.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.09	44.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	130-UNIMOD:35	0.11	44.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	759-UNIMOD:35,708-UNIMOD:4	0.07	44.0	4	2	0
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	463-UNIMOD:35	0.05	43.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.14	43.0	2	2	2
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	414-UNIMOD:4,416-UNIMOD:4	0.06	43.0	2	2	2
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	591-UNIMOD:35,594-UNIMOD:4,598-UNIMOD:35	0.03	43.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	131-UNIMOD:35	0.02	43.0	2	1	0
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	95-UNIMOD:35	0.18	43.0	1	1	1
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.18	43.0	3	2	1
PRT	sp|P33552|CKS2_HUMAN	Cyclin-dependent kinases regulatory subunit 2 OS=Homo sapiens OX=9606 GN=CKS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.22	43.0	2	1	0
PRT	sp|Q8NBU5|ATAD1_HUMAN	ATPase family AAA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ATAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	359-UNIMOD:4	0.12	43.0	2	2	2
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	280-UNIMOD:4	0.11	43.0	4	4	4
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	207-UNIMOD:4	0.09	43.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	127-UNIMOD:35	0.06	43.0	3	3	3
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	87-UNIMOD:4	0.17	43.0	1	1	1
PRT	sp|Q9BXY0|MAK16_HUMAN	Protein MAK16 homolog OS=Homo sapiens OX=9606 GN=MAK16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	1	1	1
PRT	sp|O00566|MPP10_HUMAN	U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens OX=9606 GN=MPHOSPH10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.04	43.0	3	2	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.17	43.0	2	2	2
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	2	2	2
PRT	sp|Q96DT7-3|ZBT10_HUMAN	Isoform 3 of Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	126-UNIMOD:35,153-UNIMOD:4	0.40	43.0	7	6	5
PRT	sp|Q96S19-3|MTL26_HUMAN	Isoform 3 of Methyltransferase-like 26 OS=Homo sapiens OX=9606 GN=METTL26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.17	43.0	1	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	731-UNIMOD:35	0.02	43.0	3	1	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.21	43.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	203-UNIMOD:4	0.08	43.0	1	1	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.02	43.0	2	2	2
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q9H081|MIS12_HUMAN	Protein MIS12 homolog OS=Homo sapiens OX=9606 GN=MIS12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	104-UNIMOD:4	0.08	42.0	1	1	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	165-UNIMOD:4	0.11	42.0	3	3	3
PRT	sp|Q9NSV4-2|DIAP3_HUMAN	Isoform 2 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	251-UNIMOD:35	0.09	42.0	3	2	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	163-UNIMOD:35,670-UNIMOD:35	0.12	42.0	8	6	4
PRT	sp|Q9H0E9-4|BRD8_HUMAN	Isoform 4 of Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	64-UNIMOD:4	0.02	42.0	1	1	1
PRT	sp|Q15393-3|SF3B3_HUMAN	Isoform 3 of Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	4	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	1369-UNIMOD:35,1373-UNIMOD:35,1379-UNIMOD:4,547-UNIMOD:35,917-UNIMOD:4,931-UNIMOD:4	0.11	42.0	17	14	11
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	441-UNIMOD:35,446-UNIMOD:35	0.06	42.0	5	4	3
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q08257-2|QOR_HUMAN	Isoform 2 of Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.09	42.0	1	1	1
PRT	sp|O43852-12|CALU_HUMAN	Isoform 12 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.31	42.0	1	1	1
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	537-UNIMOD:35,139-UNIMOD:35	0.04	42.0	4	2	0
PRT	sp|O60502-3|OGA_HUMAN	Isoform 3 of Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q9Y5L0-5|TNPO3_HUMAN	Isoform 4 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	380-UNIMOD:4	0.05	42.0	2	2	2
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	160-UNIMOD:4,161-UNIMOD:4,259-UNIMOD:35,42-UNIMOD:35	0.22	42.0	7	6	3
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	235-UNIMOD:35,236-UNIMOD:35,239-UNIMOD:35	0.19	42.0	6	3	1
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	171-UNIMOD:4	0.04	42.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	23-UNIMOD:4,30-UNIMOD:35	0.17	42.0	3	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	47-UNIMOD:35,44-UNIMOD:35,190-UNIMOD:35	0.20	42.0	10	5	2
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	169-UNIMOD:35,177-UNIMOD:4,178-UNIMOD:35,180-UNIMOD:4	0.11	42.0	3	2	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	208-UNIMOD:4,93-UNIMOD:4	0.20	42.0	4	3	2
PRT	sp|O15294-3|OGT1_HUMAN	Isoform 1 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	313-UNIMOD:4	0.03	42.0	2	2	2
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	635-UNIMOD:4	0.03	42.0	2	2	2
PRT	sp|Q9NRX2|RM17_HUMAN	39S ribosomal protein L17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	2	2
PRT	sp|O60716-13|CTND1_HUMAN	Isoform 2A of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	340-UNIMOD:4	0.08	42.0	5	4	3
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|O15020|SPTN2_HUMAN	Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.01	42.0	2	1	0
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null	48-UNIMOD:4,52-UNIMOD:4	0.19	42.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.12	42.0	1	1	1
PRT	sp|P38117|ETFB_HUMAN	Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.11	42.0	2	2	2
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	4	4	4
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	1622-UNIMOD:35,1197-UNIMOD:35	0.06	42.0	8	8	8
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	960-UNIMOD:4,961-UNIMOD:4,767-UNIMOD:4	0.04	42.0	3	3	3
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.04	42.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	580-UNIMOD:35,1827-UNIMOD:4,949-UNIMOD:35,954-UNIMOD:35	0.03	42.0	3	3	3
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	38-UNIMOD:35,827-UNIMOD:35,249-UNIMOD:4	0.04	42.0	4	3	2
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q99615|DNJC7_HUMAN	DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null	317-UNIMOD:4	0.08	42.0	2	2	1
PRT	sp|Q9Y287|ITM2B_HUMAN	Integral membrane protein 2B OS=Homo sapiens OX=9606 GN=ITM2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null	38-UNIMOD:4	0.09	42.0	2	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	338-UNIMOD:35,1256-UNIMOD:35,1263-UNIMOD:35	0.02	41.0	4	4	4
PRT	sp|Q00013-3|EM55_HUMAN	Isoform 3 of 55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	14-UNIMOD:35	0.06	41.0	1	1	1
PRT	sp|Q9H2U2-6|IPYR2_HUMAN	Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.14	41.0	3	2	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P78316-2|NOP14_HUMAN	Isoform 2 of Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	312-UNIMOD:35	0.04	41.0	3	2	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.13	41.0	6	5	4
PRT	sp|Q15435-3|PP1R7_HUMAN	Isoform 3 of Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	3	2	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	284-UNIMOD:4	0.07	41.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2191-UNIMOD:4,746-UNIMOD:35,1157-UNIMOD:4	0.07	41.0	11	11	10
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	541-UNIMOD:35,1178-UNIMOD:35,198-UNIMOD:35	0.06	41.0	10	9	8
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	223-UNIMOD:35	0.08	41.0	2	1	0
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	352-UNIMOD:4,355-UNIMOD:4,37-UNIMOD:4	0.09	41.0	2	2	2
PRT	sp|Q03188-2|CENPC_HUMAN	Isoform 2 of Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q8N983-4|RM43_HUMAN	Isoform 4 of 39S ribosomal protein L43, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL43	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.13	41.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	3	2	1
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P35658-5|NU214_HUMAN	Isoform 5 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1038-UNIMOD:35	0.01	41.0	2	1	0
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	96-UNIMOD:4	0.19	41.0	2	2	2
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	156-UNIMOD:35	0.14	41.0	2	2	2
PRT	sp|Q9Y3Y2-4|CHTOP_HUMAN	Isoform 3 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	193-UNIMOD:35	0.12	41.0	1	1	1
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	145-UNIMOD:35	0.07	41.0	2	1	0
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q9NXH9-2|TRM1_HUMAN	Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	347-UNIMOD:4,355-UNIMOD:4,358-UNIMOD:4	0.06	41.0	3	2	1
PRT	sp|Q9UPY3-2|DICER_HUMAN	Isoform 2 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	2	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|Q04760-2|LGUL_HUMAN	Isoform 2 of Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	124-UNIMOD:4	0.15	41.0	3	2	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	3	3	3
PRT	sp|Q9H0G5|NSRP1_HUMAN	Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=NSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	200-UNIMOD:4	0.03	41.0	1	1	1
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	369-UNIMOD:4	0.08	41.0	2	2	1
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	3	3	3
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	454-UNIMOD:4	0.07	41.0	3	3	3
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	97-UNIMOD:4,116-UNIMOD:4,166-UNIMOD:4	0.12	41.0	3	3	3
PRT	sp|Q8N5K1|CISD2_HUMAN	CDGSH iron-sulfur domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CISD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.13	41.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|P25490|TYY1_HUMAN	Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	166-UNIMOD:35	0.06	41.0	2	2	2
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	515-UNIMOD:35	0.05	40.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	420-UNIMOD:4	0.10	40.0	15	4	3
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.10	40.0	5	4	3
PRT	sp|O94979-6|SC31A_HUMAN	Isoform 6 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	214-UNIMOD:35,216-UNIMOD:4,229-UNIMOD:35	0.05	40.0	3	3	3
PRT	sp|Q14527|HLTF_HUMAN	Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	296-UNIMOD:35	0.06	40.0	3	3	3
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	145-UNIMOD:35	0.08	40.0	4	2	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	4	3	2
PRT	sp|Q9Y3D2|MSRB2_HUMAN	Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	149-UNIMOD:4	0.12	40.0	1	1	1
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	2	1	0
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	396-UNIMOD:35	0.12	40.0	4	3	2
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.05	40.0	3	2	1
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	2	2	2
PRT	sp|O75369-6|FLNB_HUMAN	Isoform 6 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2097-UNIMOD:35,1774-UNIMOD:35,26-UNIMOD:4	0.03	40.0	7	5	3
PRT	sp|Q5T200-2|ZC3HD_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|P51808|DYLT3_HUMAN	Dynein light chain Tctex-type 3 OS=Homo sapiens OX=9606 GN=DYNLT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	8-UNIMOD:4	0.16	40.0	1	1	1
PRT	sp|Q5VWQ0|RSBN1_HUMAN	Lysine-specific demethylase 9 OS=Homo sapiens OX=9606 GN=RSBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P49643|PRI2_HUMAN	DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q96AY3-2|FKB10_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.09	40.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|P07919|QCR6_HUMAN	Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	67-UNIMOD:4	0.21	40.0	2	1	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	348-UNIMOD:4	0.09	40.0	5	3	1
PRT	sp|P49336-2|CDK8_HUMAN	Isoform 2 of Cyclin-dependent kinase 8 OS=Homo sapiens OX=9606 GN=CDK8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	444-UNIMOD:35	0.09	40.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	415-UNIMOD:35,425-UNIMOD:35	0.06	40.0	3	3	3
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	2	2	2
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.05	40.0	3	2	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q7Z6I8|CE024_HUMAN	UPF0461 protein C5orf24 OS=Homo sapiens OX=9606 GN=C5orf24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.16	40.0	3	1	0
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	2	1	0
PRT	sp|P08133|ANXA6_HUMAN	Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	448-UNIMOD:35	0.03	40.0	3	1	0
PRT	sp|Q9Y5Z4|HEBP2_HUMAN	Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.09	40.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	540-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	87-UNIMOD:4	0.13	39.0	2	2	2
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	2	2	2
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	273-UNIMOD:4,283-UNIMOD:4	0.12	39.0	2	2	2
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	250-UNIMOD:4,252-UNIMOD:35	0.04	39.0	3	2	1
PRT	sp|Q9HD26-2|GOPC_HUMAN	Isoform 2 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|O95696|BRD1_HUMAN	Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	2	2
PRT	sp|Q15555-4|MARE2_HUMAN	Isoform 4 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	226-UNIMOD:4	0.08	39.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	96-UNIMOD:4,103-UNIMOD:35,201-UNIMOD:4	0.12	39.0	3	2	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	87-UNIMOD:35,93-UNIMOD:35	0.15	39.0	11	7	4
PRT	sp|P08236-3|BGLR_HUMAN	Isoform 3 of Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P35241-3|RADI_HUMAN	Isoform 3 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|Q9Y2J2-2|E41L3_HUMAN	Isoform 2 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	604-UNIMOD:35	0.05	39.0	3	2	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	302-UNIMOD:35,306-UNIMOD:35	0.05	39.0	3	1	0
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q8IUF8-4|RIOX2_HUMAN	Isoform 4 of Ribosomal oxygenase 2 OS=Homo sapiens OX=9606 GN=RIOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	404-UNIMOD:35,405-UNIMOD:35	0.04	39.0	1	1	1
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	3	3	3
PRT	sp|Q96T51-3|RUFY1_HUMAN	Isoform 3 of RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	320-UNIMOD:4	0.08	39.0	2	2	2
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	759-UNIMOD:35	0.08	39.0	6	6	3
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	12-UNIMOD:4,20-UNIMOD:4	0.03	39.0	2	1	0
PRT	sp|Q7L576|CYFP1_HUMAN	Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	198-UNIMOD:35,212-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	385-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	2	2
PRT	sp|O94806-2|KPCD3_HUMAN	Isoform 2 of Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	2	2	2
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	3	2	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	45-UNIMOD:4	0.02	39.0	3	2	1
PRT	sp|Q01844-2|EWS_HUMAN	Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	324-UNIMOD:35	0.03	39.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.15	39.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1691-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:35,12-UNIMOD:4	0.09	39.0	2	2	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	334-UNIMOD:35,118-UNIMOD:35	0.04	39.0	2	2	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	47-UNIMOD:35,549-UNIMOD:35,557-UNIMOD:35,500-UNIMOD:35	0.14	39.0	8	4	2
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.08	39.0	3	1	0
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	144-UNIMOD:4,145-UNIMOD:4,149-UNIMOD:4	0.10	39.0	1	1	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	2	2	2
PRT	sp|Q9Y3C1|NOP16_HUMAN	Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null		0.16	39.0	2	2	2
PRT	sp|Q14203|DCTN1_HUMAN	Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.04	39.0	3	3	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.19	38.0	2	2	2
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	204-UNIMOD:4,212-UNIMOD:35,214-UNIMOD:4,112-UNIMOD:4	0.17	38.0	3	3	3
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P26440|IVD_HUMAN	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	2	2	2
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|O75113|N4BP1_HUMAN	NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	2	2
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	62-UNIMOD:35,63-UNIMOD:35	0.12	38.0	4	2	1
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P63010-3|AP2B1_HUMAN	Isoform 3 of AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q9NT62-2|ATG3_HUMAN	Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	258-UNIMOD:35,259-UNIMOD:4,264-UNIMOD:4	0.07	38.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q8N2M8-3|CLASR_HUMAN	Isoform 2 of CLK4-associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null		0.02	38.0	3	2	1
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	828-UNIMOD:35	0.02	38.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	4	3	2
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	223-UNIMOD:4,224-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	181-UNIMOD:35	0.13	38.0	2	2	2
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	2	2	2
PRT	sp|Q9HB07|MYG1_HUMAN	MYG1 exonuclease OS=Homo sapiens OX=9606 GN=MYG1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	581-UNIMOD:35	0.06	38.0	3	3	3
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	13-UNIMOD:35	0.10	38.0	3	2	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1382-UNIMOD:35	0.03	38.0	6	5	4
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	34-UNIMOD:4,44-UNIMOD:4,45-UNIMOD:35	0.25	38.0	1	1	1
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9NQ29-2|LUC7L_HUMAN	Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	190-UNIMOD:4,193-UNIMOD:4,43-UNIMOD:4,44-UNIMOD:4	0.11	38.0	2	2	2
PRT	sp|Q9Y6D9|MD1L1_HUMAN	Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	47-UNIMOD:4	0.07	38.0	2	2	2
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q5U5X0|LYRM7_HUMAN	Complex III assembly factor LYRM7 OS=Homo sapiens OX=9606 GN=LYRM7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	97-UNIMOD:4	0.35	38.0	3	2	1
PRT	sp|Q7Z422|SZRD1_HUMAN	SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.15	38.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	2	2	2
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q6P2C8-4|MED27_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 27 OS=Homo sapiens OX=9606 GN=MED27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	1	1	1
PRT	sp|Q9Y3S2|ZN330_HUMAN	Zinc finger protein 330 OS=Homo sapiens OX=9606 GN=ZNF330 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	216-UNIMOD:4,228-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	435-UNIMOD:35,951-UNIMOD:35,964-UNIMOD:35	0.04	37.0	2	2	2
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.18	37.0	3	3	3
PRT	sp|Q86UP2-3|KTN1_HUMAN	Isoform 3 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1105-UNIMOD:35,1113-UNIMOD:4	0.06	37.0	5	5	4
PRT	sp|O95785-3|WIZ_HUMAN	Isoform 3 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P48444-2|COPD_HUMAN	Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	355-UNIMOD:35,357-UNIMOD:4,361-UNIMOD:35	0.06	37.0	3	2	1
PRT	sp|Q9NTK5-3|OLA1_HUMAN	Isoform 3 of Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	225-UNIMOD:35,75-UNIMOD:4	0.13	37.0	2	2	2
PRT	sp|O00330-3|ODPX_HUMAN	Isoform 3 of Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P24539|AT5F1_HUMAN	ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.07	37.0	2	1	0
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	1	1	1
PRT	sp|Q9P016-2|THYN1_HUMAN	Isoform 2 of Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1046-UNIMOD:35,1047-UNIMOD:35,16-UNIMOD:4,1470-UNIMOD:35,1479-UNIMOD:35	0.03	37.0	6	4	2
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	2	2	2
PRT	sp|Q9BYV8|CEP41_HUMAN	Centrosomal protein of 41 kDa OS=Homo sapiens OX=9606 GN=CEP41 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	2	1	0
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	462-UNIMOD:4	0.09	37.0	3	3	3
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	750-UNIMOD:4	0.03	37.0	2	2	2
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	306-UNIMOD:4	0.07	37.0	4	3	2
PRT	sp|O43683-2|BUB1_HUMAN	Isoform 2 of Mitotic checkpoint serine/threonine-protein kinase BUB1 OS=Homo sapiens OX=9606 GN=BUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q15369-2|ELOC_HUMAN	Isoform 2 of Elongin-C OS=Homo sapiens OX=9606 GN=ELOC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	3	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	46-UNIMOD:35	0.12	37.0	2	2	2
PRT	sp|O15381-5|NVL_HUMAN	Isoform 5 of Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	0
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	413-UNIMOD:35	0.02	37.0	2	1	0
PRT	sp|Q4VC31|CCD58_HUMAN	Coiled-coil domain-containing protein 58 OS=Homo sapiens OX=9606 GN=CCDC58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	61-UNIMOD:35	0.27	37.0	2	2	2
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	403-UNIMOD:35	0.07	37.0	5	5	5
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	125-UNIMOD:4	0.06	37.0	1	1	0
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	809-UNIMOD:4	0.03	37.0	2	2	2
PRT	sp|P62318-2|SMD3_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	20-UNIMOD:4	0.18	37.0	2	1	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	457-UNIMOD:4	0.02	37.0	1	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	2202-UNIMOD:4	0.04	37.0	9	6	4
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:4,90-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q99986|VRK1_HUMAN	Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	3015-UNIMOD:4	0.02	37.0	3	3	3
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:4,81-UNIMOD:4,84-UNIMOD:4,40-UNIMOD:4,50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.26	37.0	3	3	3
PRT	sp|Q96EL3|RM53_HUMAN	39S ribosomal protein L53, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL53 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	63-UNIMOD:4	0.31	37.0	2	2	2
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q96L92-3|SNX27_HUMAN	Isoform 2 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	162-UNIMOD:4	0.19	37.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	575-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q9Y5B6|PAXB1_HUMAN	PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	899-UNIMOD:35	0.04	37.0	3	2	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.19	37.0	4	3	2
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|Q9Y608-2|LRRF2_HUMAN	Isoform 2 of Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	375-UNIMOD:35,377-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1140-UNIMOD:35	0.02	37.0	2	2	2
PRT	sp|O15226|NKRF_HUMAN	NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	386-UNIMOD:4	0.05	37.0	2	2	2
PRT	sp|Q68E01-3|INT3_HUMAN	Isoform 3 of Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P23378|GCSP_HUMAN	Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	947-UNIMOD:35,954-UNIMOD:4	0.05	37.0	3	3	3
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	169-UNIMOD:35,177-UNIMOD:4,178-UNIMOD:35,180-UNIMOD:4,216-UNIMOD:35	0.10	37.0	3	2	0
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null		0.06	37.0	3	1	0
PRT	sp|P63165|SUMO1_HUMAN	Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.15	37.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	589-UNIMOD:35	0.04	37.0	3	2	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	344-UNIMOD:35	0.05	37.0	3	2	1
PRT	sp|Q9BSJ5|CQ080_HUMAN	Uncharacterized protein C17orf80 OS=Homo sapiens OX=9606 GN=C17orf80 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	466-UNIMOD:35	0.05	37.0	2	2	2
PRT	sp|Q9NUD5-2|ZCHC3_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	30-UNIMOD:35,33-UNIMOD:4	0.11	36.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	905-UNIMOD:35	0.02	36.0	2	2	2
PRT	sp|Q8TBA6-2|GOGA5_HUMAN	Isoform 2 of Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	208-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9UJ83-3|HACL1_HUMAN	Isoform 3 of 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens OX=9606 GN=HACL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q7Z7K6-3|CENPV_HUMAN	Isoform 3 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|O00291-3|HIP1_HUMAN	Isoform 3 of Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	247-UNIMOD:35,254-UNIMOD:4,141-UNIMOD:35	0.05	36.0	6	4	3
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	107-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|Q99549|MPP8_HUMAN	M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	58-UNIMOD:4	0.14	36.0	3	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	290-UNIMOD:4	0.09	36.0	2	2	2
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	18-UNIMOD:4	0.19	36.0	5	5	5
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	0
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q6NZY4|ZCHC8_HUMAN	Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	607-UNIMOD:4	0.05	36.0	2	2	2
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:4,79-UNIMOD:35	0.20	36.0	3	2	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	2	2
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	697-UNIMOD:35	0.04	36.0	2	2	2
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	224-UNIMOD:35	0.11	36.0	2	2	2
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	2	2
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	2	2
PRT	sp|Q9Y448-3|SKAP_HUMAN	Isoform 3 of Small kinetochore-associated protein OS=Homo sapiens OX=9606 GN=KNSTRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	308-UNIMOD:4,309-UNIMOD:35	0.05	36.0	2	1	0
PRT	sp|P20933|ASPG_HUMAN	N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase OS=Homo sapiens OX=9606 GN=AGA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	25-UNIMOD:35	0.32	36.0	4	2	1
PRT	sp|O00471|EXOC5_HUMAN	Exocyst complex component 5 OS=Homo sapiens OX=9606 GN=EXOC5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	111-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	400-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q92547|TOPB1_HUMAN	DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q86YM7-3|HOME1_HUMAN	Isoform 3 of Homer protein homolog 1 OS=Homo sapiens OX=9606 GN=HOMER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.10	36.0	1	1	1
PRT	sp|Q9Y5U2-2|TSSC4_HUMAN	Isoform 2 of Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	52-UNIMOD:35	0.07	36.0	1	1	1
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	183-UNIMOD:35	0.13	36.0	4	2	1
PRT	sp|Q8N3C0|ASCC3_HUMAN	Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	786-UNIMOD:35	0.01	36.0	3	2	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	4	2	0
PRT	sp|Q13613|MTMR1_HUMAN	Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q92878|RAD50_HUMAN	DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	3	3	3
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	174-UNIMOD:35	0.11	36.0	2	2	2
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	340-UNIMOD:4,343-UNIMOD:4	0.06	36.0	3	2	1
PRT	sp|Q9NWZ8|GEMI8_HUMAN	Gem-associated protein 8 OS=Homo sapiens OX=9606 GN=GEMIN8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	180-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q15126|PMVK_HUMAN	Phosphomevalonate kinase OS=Homo sapiens OX=9606 GN=PMVK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.10	36.0	1	1	1
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	143-UNIMOD:35,158-UNIMOD:4,150-UNIMOD:35	0.15	36.0	3	2	1
PRT	sp|Q15334|L2GL1_HUMAN	Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1059-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	304-UNIMOD:4	0.08	36.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	191-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.11	36.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	66-UNIMOD:4,74-UNIMOD:4,144-UNIMOD:35	0.33	36.0	6	4	2
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	287-UNIMOD:35	0.10	36.0	2	2	2
PRT	sp|Q9H5K3|SG196_HUMAN	Protein O-mannose kinase OS=Homo sapiens OX=9606 GN=POMK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	55-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	230-UNIMOD:4,114-UNIMOD:4	0.09	36.0	2	2	2
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	2	2
PRT	sp|Q9NQT5|EXOS3_HUMAN	Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	534-UNIMOD:35	0.03	36.0	1	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	179-UNIMOD:4,185-UNIMOD:35	0.05	36.0	1	1	0
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	69-UNIMOD:35	0.04	36.0	2	2	2
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P36957-2|ODO2_HUMAN	Isoform 2 of Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	74-UNIMOD:35,80-UNIMOD:35	0.18	36.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	412-UNIMOD:4,466-UNIMOD:35	0.07	36.0	4	3	2
PRT	sp|P98175|RBM10_HUMAN	RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P58317|ZN121_HUMAN	Zinc finger protein 121 OS=Homo sapiens OX=9606 GN=ZNF121 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9GZT4|SRR_HUMAN	Serine racemase OS=Homo sapiens OX=9606 GN=SRR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	71-UNIMOD:4	0.09	35.0	1	1	1
PRT	sp|Q9NZ45|CISD1_HUMAN	CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CISD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	62-UNIMOD:35	0.17	35.0	2	1	0
PRT	sp|P09601|HMOX1_HUMAN	Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:35	0.13	35.0	2	2	2
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1558-UNIMOD:35,1562-UNIMOD:4	0.01	35.0	1	1	0
PRT	sp|Q9NXV2|KCTD5_HUMAN	BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	3	2	1
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	2	2	2
PRT	sp|Q9NX55-3|HYPK_HUMAN	Isoform 3 of Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.22	35.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1841-UNIMOD:35	0.01	35.0	4	2	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	2	2
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P60002|ELOF1_HUMAN	Transcription elongation factor 1 homolog OS=Homo sapiens OX=9606 GN=ELOF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	26-UNIMOD:4,29-UNIMOD:4,16-UNIMOD:35	0.24	35.0	2	1	0
PRT	sp|O76071|CIAO1_HUMAN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	97-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|Q9H8M2-2|BRD9_HUMAN	Isoform 2 of Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	161-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.12	35.0	3	2	1
PRT	sp|Q96KA5-2|CLP1L_HUMAN	Isoform 2 of Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens OX=9606 GN=CLPTM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P13984|T2FB_HUMAN	General transcription factor IIF subunit 2 OS=Homo sapiens OX=9606 GN=GTF2F2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	2	2	2
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.12	35.0	4	4	4
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	2	2
PRT	sp|Q99614|TTC1_HUMAN	Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	421-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	494-UNIMOD:35,22-UNIMOD:35	0.03	35.0	4	2	0
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	353-UNIMOD:4,356-UNIMOD:4	0.03	35.0	3	3	3
PRT	sp|P18583-6|SON_HUMAN	Isoform E of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P33981-2|TTK_HUMAN	Isoform 2 of Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	2	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:4	0.08	35.0	2	2	2
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	3	3	3
PRT	sp|Q14781|CBX2_HUMAN	Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9H1K1|ISCU_HUMAN	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens OX=9606 GN=ISCU PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	2	1	0
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:35	0.12	35.0	3	1	0
PRT	sp|Q02241-3|KIF23_HUMAN	Isoform 3 of Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q6P9B9|INT5_HUMAN	Integrator complex subunit 5 OS=Homo sapiens OX=9606 GN=INTS5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.08	35.0	1	1	1
PRT	sp|P49750-3|YLPM1_HUMAN	Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:35	0.02	35.0	2	2	2
PRT	sp|Q99805|TM9S2_HUMAN	Transmembrane 9 superfamily member 2 OS=Homo sapiens OX=9606 GN=TM9SF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	174-UNIMOD:4,182-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	333-UNIMOD:35,340-UNIMOD:35	0.05	35.0	2	1	0
PRT	sp|A8CG34|P121C_HUMAN	Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|P98172|EFNB1_HUMAN	Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	218-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q9NRN7|ADPPT_HUMAN	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	2	2	2
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	870-UNIMOD:4	0.04	35.0	4	4	4
PRT	sp|Q8N4P3-2|MESH1_HUMAN	Isoform 2 of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	1	1	1
PRT	sp|Q14135-2|VGLL4_HUMAN	Isoform 2 of Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	29-UNIMOD:35,38-UNIMOD:4	0.08	35.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	4030-UNIMOD:4,1408-UNIMOD:35,703-UNIMOD:4	0.02	35.0	4	4	4
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	2	2	2
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	558-UNIMOD:35	0.03	35.0	2	2	0
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	477-UNIMOD:35	0.05	35.0	3	3	3
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	342-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	38-UNIMOD:35	0.15	35.0	2	2	2
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	460-UNIMOD:4,105-UNIMOD:35	0.07	35.0	3	2	1
PRT	sp|Q9P0P0|RN181_HUMAN	E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens OX=9606 GN=RNF181 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	2	1	0
PRT	sp|Q05682-4|CALD1_HUMAN	Isoform 4 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	45-UNIMOD:35	0.10	35.0	2	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	321-UNIMOD:35	0.06	35.0	5	2	0
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	118-UNIMOD:35	0.05	35.0	3	2	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	281-UNIMOD:4,139-UNIMOD:35	0.20	35.0	8	6	4
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	199-UNIMOD:4	0.13	35.0	3	2	1
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	480-UNIMOD:35,492-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	759-UNIMOD:35,763-UNIMOD:35	0.04	35.0	2	2	2
PRT	sp|Q12800-3|TFCP2_HUMAN	Isoform 3 of Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	440-UNIMOD:35	0.04	34.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	2447-UNIMOD:35,1999-UNIMOD:4,3256-UNIMOD:35	0.02	34.0	7	5	3
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	587-UNIMOD:35	0.03	34.0	3	2	1
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	0
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	341-UNIMOD:4,343-UNIMOD:35	0.03	34.0	2	2	2
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	2	2	2
PRT	sp|O00584|RNT2_HUMAN	Ribonuclease T2 OS=Homo sapiens OX=9606 GN=RNASET2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	121-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q6UXN9|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9GZT8-3|NIF3L_HUMAN	Isoform 3 of NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	2	2
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9H497-3|TOR3A_HUMAN	Isoform 3 of Torsin-3A OS=Homo sapiens OX=9606 GN=TOR3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q15833-2|STXB2_HUMAN	Isoform 2 of Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q96HY7|DHTK1_HUMAN	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Homo sapiens OX=9606 GN=DHTKD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	495-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.16	34.0	2	2	2
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	174-UNIMOD:35	0.06	34.0	4	3	2
PRT	sp|O60678-2|ANM3_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	124-UNIMOD:35,133-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|Q8WWK9-4|CKAP2_HUMAN	Isoform 2 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9UEG4|ZN629_HUMAN	Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	3	3	3
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	742-UNIMOD:4,751-UNIMOD:35	0.04	34.0	3	3	3
PRT	sp|Q15648-3|MED1_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	135-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|A0MZ66-2|SHOT1_HUMAN	Isoform 2 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O15344-2|TRI18_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.14	34.0	7	3	0
PRT	sp|P07738|PMGE_HUMAN	Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:4,60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.15	34.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null		0.17	34.0	6	2	0
PRT	sp|Q96RU2-2|UBP28_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|P51397|DAP1_HUMAN	Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	24-UNIMOD:35	0.30	34.0	2	2	2
PRT	sp|Q9BTE3-3|MCMBP_HUMAN	Isoform 3 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.15	34.0	2	2	2
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|O60573-2|IF4E2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	190-UNIMOD:4,193-UNIMOD:35	0.03	34.0	3	2	1
PRT	sp|Q9UGV2-2|NDRG3_HUMAN	Isoform 2 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|A8MXV4|NUD19_HUMAN	Nucleoside diphosphate-linked moiety X motif 19 OS=Homo sapiens OX=9606 GN=NUDT19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	56-UNIMOD:35	0.11	34.0	2	2	2
PRT	sp|Q9Y276|BCS1_HUMAN	Mitochondrial chaperone BCS1 OS=Homo sapiens OX=9606 GN=BCS1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	27-UNIMOD:35	0.12	34.0	3	3	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	4	2	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.14	34.0	1	1	1
PRT	sp|Q15398|DLGP5_HUMAN	Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	460-UNIMOD:4	0.03	34.0	2	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	2	2
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	30-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|Q70UQ0-4|IKIP_HUMAN	Isoform 4 of Inhibitor of nuclear factor kappa-B kinase-interacting protein OS=Homo sapiens OX=9606 GN=IKBIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	2	2	2
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	115-UNIMOD:35	0.09	33.0	3	2	1
PRT	sp|P23634-5|AT2B4_HUMAN	Isoform ZK of Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.11	33.0	1	1	1
PRT	sp|Q96SI9-2|STRBP_HUMAN	Isoform 2 of Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	139-UNIMOD:4,39-UNIMOD:4	0.17	33.0	2	2	2
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:35,115-UNIMOD:4	0.33	33.0	3	3	3
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	913-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|Q9NVI7-3|ATD3A_HUMAN	Isoform 3 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	292-UNIMOD:35,297-UNIMOD:35,305-UNIMOD:35	0.05	33.0	1	1	1
PRT	sp|Q3SXY8-2|AR13B_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 13B OS=Homo sapiens OX=9606 GN=ARL13B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	63-UNIMOD:35,64-UNIMOD:35	0.10	33.0	5	2	0
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	143-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	187-UNIMOD:4,190-UNIMOD:4	0.05	33.0	3	3	3
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	579-UNIMOD:35,581-UNIMOD:35,588-UNIMOD:4	0.06	33.0	2	2	2
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	40-UNIMOD:4,41-UNIMOD:4	0.06	33.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9Y3P9-3|RBGP1_HUMAN	Isoform 3 of Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	2	2
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8IX12-2|CCAR1_HUMAN	Isoform 2 of Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1107-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P28838-2|AMPL_HUMAN	Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	455-UNIMOD:35	0.07	33.0	2	2	2
PRT	sp|A5YKK6-3|CNOT1_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1826-UNIMOD:35,1827-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	374-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P36551|HEM6_HUMAN	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=CPOX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9GZT3-2|SLIRP_HUMAN	Isoform 2 of SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	48-UNIMOD:4	0.13	33.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	290-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9NUQ9|CYRIB_HUMAN	CYFIP-related Rac1 interactor B OS=Homo sapiens OX=9606 GN=CYRIB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	352-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P14735-2|IDE_HUMAN	Isoform 2 of Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	572-UNIMOD:4	0.02	33.0	2	2	2
PRT	sp|P07099|HYEP_HUMAN	Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	309-UNIMOD:35	0.08	33.0	3	2	1
PRT	sp|Q8WZ82|OVCA2_HUMAN	Esterase OVCA2 OS=Homo sapiens OX=9606 GN=OVCA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	41-UNIMOD:4	0.11	33.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	57-UNIMOD:4	0.06	33.0	2	1	0
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	3	2	1
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|O75475-2|PSIP1_HUMAN	Isoform 2 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	322-UNIMOD:35,330-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	503-UNIMOD:35	0.02	33.0	3	3	3
PRT	sp|P15735-2|PHKG2_HUMAN	Isoform 2 of Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens OX=9606 GN=PHKG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	176-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q8NB46|ANR52_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	876-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q8NI36|WDR36_HUMAN	WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9UJX6-2|ANC2_HUMAN	Isoform 2 of Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	3	3
PRT	sp|Q9UBP6|TRMB_HUMAN	tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.30	33.0	3	2	1
PRT	sp|P24941-2|CDK2_HUMAN	Isoform 2 of Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	232-UNIMOD:35	0.06	33.0	2	1	0
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	2	2	2
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	2	2
PRT	sp|O43395-3|PRPF3_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	0
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	3	3
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	3	2	1
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	286-UNIMOD:35,205-UNIMOD:4,289-UNIMOD:35,88-UNIMOD:35,91-UNIMOD:35	0.19	33.0	8	3	2
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	4	2	1
PRT	sp|Q96DT7|ZBT10_HUMAN	Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	0
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	589-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|P34949|MPI_HUMAN	Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	157-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	214-UNIMOD:35	0.07	33.0	4	3	2
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q6PJT7|ZC3HE_HUMAN	Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	488-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	163-UNIMOD:35,641-UNIMOD:35	0.05	33.0	4	3	2
PRT	sp|Q96HA1|P121A_HUMAN	Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9BTX1|NDC1_HUMAN	Nucleoporin NDC1 OS=Homo sapiens OX=9606 GN=NDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	420-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	879-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q96IY1|NSL1_HUMAN	Kinetochore-associated protein NSL1 homolog OS=Homo sapiens OX=9606 GN=NSL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.20	33.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	224-UNIMOD:4,236-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	301-UNIMOD:35	0.02	32.0	2	2	2
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	176-UNIMOD:4,177-UNIMOD:4	0.24	32.0	4	3	2
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	234-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P04179-3|SODM_HUMAN	Isoform 3 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.16	32.0	1	1	1
PRT	sp|Q00765|REEP5_HUMAN	Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	152-UNIMOD:35	0.07	32.0	2	1	0
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	309-UNIMOD:35	0.05	32.0	1	1	1
PRT	sp|P56589|PEX3_HUMAN	Peroxisomal biogenesis factor 3 OS=Homo sapiens OX=9606 GN=PEX3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P53367|ARFP1_HUMAN	Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	139-UNIMOD:4,146-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q9NPE3|NOP10_HUMAN	H/ACA ribonucleoprotein complex subunit 3 OS=Homo sapiens OX=9606 GN=NOP10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	28-UNIMOD:4,23-UNIMOD:35	0.27	32.0	3	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	53-UNIMOD:35	0.14	32.0	2	2	2
PRT	sp|O43813|LANC1_HUMAN	Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	252-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q96BR1-2|SGK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase Sgk3 OS=Homo sapiens OX=9606 GN=SGK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1027-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q92688-2|AN32B_HUMAN	Isoform 2 of Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens OX=9606 GN=ANP32B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	0
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P35998-2|PRS7_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P26374|RAE2_HUMAN	Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens OX=9606 GN=CHML PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9BPY3|F118B_HUMAN	Protein FAM118B OS=Homo sapiens OX=9606 GN=FAM118B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q68EM7-2|RHG17_HUMAN	Isoform 2 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q12981-2|SEC20_HUMAN	Isoform 2 of Vesicle transport protein SEC20 OS=Homo sapiens OX=9606 GN=BNIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|O00233-2|PSMD9_HUMAN	Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1500-UNIMOD:35	0.04	32.0	9	4	2
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:35	0.10	32.0	3	2	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.35	32.0	3	2	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	725-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|O75380|NDUS6_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	186-UNIMOD:4,187-UNIMOD:35	0.18	32.0	4	3	2
PRT	sp|Q4G0I0|CSMT1_HUMAN	Protein CCSMST1 OS=Homo sapiens OX=9606 GN=CCSMST1 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.17	32.0	2	1	0
PRT	sp|O96028-6|NSD2_HUMAN	Isoform 6 of Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	406-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q13043-2|STK4_HUMAN	Isoform 2 of Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	527-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|O15121|DEGS1_HUMAN	Sphingolipid delta(4)-desaturase DES1 OS=Homo sapiens OX=9606 GN=DEGS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O75616|ERAL1_HUMAN	GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	2	2
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	828-UNIMOD:35,830-UNIMOD:35	0.02	32.0	6	1	0
PRT	sp|Q86UA1|PRP39_HUMAN	Pre-mRNA-processing factor 39 OS=Homo sapiens OX=9606 GN=PRPF39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	62-UNIMOD:4,64-UNIMOD:4,497-UNIMOD:35,445-UNIMOD:35	0.10	32.0	5	4	3
PRT	sp|Q969V3-2|NCLN_HUMAN	Isoform 2 of Nicalin OS=Homo sapiens OX=9606 GN=NCLN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9UBL3-2|ASH2L_HUMAN	Isoform 2 of Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	0
PRT	sp|O94864-2|ST65G_HUMAN	Isoform 2 of STAGA complex 65 subunit gamma OS=Homo sapiens OX=9606 GN=SUPT7L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q2VIR3-2|IF2GL_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|Q8N6M0-2|OTU6B_HUMAN	Isoform 2 of Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	57-UNIMOD:4,58-UNIMOD:35	0.09	32.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	27-UNIMOD:35	0.08	32.0	6	5	4
PRT	sp|Q5TDH0-2|DDI2_HUMAN	Isoform 2 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.15	32.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	615-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	3	2	1
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	271-UNIMOD:35	0.07	32.0	3	1	0
PRT	sp|Q9NUQ7|UFSP2_HUMAN	Ufm1-specific protease 2 OS=Homo sapiens OX=9606 GN=UFSP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	2	2
PRT	sp|P07197|NFM_HUMAN	Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	285-UNIMOD:35	0.04	32.0	2	2	2
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	736-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	734-UNIMOD:35	0.04	32.0	4	2	1
PRT	sp|Q96HC4-3|PDLI5_HUMAN	Isoform 3 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	46-UNIMOD:35,49-UNIMOD:35	0.06	32.0	2	1	0
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	626-UNIMOD:35	0.02	32.0	1	1	0
PRT	sp|O95983|MBD3_HUMAN	Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q06787|FMR1_HUMAN	Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q14457|BECN1_HUMAN	Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|Q9Y512|SAM50_HUMAN	Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q92581|SL9A6_HUMAN	Sodium/hydrogen exchanger 6 OS=Homo sapiens OX=9606 GN=SLC9A6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P42684|ABL2_HUMAN	Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	206-UNIMOD:35	0.06	32.0	1	1	1
PRT	sp|P51572|BAP31_HUMAN	B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	89-UNIMOD:35,94-UNIMOD:35	0.15	32.0	2	2	2
PRT	sp|Q9UIF9|BAZ2A_HUMAN	Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	321-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	366-UNIMOD:4	0.09	32.0	4	3	2
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	266-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q6PD74-2|AAGAB_HUMAN	Isoform 2 of Alpha- and gamma-adaptin-binding protein p34 OS=Homo sapiens OX=9606 GN=AAGAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q14554|PDIA5_HUMAN	Protein disulfide-isomerase A5 OS=Homo sapiens OX=9606 GN=PDIA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O15126-2|SCAM1_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	5	2	1
PRT	sp|P40855-5|PEX19_HUMAN	Isoform 5 of Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	0
PRT	sp|O43674-2|NDUB5_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	157-UNIMOD:35	0.07	31.0	2	2	2
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	4763-UNIMOD:35	0.01	31.0	2	2	2
PRT	sp|Q6NVY1-2|HIBCH_HUMAN	Isoform 2 of 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|O95989|NUDT3_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q96HN2-4|SAHH3_HUMAN	Isoform 4 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	535-UNIMOD:35	0.05	31.0	3	3	3
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O75323|NIPS2_HUMAN	Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|O60551|NMT2_HUMAN	Glycylpeptide N-tetradecanoyltransferase 2 OS=Homo sapiens OX=9606 GN=NMT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	410-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q15050|RRS1_HUMAN	Ribosome biogenesis regulatory protein homolog OS=Homo sapiens OX=9606 GN=RRS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	199-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|O75487|GPC4_HUMAN	Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P49448|DHE4_HUMAN	Glutamate dehydrogenase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	112-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	2	2	2
PRT	sp|O00425|IF2B3_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	3	3	2
PRT	sp|Q16625-6|OCLN_HUMAN	Isoform 6 of Occludin OS=Homo sapiens OX=9606 GN=OCLN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	33-UNIMOD:35	0.28	31.0	1	1	1
PRT	sp|Q7KZI7-13|MARK2_HUMAN	Isoform 13 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q9BPX6-2|MICU1_HUMAN	Isoform 2 of Calcium uptake protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MICU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	3	3	3
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1225-UNIMOD:35	0.02	31.0	2	2	2
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q96TA2-3|YMEL1_HUMAN	Isoform 3 of ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|O00764-3|PDXK_HUMAN	Isoform 3 of Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	2	2
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	486-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	304-UNIMOD:35	0.03	31.0	2	1	0
PRT	sp|Q9H9Y6-5|RPA2_HUMAN	Isoform 5 of DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens OX=9606 GN=POLR1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P10253|LYAG_HUMAN	Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	427-UNIMOD:35	0.03	31.0	3	2	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	206-UNIMOD:4,57-UNIMOD:35,66-UNIMOD:4	0.14	31.0	2	2	2
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P22570-4|ADRO_HUMAN	Isoform 4 of NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P11802-2|CDK4_HUMAN	Isoform 2 of Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	15-UNIMOD:4	0.08	31.0	1	1	1
PRT	sp|P29372-5|3MG_HUMAN	Isoform 4 of DNA-3-methyladenine glycosylase OS=Homo sapiens OX=9606 GN=MPG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q53HL2|BOREA_HUMAN	Borealin OS=Homo sapiens OX=9606 GN=CDCA8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	585-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q969Z0-2|FAKD4_HUMAN	Isoform 2 of FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	2	2
PRT	sp|Q9NVU0-3|RPC5_HUMAN	Isoform 3 of DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9HCE1-2|MOV10_HUMAN	Isoform 2 of Helicase MOV-10 OS=Homo sapiens OX=9606 GN=MOV10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	782-UNIMOD:35	0.04	31.0	2	2	2
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	43-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|O75351|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	2	2
PRT	sp|Q9NPI1|BRD7_HUMAN	Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	107-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P57740-3|NU107_HUMAN	Isoform 3 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:35,86-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O95861|BPNT1_HUMAN	3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	249-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9H0E9|BRD8_HUMAN	Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|Q9GZR2|REXO4_HUMAN	RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	362-UNIMOD:35	0.06	31.0	2	2	2
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	2	1	0
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.15	31.0	1	1	1
PRT	sp|Q8NCM8|DYHC2_HUMAN	Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	3	2	1
PRT	sp|O75935|DCTN3_HUMAN	Dynactin subunit 3 OS=Homo sapiens OX=9606 GN=DCTN3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.24	31.0	1	1	1
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	208-UNIMOD:4	0.10	30.0	3	3	3
PRT	sp|Q9NSD9|SYFB_HUMAN	Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.08	30.0	2	2	2
PRT	sp|Q10567-4|AP1B1_HUMAN	Isoform 4 of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	900-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.15	30.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.15	30.0	2	2	2
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	2	2
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	0
PRT	sp|Q9P032|NDUF4_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 OS=Homo sapiens OX=9606 GN=NDUFAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	2	1	0
PRT	sp|Q96SB3|NEB2_HUMAN	Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	57-UNIMOD:35,63-UNIMOD:4	0.09	30.0	3	1	0
PRT	sp|Q92558|WASF1_HUMAN	Wiskott-Aldrich syndrome protein family member 1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q0VDG4-2|SCRN3_HUMAN	Isoform 2 of Secernin-3 OS=Homo sapiens OX=9606 GN=SCRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q04637-3|IF4G1_HUMAN	Isoform B of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	952-UNIMOD:35	0.01	30.0	2	2	2
PRT	sp|Q8IZD4-2|DCP1B_HUMAN	Isoform 2 of mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	271-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	696-UNIMOD:35,102-UNIMOD:35	0.02	30.0	3	2	1
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|P32322-2|P5CR1_HUMAN	Isoform 2 of Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	216-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	2	2
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	351-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P82912-2|RT11_HUMAN	Isoform 2 of 28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	2	2	1
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q9P021|CRIPT_HUMAN	Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	73-UNIMOD:4,76-UNIMOD:4	0.35	30.0	2	2	2
PRT	sp|Q9Y6Q5|AP1M2_HUMAN	AP-1 complex subunit mu-2 OS=Homo sapiens OX=9606 GN=AP1M2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	241-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1718-UNIMOD:4	0.00	30.0	1	1	1
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	53-UNIMOD:35	0.06	30.0	2	1	0
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	375-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	2	2	2
PRT	sp|P61457|PHS_HUMAN	Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	82-UNIMOD:4	0.16	30.0	1	1	1
PRT	sp|Q6P4Q7-2|CNNM4_HUMAN	Isoform 2 of Metal transporter CNNM4 OS=Homo sapiens OX=9606 GN=CNNM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	2	2
PRT	sp|Q9Y291|RT33_HUMAN	28S ribosomal protein S33, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS33 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:35	0.12	30.0	1	1	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.10	30.0	4	3	2
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:35	0.07	30.0	2	1	0
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1261-UNIMOD:4	0.03	30.0	3	3	3
PRT	sp|O75794|CD123_HUMAN	Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q96P16-3|RPR1A_HUMAN	Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	264-UNIMOD:35	0.08	30.0	1	1	1
PRT	sp|P36954|RPB9_HUMAN	DNA-directed RNA polymerase II subunit RPB9 OS=Homo sapiens OX=9606 GN=POLR2I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:4,119-UNIMOD:4	0.11	30.0	1	1	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	326-UNIMOD:35	0.10	30.0	7	4	2
PRT	sp|P29558-2|RBMS1_HUMAN	Isoform 2 of RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:35,194-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q15208|STK38_HUMAN	Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	262-UNIMOD:35	0.08	30.0	2	2	2
PRT	sp|Q96T23-2|RSF1_HUMAN	Isoform 2 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P55265-3|DSRAD_HUMAN	Isoform 3 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P05549-2|AP2A_HUMAN	Isoform 4 of Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	154-UNIMOD:4,157-UNIMOD:35	0.09	30.0	2	2	2
PRT	sp|Q5BJD5-3|TM41B_HUMAN	Isoform 3 of Transmembrane protein 41B OS=Homo sapiens OX=9606 GN=TMEM41B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.16	30.0	1	1	1
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|A6NDY0-2|EPAB2_HUMAN	Isoform 2 of Embryonic polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	180-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1030-UNIMOD:35	0.04	30.0	4	3	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	58-UNIMOD:4	0.11	30.0	2	2	1
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|O75909|CCNK_HUMAN	Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	265-UNIMOD:35	0.08	30.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q9NS87|KIF15_HUMAN	Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	162-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|P78536|ADA17_HUMAN	Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	423-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	153-UNIMOD:35	0.06	30.0	2	2	2
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	101-UNIMOD:4,106-UNIMOD:4	0.08	30.0	2	1	0
PRT	sp|Q9H3C7|GGNB2_HUMAN	Gametogenetin-binding protein 2 OS=Homo sapiens OX=9606 GN=GGNBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	3	3	3
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	725-UNIMOD:4,726-UNIMOD:4,708-UNIMOD:4	0.02	29.0	2	2	2
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	3	2	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	950-UNIMOD:4,324-UNIMOD:4	0.02	29.0	2	2	2
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	282-UNIMOD:4,292-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q9NZW5|MPP6_HUMAN	MAGUK p55 subfamily member 6 OS=Homo sapiens OX=9606 GN=MPP6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	222-UNIMOD:4,236-UNIMOD:4	0.07	29.0	2	2	2
PRT	sp|Q9UBQ5-2|EIF3K_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:4,88-UNIMOD:35	0.07	29.0	2	1	0
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	181-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|Q7L5Y9-5|MAEA_HUMAN	Isoform 5 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P23786|CPT2_HUMAN	Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9NUG6|PDRG1_HUMAN	p53 and DNA damage-regulated protein 1 OS=Homo sapiens OX=9606 GN=PDRG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	76-UNIMOD:35	0.10	29.0	1	1	1
PRT	sp|Q8TBZ6|TM10A_HUMAN	tRNA methyltransferase 10 homolog A OS=Homo sapiens OX=9606 GN=TRMT10A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q5VW32-2|BROX_HUMAN	Isoform 2 of BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q58FG0|HS905_HUMAN	Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q12979-4|ABR_HUMAN	Isoform 4 of Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	58-UNIMOD:35,35-UNIMOD:4	0.19	29.0	3	2	1
PRT	sp|Q9NVQ4|FAIM1_HUMAN	Fas apoptotic inhibitory molecule 1 OS=Homo sapiens OX=9606 GN=FAIM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|A0FGR8-4|ESYT2_HUMAN	Isoform 4 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	360-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q8N9N7|LRC57_HUMAN	Leucine-rich repeat-containing protein 57 OS=Homo sapiens OX=9606 GN=LRRC57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q9HA64|KT3K_HUMAN	Ketosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3KRP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q02750-2|MP2K1_HUMAN	Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	330-UNIMOD:35	0.06	29.0	2	2	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	117-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O14965|AURKA_HUMAN	Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	393-UNIMOD:4	0.09	29.0	2	2	2
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	60-UNIMOD:35,63-UNIMOD:35	0.42	29.0	5	5	5
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	2	2
PRT	sp|P37840-2|SYUA_HUMAN	Isoform 2-4 of Alpha-synuclein OS=Homo sapiens OX=9606 GN=SNCA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.14	29.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	3	3	3
PRT	sp|Q96DH6-2|MSI2H_HUMAN	Isoform 2 of RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|P35813|PPM1A_HUMAN	Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	71-UNIMOD:4,72-UNIMOD:4,334-UNIMOD:35	0.09	29.0	2	2	2
PRT	sp|P15121|ALDR_HUMAN	Aldo-keto reductase family 1 member B1 OS=Homo sapiens OX=9606 GN=AKR1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	187-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q8IXQ3|CI040_HUMAN	Uncharacterized protein C9orf40 OS=Homo sapiens OX=9606 GN=C9orf40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q8TCG1-2|CIP2A_HUMAN	Isoform 2 of Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	56-UNIMOD:35	0.11	29.0	3	1	0
PRT	sp|O96013-2|PAK4_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	618-UNIMOD:35	0.02	29.0	1	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null		0.12	29.0	4	4	4
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	4	4	4
PRT	sp|Q96RP9|EFGM_HUMAN	Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	618-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	106-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	4	3	2
PRT	sp|Q8NFP7|NUD10_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens OX=9606 GN=NUDT10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q5NDL2-2|EOGT_HUMAN	Isoform 2 of EGF domain-specific O-linked N-acetylglucosamine transferase OS=Homo sapiens OX=9606 GN=EOGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q13505-3|MTX1_HUMAN	Isoform 3 of Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	2	2	2
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8WVV9-3|HNRLL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	46-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9P0J0|NDUAD_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens OX=9606 GN=NDUFA13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	141-UNIMOD:35	0.13	29.0	3	1	0
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q12959-8|DLG1_HUMAN	Isoform 8 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8NEJ9|NGDN_HUMAN	Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9Y483|MTF2_HUMAN	Metal-response element-binding transcription factor 2 OS=Homo sapiens OX=9606 GN=MTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	185-UNIMOD:35,1128-UNIMOD:35,1136-UNIMOD:4	0.03	29.0	3	3	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	3	3	3
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	70-UNIMOD:35	0.12	29.0	3	2	1
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	825-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	3	2	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	198-UNIMOD:35,373-UNIMOD:4	0.04	29.0	2	2	2
PRT	sp|Q5JPH6|SYEM_HUMAN	Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=EARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	485-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	886-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	369-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q71UI9|H2AV_HUMAN	Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q99661-2|KIF2C_HUMAN	Isoform 2 of Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	233-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	35-UNIMOD:4,46-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	3	2	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P14373|TRI27_HUMAN	Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	284-UNIMOD:35	0.07	28.0	2	2	2
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P22413|ENPP1_HUMAN	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	883-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q86SQ0-2|PHLB2_HUMAN	Isoform 2 of Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8IUF1|CBWD2_HUMAN	COBW domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CBWD2 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	87-UNIMOD:4,91-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	226-UNIMOD:35,238-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q15121|PEA15_HUMAN	Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	1	1	1
PRT	sp|Q9BWF3-2|RBM4_HUMAN	Isoform 2 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q9NRG4-2|SMYD2_HUMAN	Isoform 2 of N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	3	2	1
PRT	sp|Q9P0M9|RM27_HUMAN	39S ribosomal protein L27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	56-UNIMOD:35	0.22	28.0	2	2	2
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	161-UNIMOD:4,164-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	742-UNIMOD:4,350-UNIMOD:4,352-UNIMOD:35	0.02	28.0	2	2	2
PRT	sp|Q9Y2I1-4|NISCH_HUMAN	Isoform 4 of Nischarin OS=Homo sapiens OX=9606 GN=NISCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	227-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	164-UNIMOD:35	0.02	28.0	2	1	0
PRT	sp|P21283|VATC1_HUMAN	V-type proton ATPase subunit C 1 OS=Homo sapiens OX=9606 GN=ATP6V1C1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	15-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1566-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q8IXB1-2|DJC10_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9Y5K5-2|UCHL5_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	171-UNIMOD:4,172-UNIMOD:35,66-UNIMOD:4	0.12	28.0	2	2	2
PRT	sp|Q92879-5|CELF1_HUMAN	Isoform 5 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	71-UNIMOD:35,77-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|P60900-2|PSA6_HUMAN	Isoform 2 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q13423|NNTM_HUMAN	NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	132-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q2M1P5|KIF7_HUMAN	Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	408-UNIMOD:35,412-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q8TF05-2|PP4R1_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	452-UNIMOD:35	0.03	28.0	2	2	2
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	2	2
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q5VZK9-4|CARL1_HUMAN	Isoform 4 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q9H1K0|RBNS5_HUMAN	Rabenosyn-5 OS=Homo sapiens OX=9606 GN=RBSN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P0DPB5|RPC22_HUMAN	Protein POLR1D, isoform 2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q15436-2|SC23A_HUMAN	Isoform 2 of Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	225-UNIMOD:35	0.07	28.0	2	2	1
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2459-UNIMOD:35,2467-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q16864|VATF_HUMAN	V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.28	28.0	2	2	2
PRT	sp|Q8TCC3-3|RM30_HUMAN	Isoform 3 of 39S ribosomal protein L30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	0
PRT	sp|Q7Z7F7|RM55_HUMAN	39S ribosomal protein L55, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL55 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	1	1	1
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	2	1	0
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9HD15|SRA1_HUMAN	Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	125-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q13084|RM28_HUMAN	39S ribosomal protein L28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL28 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	102-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q9NP81|SYSM_HUMAN	Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	191-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	24-UNIMOD:4,27-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q96G25-3|MED8_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 8 OS=Homo sapiens OX=9606 GN=MED8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	2	1	0
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	73-UNIMOD:4,79-UNIMOD:35	0.12	28.0	1	1	0
PRT	sp|Q8TCU4|ALMS1_HUMAN	Alstrom syndrome protein 1 OS=Homo sapiens OX=9606 GN=ALMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q05D32|CTSL2_HUMAN	CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O60645|EXOC3_HUMAN	Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	281-UNIMOD:4	0.04	28.0	2	2	2
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	2109-UNIMOD:4,2377-UNIMOD:35,2380-UNIMOD:4	0.01	28.0	2	2	2
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UQN3|CHM2B_HUMAN	Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	116-UNIMOD:35,125-UNIMOD:35	0.08	28.0	1	1	1
PRT	sp|Q14966|ZN638_HUMAN	Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	85-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q99676|ZN184_HUMAN	Zinc finger protein 184 OS=Homo sapiens OX=9606 GN=ZNF184 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	334-UNIMOD:35,146-UNIMOD:4	0.12	27.0	4	3	2
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q96MF7|NSE2_HUMAN	E3 SUMO-protein ligase NSE2 OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	210-UNIMOD:4,215-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q7Z6E9-4|RBBP6_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P09960-4|LKHA4_HUMAN	Isoform 4 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	112-UNIMOD:4,117-UNIMOD:4	0.05	27.0	2	2	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	614-UNIMOD:35	0.03	27.0	5	2	1
PRT	sp|P82673-2|RT35_HUMAN	Isoform 2 of 28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	2	2
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q96PE3-2|INP4A_HUMAN	Isoform 2 of Inositol polyphosphate-4-phosphatase type I A OS=Homo sapiens OX=9606 GN=INPP4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9UHA4-2|LTOR3_HUMAN	Isoform 2 of Ragulator complex protein LAMTOR3 OS=Homo sapiens OX=9606 GN=LAMTOR3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|Q4LE39-4|ARI4B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O75528-2|TADA3_HUMAN	Isoform 2 of Transcriptional adapter 3 OS=Homo sapiens OX=9606 GN=TADA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	255-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	43-UNIMOD:4,46-UNIMOD:4	0.10	27.0	1	1	1
PRT	sp|O95298-2|NDUC2_HUMAN	Isoform 4 of NADH dehydrogenase [ubiquinone] 1 subunit C2 OS=Homo sapiens OX=9606 GN=NDUFC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	119-UNIMOD:35	0.08	27.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	537-UNIMOD:35	0.04	27.0	2	2	2
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	182-UNIMOD:4	0.04	27.0	3	1	0
PRT	sp|Q4J6C6-4|PPCEL_HUMAN	Isoform 4 of Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UHD8-4|SEPT9_HUMAN	Isoform 4 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8WU76|SCFD2_HUMAN	Sec1 family domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|Q99747-2|SNAG_HUMAN	Isoform 2 of Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P48426-2|PI42A_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q96CD2-2|COAC_HUMAN	Isoform 2 of Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens OX=9606 GN=PPCDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P60953-1|CDC42_HUMAN	Isoform 1 of Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	105-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	127-UNIMOD:4,108-UNIMOD:4	0.10	27.0	2	2	2
PRT	sp|O75521-2|ECI2_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	247-UNIMOD:4,133-UNIMOD:35,138-UNIMOD:35	0.11	27.0	2	2	2
PRT	sp|O95249-2|GOSR1_HUMAN	Isoform 2 of Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q71UM5|RS27L_HUMAN	40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q9Y316-2|MEMO1_HUMAN	Isoform 2 of Protein MEMO1 OS=Homo sapiens OX=9606 GN=MEMO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	2	2
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	27-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q5H9R7-6|PP6R3_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|P49770|EI2BB_HUMAN	Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	340-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1937-UNIMOD:35	0.02	27.0	3	3	3
PRT	sp|Q9UBQ0-2|VPS29_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	245-UNIMOD:4	0.13	27.0	2	2	2
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	89-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	602-UNIMOD:35	0.03	27.0	3	2	1
PRT	sp|P04818-3|TYSY_HUMAN	Isoform 3 of Thymidylate synthase OS=Homo sapiens OX=9606 GN=TYMS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q8WVM7-2|STAG1_HUMAN	Isoform 2 of Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q13615-3|MTMR3_HUMAN	Isoform C of Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9BPX5|ARP5L_HUMAN	Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens OX=9606 GN=ARPC5L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|P18077|RL35A_HUMAN	60S ribosomal protein L35a OS=Homo sapiens OX=9606 GN=RPL35A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	2	2	2
PRT	sp|Q9H4I3-2|TRABD_HUMAN	Isoform 2 of TraB domain-containing protein OS=Homo sapiens OX=9606 GN=TRABD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9UPY3|DICER_HUMAN	Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	149-UNIMOD:35	0.13	27.0	3	2	1
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	420-UNIMOD:35	0.02	27.0	1	1	0
PRT	sp|Q15833|STXB2_HUMAN	Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9Y6E0|STK24_HUMAN	Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	0
PRT	sp|Q96DT6|ATG4C_HUMAN	Cysteine protease ATG4C OS=Homo sapiens OX=9606 GN=ATG4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9H098|F107B_HUMAN	Protein FAM107B OS=Homo sapiens OX=9606 GN=FAM107B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	2	2	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P10606|COX5B_HUMAN	Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	2	1	0
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|O75150|BRE1B_HUMAN	E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	564-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q9UGM6|SYWM_HUMAN	Tryptophan--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=WARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	214-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	174-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q96EQ0|SGTB_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens OX=9606 GN=SGTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	96-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q86VP1-3|TAXB1_HUMAN	Isoform 3 of Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q8IWZ8-2|SUGP1_HUMAN	Isoform 2 of SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	78-UNIMOD:4	0.14	26.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1000-UNIMOD:4,1009-UNIMOD:4,1012-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|O75150-4|BRE1B_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	886-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	3	2	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q08378-2|GOGA3_HUMAN	Isoform 2 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	932-UNIMOD:35,888-UNIMOD:35	0.02	26.0	2	2	2
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|B2RPK0|HGB1A_HUMAN	Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P22033|MUTA_HUMAN	Methylmalonyl-CoA mutase, mitochondrial OS=Homo sapiens OX=9606 GN=MMUT PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	2	2
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	132-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	211-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P84022-3|SMAD3_HUMAN	Isoform 3 of Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	16-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	113-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	159-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1216-UNIMOD:35	0.01	26.0	2	2	2
PRT	sp|Q6ZRP7|QSOX2_HUMAN	Sulfhydryl oxidase 2 OS=Homo sapiens OX=9606 GN=QSOX2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	131-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	250-UNIMOD:35,260-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O00443-2|P3C2A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9BZF9-2|UACA_HUMAN	Isoform 2 of Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9H857-4|NT5D2_HUMAN	Isoform 4 of 5'-nucleotidase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NT5DC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|Q9Y221|NIP7_HUMAN	60S ribosome subunit biogenesis protein NIP7 homolog OS=Homo sapiens OX=9606 GN=NIP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	523-UNIMOD:35,527-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q14181-2|DPOA2_HUMAN	Isoform 2 of DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P08397-4|HEM3_HUMAN	Isoform 4 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9UBU6|FA8A1_HUMAN	Protein FAM8A1 OS=Homo sapiens OX=9606 GN=FAM8A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P49674|KC1E_HUMAN	Casein kinase I isoform epsilon OS=Homo sapiens OX=9606 GN=CSNK1E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	3	2	1
PRT	sp|Q96AT9-4|RPE_HUMAN	Isoform 4 of Ribulose-phosphate 3-epimerase OS=Homo sapiens OX=9606 GN=RPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	69-UNIMOD:35,71-UNIMOD:35,72-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	124-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	2	2	2
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	153-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9NVS9-3|PNPO_HUMAN	Isoform 3 of Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:4	0.14	26.0	2	2	2
PRT	sp|Q15018|ABRX2_HUMAN	BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	400-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q13643|FHL3_HUMAN	Four and a half LIM domains protein 3 OS=Homo sapiens OX=9606 GN=FHL3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:4,153-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9Y6D6|BIG1_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	198-UNIMOD:35	0.02	26.0	1	1	0
PRT	sp|Q02750|MP2K1_HUMAN	Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P11171|EPB41_HUMAN	Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q6P3X3|TTC27_HUMAN	Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q70CQ2|UBP34_HUMAN	Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	856-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	129-UNIMOD:35	0.09	26.0	2	1	0
PRT	sp|Q8WTT2|NOC3L_HUMAN	Nucleolar complex protein 3 homolog OS=Homo sapiens OX=9606 GN=NOC3L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UBU9|NXF1_HUMAN	Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	618-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	532-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O15381|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q6P158|DHX57_HUMAN	Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	103-UNIMOD:35	0.01	25.0	2	1	0
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	2	2	2
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O43447-2|PPIH_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	88-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	143-UNIMOD:35	0.07	25.0	1	1	1
PRT	sp|Q8TF01|PNISR_HUMAN	Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P17010-2|ZFX_HUMAN	Isoform 2 of Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	614-UNIMOD:4	0.02	25.0	1	1	0
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	126-UNIMOD:4,129-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	269-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q96CB9-4|NSUN4_HUMAN	Isoform 4 of 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9Y399|RT02_HUMAN	28S ribosomal protein S2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|O43865-2|SAHH2_HUMAN	Isoform 2 of S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q06587-2|RING1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9H488|OFUT1_HUMAN	GDP-fucose protein O-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POFUT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13596-2|SNX1_HUMAN	Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	2
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	361-UNIMOD:35	0.02	25.0	2	2	2
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P04062-4|GLCM_HUMAN	Isoform 4 of Lysosomal acid glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	368-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9H788-2|SH24A_HUMAN	Isoform 2 of SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q8N543|OGFD1_HUMAN	Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	308-UNIMOD:4	0.05	25.0	2	2	2
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96S55-4|WRIP1_HUMAN	Isoform 4 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	118-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|Q9NRL3|STRN4_HUMAN	Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	337-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	290-UNIMOD:35	0.05	25.0	2	2	2
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	1	0
PRT	sp|Q96SB8|SMC6_HUMAN	Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	198-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q15475|SIX1_HUMAN	Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	40-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q96D09|GASP2_HUMAN	G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NVM4-4|ANM7_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 7 OS=Homo sapiens OX=9606 GN=PRMT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	171-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P53701|CCHL_HUMAN	Cytochrome c-type heme lyase OS=Homo sapiens OX=9606 GN=HCCS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	3	3	3
PRT	sp|Q9Y3E1|HDGR3_HUMAN	Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.18	25.0	2	2	2
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6P1X6-2|CH082_HUMAN	Isoform 2 of UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O94880-2|PHF14_HUMAN	Isoform 2 of PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O14936-3|CSKP_HUMAN	Isoform 3 of Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q8WXF1-2|PSPC1_HUMAN	Isoform 2 of Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	285-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9NQH7-3|XPP3_HUMAN	Isoform 3 of Xaa-Pro aminopeptidase 3 OS=Homo sapiens OX=9606 GN=XPNPEP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	62-UNIMOD:4,63-UNIMOD:35	0.06	25.0	2	2	2
PRT	sp|Q8TCC3|RM30_HUMAN	39S ribosomal protein L30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	1	1	0
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q86VP1|TAXB1_HUMAN	Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.14	25.0	1	1	1
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	163-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	2	2	1
PRT	sp|Q9HA47|UCK1_HUMAN	Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	261-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	226-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O15294|OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P09493|TPM1_HUMAN	Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q7LGA3|HS2ST_HUMAN	Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q4LDG9|DNAL1_HUMAN	Dynein light chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q8WZA0|LZIC_HUMAN	Protein LZIC OS=Homo sapiens OX=9606 GN=LZIC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|O75027|ABCB7_HUMAN	ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	747-UNIMOD:4,750-UNIMOD:4,752-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q5JTJ3|COA6_HUMAN	Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.15	25.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9BVP2-2|GNL3_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q6UWP7-3|LCLT1_HUMAN	Isoform 3 of Lysocardiolipin acyltransferase 1 OS=Homo sapiens OX=9606 GN=LCLAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	266-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q6UW68|TM205_HUMAN	Transmembrane protein 205 OS=Homo sapiens OX=9606 GN=TMEM205 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|Q7Z7E8|UB2Q1_HUMAN	Ubiquitin-conjugating enzyme E2 Q1 OS=Homo sapiens OX=9606 GN=UBE2Q1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	301-UNIMOD:4	0.06	24.0	2	2	2
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O14561|ACPM_HUMAN	Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q13823|NOG2_HUMAN	Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	225-UNIMOD:35	0.03	24.0	3	1	0
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	202-UNIMOD:35	0.00	24.0	1	1	1
PRT	sp|Q00796|DHSO_HUMAN	Sorbitol dehydrogenase OS=Homo sapiens OX=9606 GN=SORD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	66-UNIMOD:35	0.08	24.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.00	24.0	1	1	0
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|Q6PJT7-8|ZC3HE_HUMAN	Isoform 8 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	159-UNIMOD:4,168-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	280-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	225-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	59-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q8N371|KDM8_HUMAN	Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q99808|S29A1_HUMAN	Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9UNK0|STX8_HUMAN	Syntaxin-8 OS=Homo sapiens OX=9606 GN=STX8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O75191|XYLB_HUMAN	Xylulose kinase OS=Homo sapiens OX=9606 GN=XYLB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O00165-5|HAX1_HUMAN	Isoform 5 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P46934-3|NEDD4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5VYS8-5|TUT7_HUMAN	Isoform 5 of Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P82921|RT21_HUMAN	28S ribosomal protein S21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.17	24.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	18-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O43432-4|IF4G3_HUMAN	Isoform 4 of Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q04206-2|TF65_HUMAN	Isoform 2 of Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q9UGY1|NOL12_HUMAN	Nucleolar protein 12 OS=Homo sapiens OX=9606 GN=NOL12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1014-UNIMOD:4	0.02	24.0	2	2	2
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9P0I2-2|EMC3_HUMAN	Isoform 2 of ER membrane protein complex subunit 3 OS=Homo sapiens OX=9606 GN=EMC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q6ZRI6-2|CO039_HUMAN	Isoform 2 of Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q6GMV2|SMYD5_HUMAN	SET and MYND domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	101-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	632-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q86WJ1-5|CHD1L_HUMAN	Isoform 5 of Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P17482|HXB9_HUMAN	Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	50-UNIMOD:4	0.08	24.0	1	1	1
PRT	sp|P84101-4|SERF2_HUMAN	Isoform 4 of Small EDRK-rich factor 2 OS=Homo sapiens OX=9606 GN=SERF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.24	24.0	1	1	1
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9BXS6-4|NUSAP_HUMAN	Isoform 4 of Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9P2J5-2|SYLC_HUMAN	Isoform 2 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	194-UNIMOD:4,195-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	616-UNIMOD:4	0.02	24.0	1	1	0
PRT	sp|Q12959|DLG1_HUMAN	Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q9BRT8|CBWD1_HUMAN	COBW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CBWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9H269|VPS16_HUMAN	Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens OX=9606 GN=VPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y4K3|TRAF6_HUMAN	TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	450-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	492-UNIMOD:35,498-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q5VWN6|TASO2_HUMAN	Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	2	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	337-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P06899|H2B1J_HUMAN	Histone H2B type 1-J OS=Homo sapiens OX=9606 GN=H2BC11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|Q9H9B1|EHMT1_HUMAN	Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q6ZN16|M3K15_HUMAN	Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens OX=9606 GN=MAP3K15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5C9Z4|NOM1_HUMAN	Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	4	3	2
PRT	sp|A6NEC2|PSAL_HUMAN	Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9BVP2|GNL3_HUMAN	Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	106-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|A6NDU8|CE051_HUMAN	UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	268-UNIMOD:4	0.11	24.0	2	2	2
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9NQZ6-3|ZC4H2_HUMAN	Isoform 3 of Zinc finger C4H2 domain-containing protein OS=Homo sapiens OX=9606 GN=ZC4H2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	166-UNIMOD:4,169-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	133-UNIMOD:35,134-UNIMOD:35	0.13	23.0	2	2	2
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8ND82|Z280C_HUMAN	Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q99700-2|ATX2_HUMAN	Isoform 2 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q86XN7-2|PRSR1_HUMAN	Isoform 2 of Proline and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=PROSER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P57772-2|SELB_HUMAN	Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	194-UNIMOD:4,205-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96BD5-2|PF21A_HUMAN	Isoform 2 of PHD finger protein 21A OS=Homo sapiens OX=9606 GN=PHF21A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	422-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q86WR0-2|CCD25_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 25 OS=Homo sapiens OX=9606 GN=CCDC25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	36-UNIMOD:35	0.11	23.0	1	1	1
PRT	sp|Q07864|DPOE1_HUMAN	DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8IV38|ANKY2_HUMAN	Ankyrin repeat and MYND domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKMY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	424-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9NZ53-2|PDXL2_HUMAN	Isoform 2 of Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O95340|PAPS2_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96DG6|CMBL_HUMAN	Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|A6NHR9|SMHD1_HUMAN	Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q6YP21-3|KAT3_HUMAN	Isoform 3 of Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens OX=9606 GN=KYAT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P54132|BLM_HUMAN	Bloom syndrome protein OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P55809-2|SCOT1_HUMAN	Isoform 2 of Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:35	0.11	23.0	1	1	1
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	324-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O00255-3|MEN1_HUMAN	Isoform 3 of Menin OS=Homo sapiens OX=9606 GN=MEN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	294-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	162-UNIMOD:35	0.03	23.0	2	2	2
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|O75146|HIP1R_HUMAN	Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y375|CIA30_HUMAN	Complex I intermediate-associated protein 30, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P53384-2|NUBP1_HUMAN	Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	296-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q9ULR0|ISY1_HUMAN	Pre-mRNA-splicing factor ISY1 homolog OS=Homo sapiens OX=9606 GN=ISY1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9Y2Q3-3|GSTK1_HUMAN	Isoform 3 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	66-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	3	3	3
PRT	sp|Q9NX74|DUS2L_HUMAN	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens OX=9606 GN=DUS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8WVX9|FACR1_HUMAN	Fatty acyl-CoA reductase 1 OS=Homo sapiens OX=9606 GN=FAR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BVL4|SELO_HUMAN	Protein adenylyltransferase SelO, mitochondrial OS=Homo sapiens OX=9606 GN=SELENOO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5VZE5|NAA35_HUMAN	N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA35 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	433-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P53582|MAP11_HUMAN	Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	94-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	106-UNIMOD:4	0.15	23.0	2	2	2
PRT	sp|O43819|SCO2_HUMAN	Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.14	23.0	1	1	1
PRT	sp|Q9BXP5-4|SRRT_HUMAN	Isoform 4 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	184-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|O14578-3|CTRO_HUMAN	Isoform 3 of Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q6UN15-4|FIP1_HUMAN	Isoform 4 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	400-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P10644|KAP0_HUMAN	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q9UBF8-3|PI4KB_HUMAN	Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P31942|HNRH3_HUMAN	Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P54707|AT12A_HUMAN	Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q05519|SRS11_HUMAN	Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	0
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	2	2	1
PRT	sp|Q86XN7|PRSR1_HUMAN	Proline and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=PROSER1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q8N9N5|BANP_HUMAN	Protein BANP OS=Homo sapiens OX=9606 GN=BANP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q7Z7F0|KHDC4_HUMAN	KH homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KHDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	312-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P38435|VKGC_HUMAN	Vitamin K-dependent gamma-carboxylase OS=Homo sapiens OX=9606 GN=GGCX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	579-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	572-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	2129-UNIMOD:35	0.00	23.0	1	1	1
PRT	sp|Q4U2R6|RM51_HUMAN	39S ribosomal protein L51, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL51 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	102-UNIMOD:35	0.10	23.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96IZ7|RSRC1_HUMAN	Serine/Arginine-related protein 53 OS=Homo sapiens OX=9606 GN=RSRC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	2	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|Q9H2J4|PDCL3_HUMAN	Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P23919|KTHY_HUMAN	Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q86XT4|TRI50_HUMAN	E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	593-UNIMOD:4	0.01	23.0	2	1	0
PRT	sp|Q6ZSJ8|CA122_HUMAN	Uncharacterized protein C1orf122 OS=Homo sapiens OX=9606 GN=C1orf122 PE=4 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.24	23.0	1	1	1
PRT	sp|Q9UG56-2|PISD_HUMAN	Isoform 2 of Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Homo sapiens OX=9606 GN=PISD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q14207|NPAT_HUMAN	Protein NPAT OS=Homo sapiens OX=9606 GN=NPAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	682-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9H814|PHAX_HUMAN	Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	179-UNIMOD:35	0.06	22.0	2	2	2
PRT	sp|Q96C23|GALM_HUMAN	Galactose mutarotase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O95149|SPN1_HUMAN	Snurportin-1 OS=Homo sapiens OX=9606 GN=SNUPN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	356-UNIMOD:4,358-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|O95619|YETS4_HUMAN	YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9BUJ2-2|HNRL1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8WYQ5-3|DGCR8_HUMAN	Isoform 3 of Microprocessor complex subunit DGCR8 OS=Homo sapiens OX=9606 GN=DGCR8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O75909-2|CCNK_HUMAN	Isoform 2 of Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	290-UNIMOD:4	0.05	22.0	3	2	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BU76-4|MMTA2_HUMAN	Isoform 4 of Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	191-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|Q6UXV4|MIC27_HUMAN	MICOS complex subunit MIC27 OS=Homo sapiens OX=9606 GN=APOOL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	251-UNIMOD:35,263-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	212-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	483-UNIMOD:4,613-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	96-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|P17612-2|KAPCA_HUMAN	Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	518-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1030-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9ULR5|PAI2B_HUMAN	Polyadenylate-binding protein-interacting protein 2B OS=Homo sapiens OX=9606 GN=PAIP2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q8NFP9|NBEA_HUMAN	Neurobeachin OS=Homo sapiens OX=9606 GN=NBEA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q01664|TFAP4_HUMAN	Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8NCA5|FA98A_HUMAN	Protein FAM98A OS=Homo sapiens OX=9606 GN=FAM98A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	78-UNIMOD:35	0.01	22.0	2	1	0
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9UHQ9|NB5R1_HUMAN	NADH-cytochrome b5 reductase 1 OS=Homo sapiens OX=9606 GN=CYB5R1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q02809|PLOD1_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	342-UNIMOD:35	0.04	22.0	3	2	1
PRT	sp|Q9H7D7-2|WDR26_HUMAN	Isoform 2 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q7Z2W4-2|ZCCHV_HUMAN	Isoform 2 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	36-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|P47985|UCRI_HUMAN	Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y520-3|PRC2C_HUMAN	Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	155-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|P52756|RBM5_HUMAN	RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9NYB9|ABI2_HUMAN	Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P23025|XPA_HUMAN	DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	256-UNIMOD:35	0.08	22.0	1	1	1
PRT	sp|Q92688|AN32B_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens OX=9606 GN=ANP32B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	0
PRT	sp|P00374|DYR_HUMAN	Dihydrofolate reductase OS=Homo sapiens OX=9606 GN=DHFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	126-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q13492|PICAL_HUMAN	Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	35-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	86-UNIMOD:35	0.16	22.0	1	1	1
PRT	sp|Q16881|TRXR1_HUMAN	Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	390-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q01831|XPC_HUMAN	DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O95219|SNX4_HUMAN	Sorting nexin-4 OS=Homo sapiens OX=9606 GN=SNX4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P16104|H2AX_HUMAN	Histone H2AX OS=Homo sapiens OX=9606 GN=H2AX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	259-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|Q96S19|MTL26_HUMAN	Methyltransferase-like 26 OS=Homo sapiens OX=9606 GN=METTL26 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	1	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|Q9Y282-2|ERGI3_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8NCW5-2|NNRE_HUMAN	Isoform 2 of NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|Q9Y6X8|ZHX2_HUMAN	Zinc fingers and homeoboxes protein 2 OS=Homo sapiens OX=9606 GN=ZHX2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8IUR7-8|ARMC8_HUMAN	Isoform 8 of Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	576-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q9BX67|JAM3_HUMAN	Junctional adhesion molecule C OS=Homo sapiens OX=9606 GN=JAM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	155-UNIMOD:35,160-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q7LBC6-3|KDM3B_HUMAN	Isoform 3 of Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	527-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q96K37-2|S35E1_HUMAN	Isoform 2 of Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.16	21.0	1	1	1
PRT	sp|P62993|GRB2_HUMAN	Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O43837-3|IDH3B_HUMAN	Isoform C of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1309-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	162-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q86W56-3|PARG_HUMAN	Isoform 3 of Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P30038-2|AL4A1_HUMAN	Isoform 2 of Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	68-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q13445|TMED1_HUMAN	Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMED1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9GZQ8|MLP3B_HUMAN	Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q99442|SEC62_HUMAN	Translocation protein SEC62 OS=Homo sapiens OX=9606 GN=SEC62 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	32-UNIMOD:4,39-UNIMOD:35,40-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|P30536|TSPO_HUMAN	Translocator protein OS=Homo sapiens OX=9606 GN=TSPO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P49914-2|MTHFS_HUMAN	Isoform 2 of 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P36897-3|TGFR1_HUMAN	Isoform 3 of TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9ULU4-3|PKCB1_HUMAN	Isoform 3 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q15269|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens OX=9606 GN=PWP2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96NW4|ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	2	1	0
PRT	sp|Q9BU89|DOHH_HUMAN	Deoxyhypusine hydroxylase OS=Homo sapiens OX=9606 GN=DOHH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9UER7-3|DAXX_HUMAN	Isoform 3 of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	645-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q5TAQ9-2|DCAF8_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 8 OS=Homo sapiens OX=9606 GN=DCAF8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P46939-4|UTRO_HUMAN	Isoform Up140 of Utrophin OS=Homo sapiens OX=9606 GN=UTRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96G74-3|OTUD5_HUMAN	Isoform 3 of OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	0
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	274-UNIMOD:35	0.07	21.0	2	2	2
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q53GS7-2|GLE1_HUMAN	Isoform 2 of Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q06787-11|FMR1_HUMAN	Isoform 11 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	7-UNIMOD:35	0.12	21.0	2	1	0
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	2199-UNIMOD:4	0.01	21.0	1	1	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	317-UNIMOD:4,331-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q13620|CUL4B_HUMAN	Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	810-UNIMOD:4	0.01	21.0	1	1	0
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1612-UNIMOD:35,1616-UNIMOD:4	0.01	21.0	1	1	0
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q9UKJ3|GPTC8_HUMAN	G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|P06732|KCRM_HUMAN	Creatine kinase M-type OS=Homo sapiens OX=9606 GN=CKM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9UBL3|ASH2L_HUMAN	Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.05	21.0	1	1	0
PRT	sp|Q9Y285|SYFA_HUMAN	Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	32-UNIMOD:35	0.06	21.0	1	1	1
PRT	sp|O43829|ZBT14_HUMAN	Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P17302|CXA1_HUMAN	Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	3070-UNIMOD:35,641-UNIMOD:35,643-UNIMOD:4	0.01	21.0	2	2	2
PRT	sp|Q9H8V3|ECT2_HUMAN	Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	635-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q8IW35|CEP97_HUMAN	Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	593-UNIMOD:35,599-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q9UIG0|BAZ1B_HUMAN	Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9BV73|CP250_HUMAN	Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9HCJ3-2|RAVR2_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 2 OS=Homo sapiens OX=9606 GN=RAVER2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	410-UNIMOD:35	0.03	20.0	2	1	0
PRT	sp|O95782-2|AP2A1_HUMAN	Isoform B of AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6ZNB6-2|NFXL1_HUMAN	Isoform 2 of NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	589-UNIMOD:4,593-UNIMOD:4,597-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q17R31-5|TATD3_HUMAN	Isoform 5 of Putative deoxyribonuclease TATDN3 OS=Homo sapiens OX=9606 GN=TATDN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q15653-2|IKBB_HUMAN	Isoform 2 of NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q2TAY7|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	2	1	0
PRT	sp|P63208-2|SKP1_HUMAN	Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	62-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q9BZV1-2|UBXN6_HUMAN	Isoform 2 of UBX domain-containing protein 6 OS=Homo sapiens OX=9606 GN=UBXN6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|A2RTX5|SYTC2_HUMAN	Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	509-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q96B49|TOM6_HUMAN	Mitochondrial import receptor subunit TOM6 homolog OS=Homo sapiens OX=9606 GN=TOMM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.14	20.0	1	1	1
PRT	sp|Q9NVP2|ASF1B_HUMAN	Histone chaperone ASF1B OS=Homo sapiens OX=9606 GN=ASF1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	157-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	324-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q13724-2|MOGS_HUMAN	Isoform 2 of Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P07199|CENPB_HUMAN	Major centromere autoantigen B OS=Homo sapiens OX=9606 GN=CENPB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	38-UNIMOD:35,39-UNIMOD:4	0.16	20.0	1	1	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q5UCC4-2|EMC10_HUMAN	Isoform 2 of ER membrane protein complex subunit 10 OS=Homo sapiens OX=9606 GN=EMC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q6AI12|ANR40_HUMAN	Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	339-UNIMOD:4	0.03	20.0	2	2	2
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.12	20.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O95626|AN32D_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member D OS=Homo sapiens OX=9606 GN=ANP32D PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9BUH6|PAXX_HUMAN	Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	180-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P46087-3|NOP2_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q5JPE7-3|NOMO2_HUMAN	Isoform 3 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	29-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|P43304-2|GPDM_HUMAN	Isoform 2 of Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q6ZRS2-3|SRCAP_HUMAN	Isoform 3 of Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q9BYD3-2|RM04_HUMAN	Isoform 2 of 39S ribosomal protein L4, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P55196-3|AFAD_HUMAN	Isoform 3 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1602-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q96G21|IMP4_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P78316|NOP14_HUMAN	Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	525-UNIMOD:35,528-UNIMOD:35,531-UNIMOD:35	0.02	20.0	1	1	0
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	28-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q6ZRI6|CO039_HUMAN	Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|Q4J6C6|PPCEL_HUMAN	Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	303-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|O60826|CCD22_HUMAN	Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	215-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q7Z4H8|PLGT3_HUMAN	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9H5V9|CX056_HUMAN	UPF0428 protein CXorf56 OS=Homo sapiens OX=9606 GN=CXorf56 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	212-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|Q9UK61|TASOR_HUMAN	Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q76FK4|NOL8_HUMAN	Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9BR61|ACBD6_HUMAN	Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ACBD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q5VV42|CDKAL_HUMAN	Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	56-UNIMOD:4	0.13	20.0	1	1	1
PRT	sp|O00754|MA2B1_HUMAN	Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9UHB6-4|LIMA1_HUMAN	Isoform 4 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P20248|CCNA2_HUMAN	Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q14141-2|SEPT6_HUMAN	Isoform I of Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H8V3-2|ECT2_HUMAN	Isoform 2 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	931-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q02224-3|CENPE_HUMAN	Isoform 3 of Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q96BW9-2|TAM41_HUMAN	Isoform 2 of Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=TAMM41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	285-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	36-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|O43920|NDUS5_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 OS=Homo sapiens OX=9606 GN=NDUFS5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q15041-2|AR6P1_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q15067-2|ACOX1_HUMAN	Isoform 2 of Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96QT6-2|PHF12_HUMAN	Isoform 2 of PHD finger protein 12 OS=Homo sapiens OX=9606 GN=PHF12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q13191-3|CBLB_HUMAN	Isoform Truncated 2 of E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7Z3Y7|K1C28_HUMAN	Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NRY2|SOSSC_HUMAN	SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	31-UNIMOD:35	0.21	19.0	1	1	1
PRT	sp|P60510|PP4C_HUMAN	Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	192-UNIMOD:35,193-UNIMOD:4	0.10	19.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q6P4E1-3|GOLM2_HUMAN	Isoform 3 of Protein GOLM2 OS=Homo sapiens OX=9606 GN=GOLM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q6VMQ6-5|MCAF1_HUMAN	Isoform 4 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O75494-5|SRS10_HUMAN	Isoform 5 of Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O00139-2|KIF2A_HUMAN	Isoform 2 of Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	107-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q9P013|CWC15_HUMAN	Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P17900|SAP3_HUMAN	Ganglioside GM2 activator OS=Homo sapiens OX=9606 GN=GM2A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	136-UNIMOD:4,138-UNIMOD:4	0.10	19.0	1	1	1
PRT	sp|P78310-4|CXAR_HUMAN	Isoform 4 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9HB71-2|CYBP_HUMAN	Isoform 2 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	50-UNIMOD:4,51-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q6NXT2|H3C_HUMAN	Histone H3.3C OS=Homo sapiens OX=9606 GN=H3-5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q8NEY8-9|PPHLN_HUMAN	Isoform 9 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P82912|RT11_HUMAN	28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|Q99996|AKAP9_HUMAN	A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	0
PRT	sp|O60879|DIAP2_HUMAN	Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	159-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q9UPN7|PP6R1_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H3Q1|BORG4_HUMAN	Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q008S8|ECT2L_HUMAN	Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens OX=9606 GN=ECT2L PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1067-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|Q9UQ88|CD11A_HUMAN	Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|Q9UIJ7|KAD3_HUMAN	GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P50851|LRBA_HUMAN	Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|Q13433|S39A6_HUMAN	Zinc transporter ZIP6 OS=Homo sapiens OX=9606 GN=SLC39A6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9ULS5|TMCC3_HUMAN	Transmembrane and coiled-coil domain protein 3 OS=Homo sapiens OX=9606 GN=TMCC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q5SZJ8|BEND6_HUMAN	BEN domain-containing protein 6 OS=Homo sapiens OX=9606 GN=BEND6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O60486|PLXC1_HUMAN	Plexin-C1 OS=Homo sapiens OX=9606 GN=PLXNC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UPT5|EXOC7_HUMAN	Exocyst complex component 7 OS=Homo sapiens OX=9606 GN=EXOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	2	1	0
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	212-UNIMOD:35,222-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	139-UNIMOD:4	0.10	19.0	1	1	0
PRT	sp|Q16623|STX1A_HUMAN	Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLA	1	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	69	2-UNIMOD:4	ms_run[2]:scan=11989	27.136	4	3972.8701	3972.8701	D	K	200	237
PSM	KSIAACHNVGLLAHDGQVNEDGQPDLGKA	2	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67	6-UNIMOD:4	ms_run[2]:scan=8928	22.263	4	3013.4676	3013.4676	K	R	106	135
PSM	KELNSNHDGADETSEKEQQEAIEHIDEVQNEID	3	sp|Q01105-2|SET_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	66		ms_run[2]:scan=11125	25.201	4	3792.6834	3792.6834	K	R	11	44
PSM	RHTHVQDGEAGGITQQIGATNVPLEAINEQT	4	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	62		ms_run[2]:scan=11052	25.069	4	3283.6181	3283.6181	L	K	652	683
PSM	RSLVESVSSSPNKESNEEEQVWHFLGK	5	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	60		ms_run[1]:scan=11893	26.8339000424	4	3101.505893	3101.505407	A	-	308	335
PSM	KPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTT	6	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59	20-UNIMOD:35,23-UNIMOD:4,30-UNIMOD:35,31-UNIMOD:4	ms_run[2]:scan=9009	22.37	4	3765.5903	3765.5903	A	K	411	445
PSM	KLPGHAGSINEVAFHPDEPIIISASSDK	7	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58		ms_run[2]:scan=10804	24.68	4	2928.4981	2928.4981	Y	R	322	350
PSM	RVAELLLLHGAEPNCADPATLTRPVHDAA	8	sp|P42771-2|CDN2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	15-UNIMOD:4	ms_run[2]:scan=11094	25.15	4	3106.5982	3106.5982	A	R	7	36
PSM	KGGAAVDPDSGLEHSAHVLEKGG	9	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=8509	21.732	3	2230.0978	2230.0978	L	K	528	551
PSM	RTNSDSALHQSTMTPTQPESFSSGSQDVHQK	10	sp|Q6UUV9-3|CRTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	13-UNIMOD:35	ms_run[2]:scan=6640	19.3	4	3403.5335	3403.5335	R	R	148	179
PSM	RKDSGSSSVSSTSSSSSSSPGDKAGF	11	sp|Q9H7S9|ZN703_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56		ms_run[1]:scan=5245	17.424074609333335	3	2478.111749	2478.110633	S	R	167	193
PSM	KDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEI	12	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=11653	26.238	5	3932.7097	3932.7097	A	K	5	39
PSM	KKFACNGTVIEHPEYGEVIQLQGDQ	13	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	5-UNIMOD:4	ms_run[2]:scan=10367	24.022	3	2859.3861	2859.3861	K	R	65	90
PSM	KPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTT	14	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54	20-UNIMOD:35,23-UNIMOD:4,31-UNIMOD:4	ms_run[2]:scan=9545	23.007	4	3749.5954	3749.5954	A	K	411	445
PSM	RSVKHDSIPAADTFEDLSDVEGGGSEPTQ	15	sp|O95671-2|ASML_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=11130	25.208	4	3043.4007	3043.4007	R	R	206	235
PSM	KEVPEKLPEAADFGTTSSLHFVHM	16	sp|Q12849-5|GRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	24-UNIMOD:35	ms_run[2]:scan=10926	24.854	4	2685.3109	2685.3109	P	R	220	244
PSM	KGWLSLHTGNLDGEDHAAE	17	sp|Q96EL2|RT24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=10109	23.669	3	2048.9552	2048.9552	R	R	66	85
PSM	KLNSEEVTQSQLDSCTSHDGHQQLSEVSSK	18	sp|Q96RS0|TGS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	15-UNIMOD:4	ms_run[2]:scan=7936	21.056	4	3357.5379	3357.5379	I	R	325	355
PSM	KVETVHCSACSVYIPALHSSVQQHL	19	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10388	24.052	4	2849.3953	2849.3953	M	K	195	220
PSM	RPTLDTLHEQASALPQEHAESPDVRG	20	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=8985	22.344	4	2853.4005	2853.4005	Y	R	784	810
PSM	KINHLEYEDQYKDDNFGEGNDGGILDD	21	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=10607	24.361	4	3112.3534	3112.3534	E	K	205	232
PSM	KMEEDPDDVPHGHITSLAVK	22	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	2-UNIMOD:35	ms_run[2]:scan=7808	20.901	3	2233.0685	2233.0685	A	R	59	79
PSM	KSSPIAQPASSFQVETASQGHSISHH	23	sp|Q8IZH2-2|XRN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=8243	21.417	4	2717.3158	2717.3158	L	K	1643	1669
PSM	RAGGDATDSSQTALDNKASLLHSMPTHSSP	24	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	24-UNIMOD:35	ms_run[2]:scan=8048	21.191	4	3067.4265	3067.4265	P	R	985	1015
PSM	RQFQGHTDGASCIDISHDGT	25	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	12-UNIMOD:4	ms_run[2]:scan=7321	20.298	3	2200.9556	2200.9556	V	K	600	620
PSM	KTSEGVTNEKGTDSQAMEEEKPEGHV	26	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52	17-UNIMOD:35	ms_run[1]:scan=4616	16.550378233066667	4	2832.274394	2832.271961	K	-	432	458
PSM	KEAGHGTQKEEIPEEELAEDVEEIDHAE	27	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=11968	27.067	4	3160.432	3160.4320	L	R	1070	1098
PSM	KKFYPLEIDYGQDEEAVK	28	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=10778	24.634552038666666	2	2171.079366	2171.078651	P	K	636	654
PSM	RKVTFFEPGSGDENGTSNKEDEF	29	sp|O95793|STAU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=9952	23.464495079466666	3	2589.166663	2589.161940	G	R	381	404
PSM	KLVCQGSEGALGHGVGPHQHSGPAPPAAVPPP	30	sp|Q9GZT9-2|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	4-UNIMOD:4	ms_run[2]:scan=8101	21.253	4	3105.5567	3105.5567	H	R	55	87
PSM	RHGSGADSDYENTQSGDPLLGLEGK	31	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=10126	23.689	4	2602.1896	2602.1896	S	R	589	614
PSM	KKLEGNSPQGSNQGVKITPDQQ	32	sp|P61006|RAB8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=5633	17.968268710666667	3	2352.206272	2352.203351	D	K	175	197
PSM	KPEDKKENVATTDTLESTTVGTSV	33	sp|Q15046-2|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=8555	21.783599920533334	3	2549.272192	2549.270822	M	-	602	626
PSM	RKPCNSQPSELSSETSGIARPEEG	34	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50	4-UNIMOD:4	ms_run[1]:scan=7552	20.576509926133333	3	2615.226103	2615.224558	E	R	651	675
PSM	RRPQYSNPPVQGEVMEGADNQGAGEQGRPV	35	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=8310	21.494622583199998	4	3222.522837	3222.522471	G	R	204	234
PSM	KEEPLHSIISSTESVQGSTSKHEFQAET	36	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=10210	23.8	4	3085.484	3085.4840	D	K	67	95
PSM	KGIPVMGHSEGICHMYVDSEASVDKVT	37	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	6-UNIMOD:35,13-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=8448	21.656	4	2977.362	2977.3620	A	R	570	597
PSM	RKEGICALGGTSELSSEGTQHSYSEEE	38	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	6-UNIMOD:4	ms_run[2]:scan=8902	22.224	4	2940.3043	2940.3043	N	K	54	81
PSM	RSHMMDVQGSTQDSAIKDFVL	39	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	5-UNIMOD:35	ms_run[2]:scan=11172	25.283	3	2380.1151	2380.1151	P	K	370	391
PSM	RSHMMDVQGSTQDSAIKDFVL	40	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=11624	26.176	3	2364.1202	2364.1202	P	K	370	391
PSM	RSHTSEGAHLDITPNSGAAGNSAGP	41	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7358	20.338	3	2403.1163	2403.1163	S	K	363	388
PSM	KKTGLSSEQTVNVLAQILK	42	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=12164	27.7581919048	3	2056.190099	2056.189205	T	R	480	499
PSM	RRPQYSNPPVQGEVMEGADNQGAGEQGRPV	43	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49	15-UNIMOD:35	ms_run[1]:scan=7310	20.284203470666668	4	3238.515883	3238.517386	G	R	204	234
PSM	KCFEKNEAIQAAHDAVAQEGQC	44	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	2-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=9190	22.591	3	2503.122	2503.1220	A	R	131	153
PSM	KDHASIQMNVAEVDKVTG	45	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	8-UNIMOD:35	ms_run[2]:scan=8215	21.386	2	1956.9575	1956.9575	A	R	27	45
PSM	KFAASGGFLHHMAGLSSS	46	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	12-UNIMOD:35	ms_run[2]:scan=8701	21.963	2	1819.8676	1819.8676	M	K	200	218
PSM	KGEFDPGQDTYQHPPKDSSGQHVDVSPTSQ	47	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=7610	20.648	4	3267.4705	3267.4705	P	R	534	564
PSM	KHQVSVEGTNQTDVKAVGGPA	48	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=6141	18.637	3	2121.0814	2121.0814	K	K	540	561
PSM	KIQHNGNCQLNEENLSTKTEAV	49	sp|Q8WXA9|SREK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	8-UNIMOD:4	ms_run[2]:scan=7574	20.605	3	2526.2133	2526.2133	N	-	487	509
PSM	KLVKGHAYSVTGAEEVESNGSLQ	50	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=8151	21.311	3	2402.2078	2402.2078	Q	K	179	202
PSM	RHSLALGSATEDKDSMETDDCS	51	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	16-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=6128	18.617	3	2440.0118	2440.0118	T	R	1139	1161
PSM	RQMEKDETVSDCSPHIANIG	52	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7810	20.908	3	2302.0318	2302.0318	T	R	195	215
PSM	RYGDGGSTFQSTTGHCVHM	53	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	16-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=6208	18.723	3	2112.8742	2112.8742	H	R	275	294
PSM	RKTTQSGQMSGEGKAGPPGGSS	54	sp|Q16630|CPSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	9-UNIMOD:35	ms_run[1]:scan=3376	14.538964136266666	3	2119.991641	2119.991644	S	R	172	194
PSM	RKTAAELLQSQGSQAGGSQTLK	55	sp|Q14141|SEPT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=7883	20.994046654399998	3	2258.197488	2258.197872	Q	R	399	421
PSM	RKVTFQGVGDEEDEDEIIVPK	56	sp|O95400|CD2B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=10101	23.662429627999998	3	2402.200161	2402.196535	K	K	4	25
PSM	RKGSSSSVCSVASSSDISLGSTKTE	57	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	9-UNIMOD:4	ms_run[1]:scan=7958	21.0882921608	3	2516.203544	2516.202425	S	R	1381	1406
PSM	KKKPPPPDADPANEPPPPGPMPPAP	58	sp|Q96G74|OTUD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	21-UNIMOD:35	ms_run[1]:scan=7214	20.151570968266665	3	2554.292720	2554.288996	P	R	6	31
PSM	KAHVLAASVEQATENFLEKGD	59	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=12166	27.768	3	2256.1386	2256.1386	K	K	57	78
PSM	KHEGLDAIENAVENLDATSDKQ	60	sp|O75044|SRGP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=12188	27.858	3	2396.1456	2396.1456	S	R	306	328
PSM	KTVETRDGQVINETSQHHDDLE	61	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6446	19.035	4	2550.1946	2550.1946	I	-	445	467
PSM	KWNTEDKVSHVSTGGGASLELLEG	62	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=10812	24.691	3	2513.2398	2513.2398	A	K	354	378
PSM	RADAEKAQEQQQQMAELHS	63	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	14-UNIMOD:35	ms_run[2]:scan=4610	16.542	3	2213.0131	2213.0131	L	K	469	488
PSM	RHADNCAGPDGVEGENGGETK	64	sp|P49711|CTCF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	6-UNIMOD:4	ms_run[2]:scan=3929	15.313	3	2168.9141	2168.9141	A	K	572	593
PSM	RHVNGQDQIVPGLYACGEAACASVHGAN	65	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	16-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=10489	24.184	4	2950.3563	2950.3563	L	R	278	306
PSM	RPHLSVILVGENPASHSYVLN	66	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=11296	25.512	3	2301.223	2301.2230	K	K	67	88
PSM	RPRDEVQEVVYFSAADHEPES	67	sp|Q12765|SCRN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=10658	24.445	3	2459.1353	2459.1353	A	K	30	51
PSM	RQQSHFAMMHGGTGFAGIDSSSPEV	68	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=10554	24.275	3	2633.1751	2633.1751	A	K	243	268
PSM	RYGDGGSSFQSTTGHCVHM	69	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	16-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=5992	18.441	3	2098.8585	2098.8585	H	R	275	294
PSM	KKLGGSLADSYLDEGFLLDK	70	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=12020	27.2466286248	3	2168.137364	2168.136501	I	K	203	223
PSM	KKLGEMWNNTAADDKQPYE	71	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47	6-UNIMOD:35	ms_run[1]:scan=7563	20.593180568266668	3	2253.034126	2253.037198	A	K	127	146
PSM	KKNGNYCVLQMDQSYKPDENEV	72	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47	7-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=8513	21.736571011466665	3	2674.200647	2674.200317	K	R	357	379
PSM	KRLEENDDDAYLNSPWADNTALK	73	sp|P57076|CF298_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=10786	24.6505268024	3	2677.260656	2677.261989	L	R	254	277
PSM	KGMSVSDLADKLSTDDLNSLIAHAH	74	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	3-UNIMOD:35	ms_run[2]:scan=12169	27.778	4	2653.3017	2653.3017	W	R	353	378
PSM	KKVEHEISEGNVATAAAAALASAAT	75	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=11873	26.778	3	2409.25	2409.2500	K	K	855	880
PSM	KSVEMHHEALSEALPGDNVGFNV	76	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=11146	25.237	3	2479.1802	2479.1802	V	K	290	313
PSM	KSWASLFHDSKPSSSSPVAYVET	77	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=11539	25.993	3	2509.2125	2509.2125	P	K	340	363
PSM	RNPVWYQALTHGLNEEQR	78	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=11768	26.511	3	2210.0981	2210.0981	N	K	972	990
PSM	RYLTEHPDPNNENIVGYNNK	79	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=8172	21.334	3	2386.1302	2386.1302	Q	K	1112	1132
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	80	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=11010	25.00077043306667	4	3181.590213	3179.584720	R	K	469	499
PSM	KRPVFPPLCGDGLLSGKEET	81	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	9-UNIMOD:4	ms_run[1]:scan=11071	25.103188522933333	3	2199.134301	2199.135789	A	R	56	76
PSM	KKALQYACGNALVCDNVEDAR	82	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=8829	22.131847532	3	2394.134900	2394.142014	I	R	606	627
PSM	RKVTFQGVGDEEDEDEIIVPK	83	sp|O95400|CD2B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=10133	23.6969852176	3	2402.200161	2402.196535	K	K	4	25
PSM	RKQEEQEPTGEEPAVLGGDKEST	84	sp|Q6NS38|ALKB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=7006	19.852720854933334	3	2513.190060	2513.188155	L	R	15	38
PSM	KAAIDWFDGKEFHGNII	85	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=12144	27.688	3	1959.9843	1959.9843	A	K	294	311
PSM	KEFHLNESGDPSSKSTEI	86	sp|Q01105-2|SET_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7984	21.118	3	2003.9436	2003.9436	S	K	141	159
PSM	KGHYTEGAELVDSVLDVVR	87	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=12457	29.111	3	2086.0695	2086.0695	A	K	103	122
PSM	KHDGTGGQSIYGDKFEDENFDV	88	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=10597	24.345	3	2457.0721	2457.0721	T	K	3129	3151
PSM	KIDASKNEEDEGHSNSSP	89	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3585	14.79	3	1942.8504	1942.8504	A	R	67	85
PSM	KKTATQTGHTLLEDYQIVDNSQ	90	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=10439	24.121	3	2489.2398	2489.2398	V	R	614	636
PSM	KNQQITHANNTVSNFK	91	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5579	17.881	3	1842.9337	1842.9337	A	R	53	69
PSM	KPGQFIHTNWTGHGGTVSSSSYNA	92	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=9103	22.481	3	2532.1782	2532.1782	A	-	447	471
PSM	KSGKQSIAIDDCTFHQCV	93	sp|Q96CW1|AP2M1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	12-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8795	22.084	3	2092.967	2092.9670	S	R	235	253
PSM	KVFLENVIRDAVTYTEHA	94	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=12653	29.976	3	2104.0953	2104.0953	L	K	60	78
PSM	KVTSEELHYFVQNHFTSA	95	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=11350	25.602	3	2136.0276	2136.0276	G	R	199	217
PSM	KWFFDSSGGNGHALEHY	96	sp|Q92995-2|UBP13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=11075	25.113	3	1950.8649	1950.8649	G	R	168	185
PSM	REAEKSEDSSGAAGLSGLH	97	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6222	18.747	3	1899.8922	1899.8922	K	R	926	945
PSM	RHVVFTAETHNFPTGVCPFSGATTGTGG	98	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	17-UNIMOD:4	ms_run[2]:scan=10845	24.738	4	2904.3613	2904.3613	L	R	302	330
PSM	RIVKADEHVIDQGDDGDNFYVIE	99	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=10745	24.584	3	2646.2562	2646.2562	E	R	158	181
PSM	RLVQAFQFTDKHGEVCPAGW	100	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	16-UNIMOD:4	ms_run[2]:scan=11578	26.082	3	2345.1375	2345.1375	L	K	158	178
PSM	RNLHQSGFSLSGSQADDHIA	101	sp|O14531|DPYL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=8700	21.962	3	2139.0093	2139.0093	V	R	532	552
PSM	KKFYPLEIDYGQDEEAVK	102	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=10584	24.324608165066664	3	2171.078036	2171.078651	P	K	636	654
PSM	RKQTIDNSQGAYQEAFDISK	103	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=9343	22.77443109973333	3	2298.124784	2298.124038	D	K	138	158
PSM	RKDPTGMDPDDIWQLSSSLK	104	sp|Q15005|SPCS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	7-UNIMOD:35	ms_run[1]:scan=11625	26.17917099306667	3	2304.106799	2304.105612	H	R	145	165
PSM	KRDAEDAMDAMDGAVLDGREL	105	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	8-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=8599	21.83238728666667	3	2309.027750	2309.026375	D	R	65	86
PSM	KKINEELESQYQQSMDSKLSG	106	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	15-UNIMOD:35	ms_run[1]:scan=8437	21.644542512266664	3	2457.172559	2457.169334	D	R	74	95
PSM	RKEGFGLSENPFASLSPDEQKDE	107	sp|O15504|NUP42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=11679	26.29753292586667	3	2579.215835	2579.213976	N	K	91	114
PSM	RRPAGPELQTPPGKDGAVEDEEGEGEDGEE	108	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=7391	20.376861149066666	4	3149.403994	3149.402124	A	R	200	230
PSM	KAHDGGIYAISWSPDSTHLLSASGDKTS	109	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=11334	25.571	4	2900.3941	2900.3941	S	K	91	119
PSM	KEFGTNIKLGVIEDHSN	110	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9914	23.423	3	1899.969	1899.9690	W	R	486	503
PSM	KKLASQGDSISSQLGPIHPPP	111	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9366	22.798	3	2156.159	2156.1590	S	R	121	142
PSM	KKLLDEQEQEDEEASTGSHL	112	sp|Q9HAU5|RENT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7870	20.979	3	2285.0659	2285.0659	T	K	545	565
PSM	KLTQTSGETTHTHTEPTGDGKSM	113	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	23-UNIMOD:35	ms_run[2]:scan=3571	14.777	4	2459.1234	2459.1234	G	K	1291	1314
PSM	KQTTKSELLSQLQQHEEES	114	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9541	23.002	3	2242.1077	2242.1077	D	R	170	189
PSM	KSFPLHFDENSFFAGDK	115	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=11833	26.676	3	1984.9319	1984.9319	I	K	352	369
PSM	KVLQHYQESDKGEELGPGNVQ	116	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7199	20.133	3	2354.1503	2354.1503	G	K	90	111
PSM	RADAEKAQEQQQQMAELHS	117	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=6345	18.905	3	2197.0182	2197.0182	L	K	469	488
PSM	RAHPLQLEQSSDPSNSIDGPDHL	118	sp|Q9Y2L5-2|TPPC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9503	22.959	3	2512.1942	2512.1942	F	R	296	319
PSM	RDHINLPGFSGQNPLRGPNDE	119	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=10943	24.89	3	2332.1309	2332.1309	I	R	133	154
PSM	RGPAWVGSHGVLQHTQGLPAD	120	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=9632	23.104	3	2182.1032	2182.1032	D	R	64	85
PSM	RLAQQVCHAIANISDR	121	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:4	ms_run[2]:scan=10057	23.606	3	1850.9533	1850.9533	Y	R	810	826
PSM	RLGCHPQTGFADIQGHPFF	122	sp|P41743|KPCI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	4-UNIMOD:4	ms_run[2]:scan=11546	26.008	3	2184.0323	2184.0323	E	R	504	523
PSM	RLHNENAEMDSDSSSSGTETDLHGSL	123	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	9-UNIMOD:35	ms_run[2]:scan=7223	20.167	4	2804.1791	2804.1791	E	R	219	245
PSM	RQTESLESLLSKSQEHEQ	124	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=10122	23.684	3	2128.0396	2128.0396	A	R	429	447
PSM	RSHMMDVQGSTQDSAIKDFVL	125	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=10873	24.785	3	2396.11	2396.1100	P	K	370	391
PSM	RTHVNPMDEEENEVNHVNGEQEN	126	sp|Q8TAF3-4|WDR48_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	7-UNIMOD:35	ms_run[2]:scan=6017	18.477	3	2735.1478	2735.1478	P	R	394	417
PSM	RTSSAQVEGGVHSLHSYE	127	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7306	20.279	3	1942.9133	1942.9133	K	K	493	511
PSM	RTTHYTPLACGSNPLK	128	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	10-UNIMOD:4	ms_run[2]:scan=7805	20.896	2	1814.9098	1814.9098	V	R	65	81
PSM	RVAEPGAEATSSTGEESGSEHPPAVPMHNK	129	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	27-UNIMOD:35	ms_run[2]:scan=5677	18.035	4	3074.4	3074.4000	A	R	424	454
PSM	KGYPHLCSICDLPVHSN	130	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=9861	23.3698854984	3	1995.939338	1995.929502	P	K	287	304
PSM	KSEFNEPGEDFTEVHQNWNAHSSASEHA	131	sp|Q96HR8|NAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=9622	23.09479136266667	4	3184.359215	3183.355448	L	K	338	366
PSM	RAQLGGPEAAKSDETAAK	132	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=4465	16.3351690152	3	1798.916932	1798.917340	S	-	188	206
PSM	KKALGITLIKGIDEGPEGL	133	sp|Q8N335|GPD1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=11646	26.224052348	3	1951.135846	1951.135378	P	K	113	132
PSM	KKGIVDQSQQAYQEAFEISK	134	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=10478	24.169444790666667	3	2296.171363	2296.169926	D	K	138	158
PSM	KKLGEMWNNLNDSEKQPYIT	135	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	6-UNIMOD:35	ms_run[1]:scan=9447	22.89796151466667	3	2423.180885	2423.179111	A	K	125	145
PSM	RKDGNASGTTLLEALDCILPPTRPTD	136	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	17-UNIMOD:4	ms_run[1]:scan=12662	30.016235283466663	4	2810.423993	2810.423257	T	K	218	244
PSM	KKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAES	137	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	27-UNIMOD:35	ms_run[1]:scan=7343	20.321574171733335	4	3889.705168	3889.703193	A	R	733	770
PSM	KAKLEATLQEEAAIQQEH	138	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9149	22.537	3	2036.0538	2036.0538	N	R	463	481
PSM	KAPKPDGPGGGPGGSHMGGNYGDD	139	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5358	17.574	3	2223.9603	2223.9603	C	R	447	471
PSM	KFLQEHGSDSFLAEH	140	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9200	22.603	3	1743.8216	1743.8216	I	K	27	42
PSM	KGEDSVPDTVHHVVVPVNPKTD	141	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8200	21.367	4	2368.2023	2368.2023	L	R	304	326
PSM	KHDHEMEDCDTEMEVDSSQL	142	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	6-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=7014	19.866	3	2465.9257	2465.9257	S	R	586	606
PSM	KHSTPHAAFQPNSQIGEEMSQNSFI	143	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	19-UNIMOD:35	ms_run[2]:scan=9838	23.342	4	2800.2875	2800.2875	Q	K	113	138
PSM	KIHVYGYSMAYGPAQHAISTE	144	sp|Q9NRX4|PHP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	9-UNIMOD:35	ms_run[2]:scan=9336	22.764	3	2338.1052	2338.1052	K	K	87	108
PSM	KNFGPKGFGYGQGAGALVHAQ	145	sp|Q16527|CSRP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9590	23.061	4	2103.065	2103.0650	A	-	173	194
PSM	KQIYYSDKYFDEHYEY	146	sp|P33552|CKS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=10291	23.917	3	2189.9582	2189.9582	H	R	4	20
PSM	KSKDAAFQNVLTHVCLD	147	sp|Q8NBU5|ATAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	15-UNIMOD:4	ms_run[2]:scan=11344	25.592	3	1944.9727	1944.9727	K	-	345	362
PSM	KTEKQLEAIDQLHLEYA	148	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=10991	24.966	3	2028.0528	2028.0528	E	K	299	316
PSM	KTNHIGHTGYLNTVTVSPDGSLCASGG	149	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	23-UNIMOD:4	ms_run[2]:scan=9678	23.149	3	2742.3031	2742.3031	L	K	185	212
PSM	RDGQVINETSQHHDDLE	150	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5906	18.333	3	1991.8933	1991.8933	T	-	450	467
PSM	REYGSQEGKHDYDDSSEEQSAEI	151	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6830	19.587	3	2658.0954	2658.0954	P	R	46	69
PSM	RKTQTVCNFTDGALVQHQEWDG	152	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	7-UNIMOD:4	ms_run[2]:scan=10268	23.883	3	2589.203	2589.2030	G	K	81	103
PSM	RLKQDTYGDIYNFPIHAFD	153	sp|Q9BXY0|MAK16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=12148	27.7	3	2312.1226	2312.1226	E	K	169	188
PSM	RPENSLLEETLHFDHAV	154	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=12014	27.223	3	2005.9858	2005.9858	K	R	395	412
PSM	RPRPDPSPEIEGDLQPATHGS	155	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8106	21.258	3	2255.0931	2255.0931	S	R	145	166
PSM	RQQHQEEEDILDVRDE	156	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8687	21.945	3	2037.9352	2037.9352	K	K	382	398
PSM	RRSGGDGGDEVEGSGVGAGEGETVQHFPLA	157	sp|Q96DT7-3|ZBT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9948	23.46	4	2926.3442	2926.3442	S	R	35	65
PSM	RRSYDVPPPPMEPDHPFYSNIS	158	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=10630	24.399	3	2600.2118	2600.2118	W	K	116	138
PSM	RVLEVASGSGQHAAHFA	159	sp|Q96S19-3|MTL26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7487	20.495	3	1735.8754	1735.8754	V	R	30	47
PSM	KNKEDQYDHLDAADMT	160	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	15-UNIMOD:35	ms_run[1]:scan=6200	18.710870085333333	2	1908.810335	1908.815971	F	K	717	733
PSM	KKSSPSVKPAVDPAAA	161	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=5029	17.139738969866666	2	1551.862668	1551.862057	T	K	180	196
PSM	RDASTLQSQKAEGTGDAK	162	sp|O00479|HMGN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3623	14.846926716	3	1861.914315	1861.912983	N	-	73	91
PSM	KRDYTGCSTSESLSPVKQAP	163	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	7-UNIMOD:4	ms_run[1]:scan=7161	20.08003190506667	3	2210.066375	2210.063747	S	R	197	217
PSM	KRLDEELEDAEKNLGESEI	164	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=12015	27.2255540936	3	2216.081240	2216.080836	L	R	82	101
PSM	KKLGEMWNNTAADDKQPYE	165	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=8770	22.0504898992	3	2237.041863	2237.042283	A	K	127	146
PSM	RKEVVVYLDDNQKPPVGEGLN	166	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=9653	23.125687028	3	2368.241449	2368.238674	R	R	796	817
PSM	KRVQDLSAGGQGSLTDSGPER	167	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=6697	19.3838552904	3	2158.080931	2157.077423	N	R	483	504
PSM	RRPQYSNPPVQGEVMEGADNQGAGEQGRPV	168	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	15-UNIMOD:35	ms_run[1]:scan=7595	20.6294344992	4	3238.515883	3238.517386	G	R	204	234
PSM	KCKETPYSEEDFQHLQ	169	sp|Q9H081|MIS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	2-UNIMOD:4	ms_run[2]:scan=8551	21.78	3	2037.9102	2037.9102	D	K	103	119
PSM	KDIKGSYVSIHSSGF	170	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8813	22.11	3	1623.8257	1623.8257	K	R	32	47
PSM	KDVKGSYVSIHSSGF	171	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8408	21.614	3	1609.81	1609.8100	K	R	33	48
PSM	KEFTDHQETQAELQK	172	sp|Q9NSV4-2|DIAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5376	17.597	3	1830.8748	1830.8748	E	K	255	270
PSM	KEINNAHAILTDATK	173	sp|Q9H3Z4-2|DNJC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7687	20.745	3	1637.8737	1637.8737	F	R	58	73
PSM	KEVPEKLPEAADFGTTSSLHFVHM	174	sp|Q12849-5|GRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11603	26.13	4	2669.3159	2669.3159	P	R	220	244
PSM	KFHDPDSAVVAQHLTNTVFVD	175	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11314	25.54	3	2339.1546	2339.1546	V	R	82	103
PSM	KFSHEEIAMATVTALR	176	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:35	ms_run[2]:scan=9585	23.056	3	1818.9298	1818.9298	Q	R	243	259
PSM	KGMWSEGNGSHTIRDL	177	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:35	ms_run[2]:scan=8221	21.393	3	1802.837	1802.8370	K	K	161	177
PSM	KHCASQYSELLETTETPK	178	sp|Q9H0E9-4|BRD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=9215	22.621	3	2121.0048	2121.0048	Q	R	62	80
PSM	KHIANYISGIQTIGH	179	sp|Q15393-3|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9559	23.027	2	1650.8842	1650.8842	N	R	166	181
PSM	KHSQAVEELAEQLEQTK	180	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10848	24.743	3	1966.996	1966.9960	Q	R	1193	1210
PSM	KKLSSWDQAETPGHTPSL	181	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8986	22.345	3	1980.9905	1980.9905	P	R	213	231
PSM	KNKEQHLSENEPVDTNSDNNLFTDTDL	182	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10820	24.704	4	3116.417	3116.4170	W	K	502	529
PSM	KPVNAIIEHVRDGSVV	183	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10234	23.845	3	1731.9632	1731.9632	Q	R	193	209
PSM	KVAEAHENIIHGSGATG	184	sp|Q08257-2|QOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5164	17.331	3	1689.8434	1689.8434	E	K	170	187
PSM	KVHNDAQSFDYDHDAFLGAEEA	185	sp|O43852-12|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10463	24.148	3	2478.0724	2478.0724	D	K	37	59
PSM	KYQEEFEHFQQELDK	186	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10719	24.548	3	1996.9167	1996.9167	E	K	288	303
PSM	RAKEMDLVGLGLHPLFSS	187	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	5-UNIMOD:35	ms_run[2]:scan=11938	26.968	3	1985.0404	1985.0404	K	R	533	551
PSM	RAPVIWDNIHANDYDQK	188	sp|O60502-3|OGA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9927	23.435	3	2053.997	2053.9970	K	R	273	290
PSM	RDLIHTGVANDHEEDFEL	189	sp|Q9Y5L0-5|TNPO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10870	24.78	3	2108.9763	2108.9763	L	R	736	754
PSM	RENTQTTIKLFQECCPHSTD	190	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9493	22.948	3	2464.1111	2464.1111	L	R	147	167
PSM	RFPGYDSESKEFNAEVH	191	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9226	22.633	3	2010.9072	2010.9072	K	R	179	196
PSM	RFSGWYDADLSPAGHEEAK	192	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=10140	23.706	3	2134.9708	2134.9708	N	R	21	40
PSM	RGHDDLGDHYLDCGDLSNAL	193	sp|Q13098-5|CSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	13-UNIMOD:4	ms_run[2]:scan=11129	25.207	3	2241.9709	2241.9709	R	K	159	179
PSM	RGQTCVVHYTGMLEDGK	194	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	5-UNIMOD:4	ms_run[2]:scan=8732	22	3	1949.9088	1949.9088	K	K	19	36
PSM	RHESGASIKIDEPLEGSED	195	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8499	21.721	3	2067.9709	2067.9709	I	R	390	409
PSM	RHQGVMVGMGQKDSYVGDEAQS	196	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7886	20.998	3	2378.0743	2378.0743	P	K	39	61
PSM	RIAQNFGLQHLSSGHFL	197	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11455	25.825	3	1924.0068	1924.0068	Q	R	24	41
PSM	RIHQIGPGMVQQIQSVCMECQGHGE	198	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:35,17-UNIMOD:4,18-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=8697	21.958	3	2910.2993	2910.2993	I	R	161	186
PSM	RIHQIGPGMVQQIQSVCMECQGHGE	199	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	17-UNIMOD:4,18-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=10345	23.982	4	2894.3044	2894.3044	I	R	161	186
PSM	RKPLVLCGDLNVAHEEIDL	200	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	7-UNIMOD:4	ms_run[2]:scan=11677	26.292	3	2190.1467	2190.1467	S	R	202	221
PSM	RLCPTHADSLNNLANIK	201	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=9210	22.615	3	1935.9949	1935.9949	L	R	311	328
PSM	RPCHTTPDSQFGTEHVL	202	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	3-UNIMOD:4	ms_run[2]:scan=8529	21.756	3	1980.9112	1980.9112	P	R	633	650
PSM	RQQSHFAMMHGGTGFAGIDSSSPEV	203	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	8-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=9167	22.562	3	2665.1649	2665.1649	A	K	243	268
PSM	RQSQEASNHSSHTAQTPGI	204	sp|Q9NRX2|RM17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=4608	16.539	3	2034.9467	2034.9467	L	-	157	176
PSM	RSDLTVDAVKLHNELQSGSL	205	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11766	26.507	3	2181.139	2181.1390	G	R	48	68
PSM	RSQSSHSYDDSTLPLIDRNQ	206	sp|O60716-13|CTND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9151	22.539	3	2318.0887	2318.0887	S	K	798	818
PSM	RTIKVWQLGSSSPNFTLEGHE	207	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11461	25.836	3	2385.2077	2385.2077	D	K	136	157
PSM	RLEHSSFPEGPGPGSGDEANGPRGE	208	sp|O15020|SPTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7522	20.538641483200003	3	2536.138317	2535.137457	Q	R	2157	2182
PSM	REVKPEETTCSEHCLQ	209	sp|Q9Y5J7|TIM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	10-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=4948	17.019906208800002	3	2001.886047	2001.888425	T	K	39	55
PSM	KTYFPHFDLSHGSAQV	210	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=11036	25.045322357866667	3	1832.884442	1832.884583	T	K	41	57
PSM	KKIEVIKPGDLGVDLTS	211	sp|P38117|ETFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=10613	24.367174636266668	2	1811.041064	1811.040415	K	K	204	221
PSM	KKIFDIDEAEEGVKDL	212	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=11552	26.018005624533334	3	1847.952164	1847.951660	T	K	86	102
PSM	KKDASDDLDDLNFFNQK	213	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=11534	25.984682696	3	2011.948533	2011.948700	R	K	63	80
PSM	RRDEPTGEVLSLVGKLEGT	214	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=12269	28.210180557866668	3	2055.097304	2055.096033	T	R	32	51
PSM	KKMEIDLKDLEAQIEAAN	215	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	3-UNIMOD:35	ms_run[1]:scan=12026	27.2707556616	3	2074.061681	2074.061622	K	K	1620	1638
PSM	KKSEFLCCQDSFLQEIK	216	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=11336	25.574810592800002	3	2159.040117	2159.039112	M	K	954	971
PSM	RVVEKADSWVEKEEPAPSN	217	sp|Q8N163|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7960	21.090306499466667	3	2169.071109	2169.070212	Q	-	905	924
PSM	RKLEEVLSTEGAEENGNSDK	218	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7698	20.758098289333336	3	2204.053143	2204.055684	K	K	520	540
PSM	RKNDMDEPPSGDFGGDEEKS	219	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	5-UNIMOD:35	ms_run[1]:scan=5604	17.922596037866665	3	2224.917971	2224.917870	Q	R	576	596
PSM	KRPDFAQQQAMQQLTFDGK	220	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	11-UNIMOD:35	ms_run[1]:scan=8809	22.104579018133332	3	2252.097864	2252.100801	Y	R	28	47
PSM	KKSESEVEEAAAIIAQRPDNP	221	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=10923	24.849675578933333	3	2281.155889	2281.155004	M	R	270	291
PSM	KRDAEDAMDAMDGAVLDGREL	222	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	8-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=9141	22.526467884266665	3	2309.029030	2309.026375	D	R	65	86
PSM	RKLDDAIEDCTNAVKLDDTYI	223	sp|Q99615|DNJC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	10-UNIMOD:4	ms_run[1]:scan=11526	25.969003654133335	3	2467.191554	2467.190069	L	K	308	329
PSM	KKDEPKSGEEALIIPPDAVAVDC	224	sp|Q9Y287|ITM2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	23-UNIMOD:4	ms_run[1]:scan=10800	24.6738809016	3	2480.248149	2480.246856	A	K	16	39
PSM	KKIEPELDGSAQVTSHDASTNGLINFIKQQ	225	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=11633	26.196044025333332	4	3267.673754	3267.673535	A	R	523	553
PSM	KAIQDHLLEVEQSKDQME	226	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:35	ms_run[2]:scan=8483	21.7	3	2156.0419	2156.0419	N	K	322	340
PSM	KASEGESGGSMHTALSDLYLEHLLQK	227	sp|Q00013-3|EM55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:35	ms_run[2]:scan=11655	26.241	4	2816.3651	2816.3651	L	R	4	30
PSM	KDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEI	228	sp|P43487-2|RANG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11832	26.672	4	3932.7097	3932.7097	A	K	5	39
PSM	KESNEEEQVWHFLGK	229	sp|Q9H2U2-6|IPYR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11708	26.366	3	1858.885	1858.8850	N	-	218	233
PSM	KFAEYGEIKNIHLNLD	230	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11312	25.538	3	1902.984	1902.9840	D	R	91	107
PSM	KHASPILPITEFSDIPR	231	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11718	26.393	3	1920.0469	1920.0469	F	R	303	320
PSM	KHMSADDLNDGFVLDKDD	232	sp|P78316-2|NOP14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9943	23.453	3	2033.9	2033.9000	P	R	310	328
PSM	KHPDADSLYVEKIDVGEAEP	233	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10298	23.923	3	2211.0695	2211.0695	E	R	380	400
PSM	KHSSGIVADLSEQSLKDGEE	234	sp|Q15435-3|PP1R7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9613	23.083	3	2128.0284	2128.0284	K	R	34	54
PSM	KKDALLSALSIQNYHLECNET	235	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:4	ms_run[2]:scan=11855	26.727	3	2446.2162	2446.2162	R	K	934	955
PSM	KKISSIQSIVPALEIANAH	236	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11719	26.396	3	2018.1524	2018.1524	E	R	249	268
PSM	KKIWEQIQPDLHTNDECVATY	237	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:4	ms_run[2]:scan=10895	24.811	3	2587.2377	2587.2377	K	K	268	289
PSM	KKNGQHVASSPIPVVISQSEIGDAS	238	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10450	24.133	3	2547.3293	2547.3293	V	R	2016	2041
PSM	KLIQNNHYAMEDVATR	239	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:35	ms_run[2]:scan=6262	18.796	3	1917.9367	1917.9367	T	R	532	548
PSM	KMALNHPYFNDLDNQIK	240	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10299	23.926	3	2060.0149	2060.0149	G	K	222	239
PSM	KNHAVVCQGCHNAIDPEVQ	241	sp|Q9UGI8-2|TES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6500	19.111	3	2174.995	2174.9950	V	R	346	365
PSM	KPAEEQLDVGQSKDENIHTSHITQDEFQ	242	sp|Q03188-2|CENPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8689	21.947	4	3222.5065	3222.5065	A	R	428	456
PSM	KPFHTDNPSIQGQWHPFTN	243	sp|Q8N983-4|RM43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10301	23.928	3	2250.0606	2250.0606	R	K	117	136
PSM	KQHNSGPNSKPVVSFIAGLTAPPG	244	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11867	26.761	4	2402.2706	2402.2706	L	R	271	295
PSM	KQIFLGGVDKHTQFW	245	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11343	25.59	3	1802.9468	1802.9468	Y	R	96	111
PSM	KRPLDDGVGNQLGALVHQ	246	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10430	24.11	3	1916.0228	1916.0228	Q	R	57	75
PSM	KSHLVHGSSPGVMGTSVATSAS	247	sp|P35658-5|NU214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	13-UNIMOD:35	ms_run[2]:scan=5433	17.683	3	2112.027	2112.0270	A	K	1026	1048
PSM	KSTAVKALTGGIAHLF	248	sp|P09622-2|DLDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11745	26.458	3	1612.9301	1612.9301	Q	K	28	44
PSM	KSYCAEIAHNVSSKN	249	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:4	ms_run[2]:scan=6287	18.833	3	1706.8046	1706.8046	N	R	93	108
PSM	KTAHNSEADLEESFNEHELEPSSPKS	250	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9415	22.858	4	2911.3108	2911.3108	K	K	99	125
PSM	KTFITQQGIKSQHQT	251	sp|Q96CW1|AP2M1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5925	18.358	3	1743.9268	1743.9268	L	K	130	145
PSM	KTKGHLDAELDAYMAQTDPETND	252	sp|Q9Y3Y2-4|CHTOP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	14-UNIMOD:35	ms_run[2]:scan=8937	22.277	3	2578.1493	2578.1493	S	-	180	203
PSM	KVYNENLVHMIEHAQ	253	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:35	ms_run[2]:scan=9213	22.62	3	1839.8938	1839.8938	W	K	136	151
PSM	KVYNENLVHMIEHAQ	254	sp|O75934|SPF27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10744	24.582	3	1823.8989	1823.8989	W	K	136	151
PSM	KYDAGEHGLQEAEKGV	255	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7703	20.764	3	1729.8271	1729.8271	N	K	362	378
PSM	RAKFSAACGPPVTPECEHCGQ	256	sp|Q9NXH9-2|TRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	8-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=7052	19.923	3	2358.0304	2358.0304	A	R	340	361
PSM	RAPKEEADYEDDFLEYDQEHI	257	sp|Q9UPY3-2|DICER_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11614	26.152	3	2611.1351	2611.1351	W	R	1430	1451
PSM	REFGSVDDENKPIWMHAEE	258	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10460	24.144	3	2288.0168	2288.0168	E	R	414	433
PSM	RGFGHIGIAVPDVYSACK	259	sp|Q04760-2|LGUL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	17-UNIMOD:4	ms_run[2]:scan=10951	24.907	2	1945.9833	1945.9833	P	R	108	126
PSM	RGNFGGSFAGSFGGAGGHAPGVAR	260	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9584	23.055	4	2190.0467	2190.0467	E	K	588	612
PSM	RHLLNQAVGEEEVPKCSF	261	sp|Q9H0G5|NSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:4	ms_run[2]:scan=9410	22.854	3	2112.0422	2112.0422	Y	R	185	203
PSM	RHQGVMVGMGQKDSYVGDEAQS	262	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	9-UNIMOD:35	ms_run[2]:scan=6499	19.109	3	2394.0692	2394.0692	P	K	39	61
PSM	RIHYIGQNEPELLVAHAYT	263	sp|P30519-2|HMOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11016	25.014	3	2223.1437	2223.1437	E	R	108	127
PSM	RKPTDGASSSNCVTDISHLV	264	sp|P49321-2|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	12-UNIMOD:4	ms_run[2]:scan=10232	23.841	3	2143.0328	2143.0328	S	R	358	378
PSM	RLQQLGEAHQAETEVLR	265	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8759	22.036	3	1977.0392	1977.0392	A	R	770	787
PSM	RNKETLGSEAVSSNVIDYGHAS	266	sp|Q14966-2|ZN638_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8967	22.319	3	2333.1248	2333.1248	S	K	194	216
PSM	RQFQDAGHFDAENIK	267	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8066	21.212	3	1774.8387	1774.8387	A	K	742	757
PSM	RVHIPNDDAQFDASHCDSD	268	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	16-UNIMOD:4	ms_run[2]:scan=7857	20.965	3	2197.9083	2197.9083	A	K	82	101
PSM	KELNSNHDGADETSEKEQQEAIEHIDEVQNEID	269	sp|Q01105-2|SET_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=11323	25.553927457866667	4	3792.676387	3792.683444	K	R	11	44
PSM	KHNELTGDNVGPLILK	270	sp|Q8N5K1|CISD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=9886	23.394901784	3	1746.973665	1746.962834	N	K	116	132
PSM	KQATYGYYLGNPAEFHDSSDHHTF	271	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=10394	24.060695372266665	4	2784.220759	2784.220458	Y	K	141	165
PSM	KKSYLSGGAGAAGGGGADPGNK	272	sp|P25490|TYY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4818	16.8347053456	3	1918.956258	1918.949703	G	K	182	204
PSM	RKGSLESPATDVFGSTEEGEK	273	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=8894	22.2129533952	3	2223.065779	2223.065521	L	R	329	350
PSM	KKKEGVILTNESAASTGQPDNDVTEGQ	274	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7277	20.248055801333333	4	2815.383027	2815.383560	E	R	710	737
PSM	KKKEDDDGEIDDGEIDDDDLEEGEV	275	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=9864	23.3719457072	3	2821.187695	2821.178497	E	K	186	211
PSM	KDWIQHQNTSTHIESC	276	sp|Q14966-2|ZN638_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:4	ms_run[2]:scan=7154	20.072	3	1982.8905	1982.8905	L	R	439	455
PSM	KGAVDGGLSIPHSTK	277	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7067	19.944	2	1465.7889	1465.7889	L	R	164	179
PSM	KGGASIIQCHILNDK	278	sp|Q8TAF3-4|WDR48_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	9-UNIMOD:4	ms_run[2]:scan=8684	21.942	3	1652.8668	1652.8668	I	R	276	291
PSM	KHAAENPGKYNILGTNTIMD	279	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10078	23.639	3	2186.079	2186.0790	T	K	497	517
PSM	KHIYYITGETKDQVANSAFVE	280	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9706	23.181	4	2412.1961	2412.1961	Q	R	489	510
PSM	KICDQWDALGSLTHSR	281	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=11244	25.427	3	1885.9105	1885.9105	Q	R	278	294
PSM	KKDQVTAQEIFQDNHEDGPTA	282	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9123	22.507	3	2370.1088	2370.1088	K	K	544	565
PSM	KLREQTLSPTITSGLHNIA	283	sp|O94979-6|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10134	23.699	3	2078.1484	2078.1484	D	R	1003	1022
PSM	KMALNHPYFNDLDNQIK	284	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	2-UNIMOD:35	ms_run[2]:scan=9609	23.079	3	2076.0099	2076.0099	G	K	222	239
PSM	KMEEDPDDVPHGHITSLAVK	285	sp|P41227-2|NAA10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8332	21.52	4	2217.0736	2217.0736	A	R	59	79
PSM	KNAIKVNNVNGNQVGHL	286	sp|Q14527|HLTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7348	20.327	3	1817.986	1817.9860	D	K	95	112
PSM	KNIHLWTPTDGGSWHVDQ	287	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10877	24.79	3	2089.997	2089.9970	Q	R	237	255
PSM	KPIHQGPDAAVTGHI	288	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6678	19.36	3	1539.8158	1539.8158	E	R	913	928
PSM	KQCEAHLGHVFPDGPGPNGQ	289	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=8342	21.532	3	2143.9858	2143.9858	C	R	147	167
PSM	KSIEAVHEDIRVLSEDAI	290	sp|P23919-2|KTHY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=11315	25.541	3	2023.0586	2023.0586	S	R	158	176
PSM	KTLNGGSDAQDGNQPQHNGESNEDSKDNHEAST	291	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=3526	14.73	4	3480.4646	3480.4646	S	K	476	509
PSM	KVSDILHSIFSSYKE	292	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=12525	29.433	3	1751.9094	1751.9094	T	K	781	796
PSM	KYDEELEGERPHSF	293	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8198	21.365	3	1734.7849	1734.7849	S	R	336	350
PSM	RAAETHFGFETVSEEEKGG	294	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9037	22.403	3	2079.9498	2079.9498	K	K	48	67
PSM	RFVPQEMGVHTVSVKY	295	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35	ms_run[2]:scan=8674	21.927	3	1891.9615	1891.9615	V	R	2091	2107
PSM	RGQTCVVHYTGMLEDGK	296	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=7406	20.396	3	1965.9037	1965.9037	K	K	19	36
PSM	RGSQIDSHSSNSNYHDSWET	297	sp|Q5T200-2|ZC3HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6827	19.58	3	2305.9584	2305.9584	S	R	579	599
PSM	RGSSYGVTSTESYKETLH	298	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7387	20.373	3	2000.9439	2000.9439	A	K	824	842
PSM	RHCDEVGFNAEEAHNIV	299	sp|P51808|DYLT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:4	ms_run[2]:scan=9367	22.798	3	1995.8857	1995.8857	H	K	6	23
PSM	RLDSDQQHNLQEHSTTSV	300	sp|Q5VWQ0|RSBN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5974	18.418	3	2093.9726	2093.9726	S	-	785	803
PSM	RLQPLLNHLSHSYTGQDYSTQGNVG	301	sp|P49643|PRI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10279	23.899	3	2784.358	2784.3580	E	K	245	270
PSM	RNLHQSGFSLSGAQIDDNIPR	302	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10248	23.859	4	2324.1622	2324.1622	V	R	496	517
PSM	RQLIVPPHLAHGESGA	303	sp|Q96AY3-2|FKB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8322	21.508	3	1680.906	1680.9060	R	R	225	241
PSM	RQVQHEESTEGEADHSGYAGELGF	304	sp|Q92890-3|UFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9763	23.253	4	2632.1426	2632.1426	E	R	202	226
PSM	RRQTNNQNWGSQPIAQQPLQGGDHSGNYGY	305	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9368	22.799	4	3370.5576	3370.5576	K	K	577	607
PSM	RSHTEEDCTEELFDFLHA	306	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	8-UNIMOD:4	ms_run[2]:scan=12479	29.214	3	2234.9539	2234.9539	S	R	60	78
PSM	RSLHDALCVLAQTVKDS	307	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	8-UNIMOD:4	ms_run[2]:scan=12377	28.713	3	1911.9836	1911.9836	E	R	341	358
PSM	RSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTH	308	sp|P49336-2|CDK8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	22-UNIMOD:35	ms_run[2]:scan=6975	19.812	5	4223.874	4223.8740	Q	R	423	462
PSM	RSNQLFNGHGGHIMPPTQSQFGEMGG	309	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	14-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=9272	22.691	3	2815.2555	2815.2555	H	K	402	428
PSM	RVTHETSAHEGQTEAPSIDE	310	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=5311	17.509	3	2192.9934	2192.9934	I	K	145	165
PSM	RYGDGGSSFQSTTGHCVHM	311	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:4	ms_run[2]:scan=7780	20.855	3	2082.8636	2082.8636	H	R	275	294
PSM	RYGDGGSTFQSTTGHCVHM	312	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:4	ms_run[2]:scan=7893	21.007	3	2096.8793	2096.8793	H	R	275	294
PSM	KAYFHLLNQIAPKGQ	313	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=10432	24.113193414933335	3	1727.943803	1726.951875	S	K	300	315
PSM	RHGSGADSDYENTQSGDPLLGLEGK	314	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=10184	23.760474409066667	3	2603.191366	2602.189552	S	R	589	614
PSM	RIVFSGNLFQHQEDSK	315	sp|Q96TA1|NIBA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=10338	23.972437567733333	3	1904.956070	1903.954060	E	K	68	84
PSM	RAVHGVEETSSEVKPPNE	316	sp|Q7Z6I8|CE024_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=5875	18.285700006933332	3	1964.963272	1963.959933	G	-	171	189
PSM	KKILDSVGIEADDDRLN	317	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=9442	22.894526228533334	3	1899.989912	1899.990171	I	K	24	41
PSM	KKTTDTASVQNEAKLDEIL	318	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=10117	23.6780583008	3	2103.103233	2103.105929	P	K	427	446
PSM	KKAMEGAGTDEKALIEILAT	319	sp|P08133|ANXA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	4-UNIMOD:35	ms_run[1]:scan=11831	26.6702719968	3	2104.109609	2104.108572	L	R	445	465
PSM	RNNEVWLIQKNEPTKENE	320	sp|Q9Y5Z4|HEBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=8905	22.228636629333334	3	2240.118255	2240.118559	N	-	188	206
PSM	KKDTCYSPKPSVYLSTPSSAS	321	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	5-UNIMOD:4	ms_run[1]:scan=8226	21.397542048800002	3	2302.114906	2302.115114	L	K	536	557
PSM	RRPQYSNPPVQGEVMEGADNQGAGEQGRPV	322	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=8525	21.75041256613333	4	3223.508503	3222.522471	G	R	204	234
PSM	KCFEKNEAIQAAHDAVAQEGQC	323	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=9191	22.592	4	2503.122	2503.1220	A	R	131	153
PSM	KDCGATWVVLGHSER	324	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4	ms_run[2]:scan=9297	22.719	3	1713.8257	1713.8257	I	R	85	100
PSM	KDLFDPIIEDRHGGY	325	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=11079	25.122	3	1773.8686	1773.8686	F	K	86	101
PSM	KFVIHCNSPVWGADKCEELLE	326	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=11228	25.385	4	2530.1985	2530.1985	A	K	268	289
PSM	KHCIMQANAEYHQSILA	327	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4	ms_run[2]:scan=8711	21.976	3	2012.9561	2012.9561	A	K	248	265
PSM	KKAVTDTHENGDLGTASETPLDDGAS	328	sp|Q9HD26-2|GOPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7519	20.533	3	2628.2151	2628.2151	N	K	415	441
PSM	KKNEALPSAHGTPASASALPEP	329	sp|O95696|BRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8206	21.374	3	2172.1175	2172.1175	K	K	99	121
PSM	KLQDLQGEKDALHSE	330	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7405	20.394	3	1709.8584	1709.8584	Q	K	503	518
PSM	KLREIELLCQEHGQENDDLVQ	331	sp|Q15555-4|MARE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	9-UNIMOD:4	ms_run[2]:scan=10576	24.311	3	2565.2493	2565.2493	G	R	218	239
PSM	KNCLTNFHGMDLTRD	332	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=7972	21.104	3	1836.8247	1836.8247	G	K	94	109
PSM	KNQTAEKEEFEHQQ	333	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4262	16.071	3	1744.8016	1744.8016	D	K	583	597
PSM	KNTHATTHNAYDLEVIDIF	334	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=12229	28.036	3	2201.0753	2201.0753	V	K	819	838
PSM	KSLLEQYHLGLDQK	335	sp|P08236-3|BGLR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=10809	24.687	3	1670.8992	1670.8992	Q	R	417	431
PSM	KTHVHIGEGPSTISNSTIPENATSSG	336	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8150	21.309	3	2620.2729	2620.2729	Q	R	527	553
PSM	KTQNDVLHAENVKAG	337	sp|P35241-3|RADI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5650	17.996	3	1622.8376	1622.8376	K	R	140	155
PSM	KVVVHKETEITPEDGED	338	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5663	18.015	3	1923.9426	1923.9426	T	-	849	866
PSM	RAHSSMVGVNLPQKAGGFLM	339	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	20-UNIMOD:35	ms_run[2]:scan=10424	24.1	3	2115.0717	2115.0717	H	K	143	163
PSM	RDFTVSAMHGDMDQKE	340	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5244	17.423	3	1897.7935	1897.7935	A	R	295	311
PSM	RDHAVVVGVYRPPP	341	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7817	20.921	2	1560.8525	1560.8525	E	K	304	318
PSM	RDKTSDLVEEYFEAHSSS	342	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=11807	26.611	3	2098.9443	2098.9443	K	K	233	251
PSM	RETHMMGNEEETEFHGL	343	sp|Q8IUF8-4|RIOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8334	21.521	3	2077.847	2077.8470	S	R	400	417
PSM	RFDFGEDSEHSEEPK	344	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7861	20.969	3	1807.7649	1807.7649	D	K	266	281
PSM	RHLSCTVGDLQTKIDGLE	345	sp|Q96T51-3|RUFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:4	ms_run[2]:scan=10555	24.277	3	2041.0262	2041.0262	N	K	316	334
PSM	RHQGVMVGMGQKDSYVGDEAQS	346	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:35	ms_run[2]:scan=7109	20.003	3	2394.0692	2394.0692	P	K	39	61
PSM	RHSSNPPLESHVGWVMDS	347	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	16-UNIMOD:35	ms_run[2]:scan=8785	22.071	3	2049.9327	2049.9327	T	R	744	762
PSM	RHVVSCSSQDSTHCAENLL	348	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=8044	21.187	3	2198.9797	2198.9797	L	K	7	26
PSM	RIPHEPVINSSNVHVGS	349	sp|Q14966-2|ZN638_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8080	21.23	3	1840.9544	1840.9544	E	R	350	367
PSM	RKLTATPTPLGGMTGFHMQTED	350	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	13-UNIMOD:35	ms_run[2]:scan=9520	22.978	3	2404.1515	2404.1515	A	R	429	451
PSM	RKMADPQSIQESQNLSMFLANHN	351	sp|Q7L576|CYFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=10865	24.771	3	2690.2541	2690.2541	L	K	196	219
PSM	RLGWDPKPGEGHLDALL	352	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=11630	26.191	3	1872.9846	1872.9846	E	R	689	706
PSM	RLLIHQSLAGGIIGVKGA	353	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=10606	24.358	3	1802.089	1802.0890	L	K	124	142
PSM	RLQFHDVAGDIFHQQC	354	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	16-UNIMOD:4	ms_run[2]:scan=11277	25.48	3	1969.9217	1969.9217	V	K	370	386
PSM	RNDTKEDVFVHQTAI	355	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8668	21.919	2	1771.8853	1771.8853	N	K	109	124
PSM	RPLQPEYVALPSEESHVHQEPSK	356	sp|O94806-2|KPCD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8569	21.8	4	2656.3245	2656.3245	P	R	226	249
PSM	RQAGEVTYADAHKE	357	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4402	16.25	2	1573.7485	1573.7485	M	R	131	145
PSM	RQLFHPEQLITGKEDAANNYA	358	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=10761	24.612	3	2414.1979	2414.1979	Y	R	49	70
PSM	RQNVAYEYLCHLEEAK	359	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	10-UNIMOD:4	ms_run[2]:scan=11528	25.975	3	2021.9629	2021.9629	R	R	36	52
PSM	RRSYDVPPPPMEPDHPFYSNIS	360	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:35	ms_run[2]:scan=9908	23.417	3	2616.2067	2616.2067	W	K	116	138
PSM	RTGQPMIHIYLDKETG	361	sp|Q01844-2|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:35	ms_run[2]:scan=9027	22.391	3	1873.9356	1873.9356	K	K	319	335
PSM	RTLSDYNIQKESTLHLVL	362	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=11598	26.123	3	2129.1481	2129.1481	G	R	54	72
PSM	RVSALNSVHCEHVEDEGES	363	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	10-UNIMOD:4	ms_run[2]:scan=6632	19.285	3	2152.9444	2152.9444	K	R	1682	1701
PSM	KGHYTEGAELVDSVLDVVR	364	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=11825	26.65843243413333	3	2087.073898	2086.069484	A	K	103	122
PSM	KLHNMIVDLDNVVK	365	sp|Q16891|MIC60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	5-UNIMOD:35	ms_run[1]:scan=9755	23.24218610426667	2	1652.902580	1652.891977	G	K	330	344
PSM	RGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSS	366	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	4-UNIMOD:35	ms_run[1]:scan=12357	28.6184280336	7	6860.3755	6860.3703	N	K	44	108
PSM	RPENSLLEETLHFDHAV	367	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=11992	27.1459334192	3	2005.987081	2005.985754	K	R	395	412
PSM	KKALAAAGYDVEKNNS	368	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5493	17.763011905866666	3	1677.868065	1677.868599	L	R	66	82
PSM	KCCLTYCFNKPEDK	369	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:4,3-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=7970	21.10223352426667	3	1861.814925	1861.816112	G	-	143	157
PSM	KKADSVANQGTKVEGITNQG	370	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5785	18.161896795733334	3	2044.053959	2044.054896	G	K	548	568
PSM	RKPYVLNDLEAEASLPEK	371	sp|Q9Y3C1|NOP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=10760	24.609456324266667	3	2071.096707	2071.094970	V	K	89	107
PSM	KRVEAAQETVADYQQTIK	372	sp|Q14203|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=8104	21.2563304376	3	2077.081748	2077.080383	Q	K	501	519
PSM	KKFYPLEIDYGQDEEAVK	373	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=10805	24.682116521333334	3	2171.078036	2171.078651	P	K	636	654
PSM	KKEEEEEEEEYDEGSNLK	374	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6183	18.690909806933334	3	2212.947161	2212.949547	E	K	229	247
PSM	KRPDFAQQQAMQQLTFDGK	375	sp|Q9C0J8|WDR33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=10061	23.611644276533333	3	2236.107598	2236.105886	Y	R	28	47
PSM	KKGLDWVKEEAPDILCLQET	376	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	16-UNIMOD:4	ms_run[1]:scan=12080	27.451560702133335	3	2371.207896	2371.209348	K	K	78	98
PSM	KANGTTVHVGIHPS	377	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5466	17.731	2	1416.7474	1416.7474	E	K	89	103
PSM	KAQQNNVEHKVETFSGVY	378	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9248	22.664	3	2077.0229	2077.0229	D	K	160	178
PSM	KCSALATQYMHCVNHA	379	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4,10-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6700	19.389	3	1905.8284	1905.8284	L	K	203	219
PSM	KEHLLQSNIGTGEKELGL	380	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10560	24.287	3	1965.0531	1965.0531	E	R	808	826
PSM	KFLQEHLAPKAQEID	381	sp|P26440|IVD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8393	21.594	3	1765.9363	1765.9363	A	R	58	73
PSM	KGKILFIFIDSDHTDNQ	382	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11882	26.803	3	1990.016	1990.0160	F	R	283	300
PSM	KHIYYITGETKDQVANSAFVE	383	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9655	23.127	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHIYYITGETKDQVANSAFVE	384	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=12542	29.507	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHLAGLGLTEAIDKN	385	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9134	22.519	3	1578.873	1578.8730	Q	K	319	334
PSM	KKQFSLENVQEGEILHDA	386	sp|O75113|N4BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10723	24.554	3	2084.0538	2084.0538	T	K	296	314
PSM	KLHETVDATSETHIYQV	387	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8675	21.928	3	1969.9745	1969.9745	P	R	592	609
PSM	KLKGEMMDLQHGSLFL	388	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11808	26.614	3	1845.9481	1845.9481	D	R	57	73
PSM	KLLEAFHNQGPVIK	389	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9171	22.566	3	1592.9039	1592.9039	H	R	208	222
PSM	KNKEDQYDHLDAADMT	390	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:35	ms_run[2]:scan=6124	18.613	3	1908.816	1908.8160	F	K	717	733
PSM	KPPNAFVEGSHGIH	391	sp|P63010-3|AP2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6935	19.736	3	1488.7474	1488.7474	H	R	519	533
PSM	KQIATLHAQVADMK	392	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	13-UNIMOD:35	ms_run[2]:scan=5598	17.916	3	1568.8345	1568.8345	E	K	1357	1371
PSM	KSKEEYQQTWYHEGPNSL	393	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9358	22.789	3	2223.0233	2223.0233	K	K	156	174
PSM	KSYEALVQHVIEDHE	394	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11569	26.062	3	1795.8741	1795.8741	P	R	231	246
PSM	KTLNGGSDAQDGNQPQHNGESNEDSKDNHEAST	395	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3598	14.807	4	3480.4646	3480.4646	S	K	476	509
PSM	KTVTIENHPHLPPPPMCSVHPC	396	sp|Q9NT62-2|ATG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:35,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=8260	21.436	4	2563.2134	2563.2134	K	R	243	265
PSM	KYNAPTSHVTPSVK	397	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5133	17.282	3	1527.8045	1527.8045	L	K	563	577
PSM	RAHLDHIPDYTPPLLTTISPEQESDE	398	sp|Q8N2M8-3|CLASR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=12001	27.177	4	2973.4356	2973.4356	V	R	83	109
PSM	RASPGHSPHYFAASSPTSPNALPPA	399	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8690	21.948	3	2516.2197	2516.2197	P	R	1846	1871
PSM	RDLIGHIVEFSQDQHGS	400	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11047	25.061	3	1936.9391	1936.9391	L	R	646	663
PSM	RDVFLPKPTWGNHTPIF	401	sp|P00505-2|AATM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11961	27.039	3	2024.0632	2024.0632	S	R	110	127
PSM	REIAGHIMEFSQDQHGS	402	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	8-UNIMOD:35	ms_run[2]:scan=7285	20.258	3	1956.8748	1956.8748	L	R	821	838
PSM	RFPPEASGYLHIGHA	403	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10024	23.551	3	1650.8267	1650.8267	V	K	201	216
PSM	RGDFFYHSENPKYPEVGDL	404	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11235	25.4	3	2269.044	2269.0440	R	R	221	240
PSM	RGVKGTTGTQASFLQLFEGDDH	405	sp|P30566-2|PUR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=12184	27.84	4	2363.1506	2363.1506	F	K	196	218
PSM	RHQGVMVGMGQKDSYVGDEAQS	406	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5741	18.111	3	2410.0642	2410.0642	P	K	39	61
PSM	RIAVDEVHCCSQWGHDF	407	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10131	23.695	3	2114.9051	2114.9051	T	R	215	232
PSM	RLEHVVEEEKVDISEDGM	408	sp|P40937-2|RFC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	18-UNIMOD:35	ms_run[2]:scan=8536	21.763	3	2128.9947	2128.9947	P	K	164	182
PSM	RLLSDATVEKDESHAG	409	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6714	19.408	3	1726.8486	1726.8486	V	K	289	305
PSM	RLNPTWNHPDQDTEAGFK	410	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8586	21.82	3	2124.9977	2124.9977	A	R	201	219
PSM	RLSFQHDPETSVLVLR	411	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10762	24.613	3	1896.0217	1896.0217	S	K	914	930
PSM	RPLILQLVHVSQEDK	412	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=11457	25.827	3	1774.0101	1774.0101	R	R	61	76
PSM	RPLPSASQKAGENQEH	413	sp|Q8ND56-3|LS14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=3742	14.975	3	1747.8602	1747.8602	T	R	180	196
PSM	RQDLAQLMNSSGSHKDLAG	414	sp|Q9BT78-2|CSN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	8-UNIMOD:35	ms_run[2]:scan=7226	20.172	3	2042.9804	2042.9804	V	K	6	25
PSM	RQLLQEQESVKQAHL	415	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8252	21.426	3	1805.9748	1805.9748	R	R	1666	1681
PSM	RQQSHFAMMHGGTGFAGIDSSSPEV	416	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:35	ms_run[2]:scan=9804	23.305	3	2649.17	2649.1700	A	K	243	268
PSM	RSDVTHHAVTSQLPQVPAGAGS	417	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8248	21.422	3	2214.1141	2214.1141	S	R	1719	1741
PSM	RSGCAASHFAVQECMAQHQDW	418	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	4-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=8846	22.152	4	2491.0216	2491.0216	S	R	31	52
PSM	RTLIENGEKITSLH	419	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8740	22.012	3	1609.8788	1609.8788	D	R	363	377
PSM	RVCEVCSAYLGLHDNDR	420	sp|Q9NQ29-2|LUC7L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8921	22.253	3	2062.9313	2062.9313	L	R	188	205
PSM	RVILDEGHAIRNPNAQQT	421	sp|Q14527|HLTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7356	20.335	3	2031.061	2031.0610	L	K	553	571
PSM	RLESEKQELQEQLDLQH	422	sp|Q9Y6D9|MD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=9534	22.993810808533333	3	2122.073548	2122.065461	K	K	182	199
PSM	KKSIQSGPLKISSVSEVM	423	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	18-UNIMOD:35	ms_run[1]:scan=8588	21.821691363733333	3	1933.055009	1933.055414	P	K	101	119
PSM	KKYEQGFITDPVVLSPKD	424	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=10334	23.9678775584	3	2063.095461	2063.093908	V	R	108	126
PSM	RKTASVLSKDDVAPESGDTTV	425	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7542	20.564412061333332	3	2175.101769	2175.101906	A	K	310	331
PSM	KKINETFVDKDFVPYQDI	426	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=11432	25.779246738399998	3	2198.125711	2198.125936	I	R	137	155
PSM	RKDLLVENVPYCDAPTQKQ	427	sp|Q5U5X0|LYRM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	12-UNIMOD:4	ms_run[1]:scan=9243	22.6567256032	3	2273.146548	2273.147417	P	-	86	105
PSM	KRPTSNGVVSSPNSTSRPTLPV	428	sp|Q7Z422|SZRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8272	21.448772943999998	3	2280.218732	2280.218608	L	K	64	86
PSM	KKPLPDHVSIVEPKDEILPTTPISEQ	429	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=10480	24.171592529599998	4	2909.576649	2909.574990	P	K	201	227
PSM	KKIKGSSPGIQDTLEAEDGAFETDEAPED	430	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=10513	24.216659189066668	4	3076.434175	3076.436050	P	R	235	264
PSM	KKAKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAES	431	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=9512	22.9693318176	4	3873.711250	3873.708278	A	R	733	770
PSM	KAFIAHFQDNLHSVN	432	sp|Q6P2C8-4|MED27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9540	23.001	3	1739.8744	1739.8744	E	R	50	65
PSM	KCGHETQETKDLSMST	433	sp|Q9Y3S2|ZN330_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=4080	15.605	3	1866.8088	1866.8088	P	R	215	231
PSM	KDHIPITDSPVVVQQHMLPPK	434	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:35	ms_run[2]:scan=8568	21.799	4	2394.273	2394.2730	N	K	419	440
PSM	KEAYPTPTKDLHQPSLSPASPHSQGFE	435	sp|Q9BZF1-3|OSBL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8851	22.159	4	2948.4305	2948.4305	G	R	7	34
PSM	KFDPYEHEALFHTPVEGKEPGTVALVS	436	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11303	25.522	4	2996.492	2996.4920	A	K	169	196
PSM	KFVAKENEVQSLHS	437	sp|Q86UP2-3|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6389	18.964	3	1614.8366	1614.8366	S	K	521	535
PSM	KGSPIDVLHGLIR	438	sp|O95785-3|WIZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11942	26.979	3	1403.8249	1403.8249	A	R	258	271
PSM	KGVQLQTHPNVDK	439	sp|P48444-2|COPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5106	17.251	2	1462.7892	1462.7892	K	K	235	248
PSM	KGVVHDDMECSHYM	440	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:35,10-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=4267	16.081	2	1738.6749	1738.6749	G	K	348	362
PSM	KHAAENPGKYNILGTNTIMD	441	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	19-UNIMOD:35	ms_run[2]:scan=9138	22.524	3	2202.0739	2202.0739	T	K	497	517
PSM	KHLFLTSKPMVYLVNLSE	442	sp|Q9NTK5-3|OLA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:35	ms_run[2]:scan=11545	26.006	3	2134.1496	2134.1496	N	K	216	234
PSM	KHMSADDLNDGFVLDKDD	443	sp|P78316-2|NOP14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:35	ms_run[2]:scan=9388	22.827	3	2049.8949	2049.8949	P	R	310	328
PSM	KHSLDASQGTATGPRGIFT	444	sp|O00330-3|ODPX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8562	21.792	3	1942.9861	1942.9861	E	K	179	198
PSM	KHVVQSISTQQEKETIA	445	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6201	18.712	3	1925.0218	1925.0218	E	K	221	238
PSM	KIECEIKINHEGEVN	446	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:4	ms_run[2]:scan=7392	20.378	3	1810.8883	1810.8883	G	R	113	128
PSM	KIEPHHTAVLGEGDSVQVEN	447	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7516	20.53	3	2158.0655	2158.0655	Q	K	211	231
PSM	KIVKEAYPDHTQFE	448	sp|Q9P016-2|THYN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7243	20.196	3	1703.8519	1703.8519	M	K	128	142
PSM	KKAQDALPFFMMHLGYE	449	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=11610	26.145	3	2056.9751	2056.9751	R	K	1036	1053
PSM	KKASSEGGTAAGAGLDSLH	450	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6295	18.84	3	1755.8751	1755.8751	D	K	307	326
PSM	KKIEYYLEEEQGPADHPS	451	sp|Q9BYV8|CEP41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8771	22.053	3	2132.0062	2132.0062	L	R	308	326
PSM	KKLTQIQESQVTSHN	452	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5310	17.508	2	1739.9166	1739.9166	K	K	250	265
PSM	KKTETAAHSLPQQT	453	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4094	15.641	2	1538.8053	1538.8053	E	K	207	221
PSM	KLDAFIEALHQEK	454	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11061	25.084	3	1540.8249	1540.8249	E	-	912	925
PSM	KLDKAQIHDLVLVGGST	455	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10293	23.919	3	1793.0047	1793.0047	A	R	325	342
PSM	KLHQVVETSHEDLPASQE	456	sp|O43683-2|BUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6710	19.402	3	2046.0018	2046.0018	K	R	299	317
PSM	KLISSDGHEFIVK	457	sp|Q15369-2|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8582	21.815	3	1471.8035	1471.8035	V	R	4	17
PSM	KLITQTFSHHNQLAQ	458	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7781	20.856	3	1764.9271	1764.9271	E	K	53	68
PSM	KNEKGQYISPFHDIPIYAD	459	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11530	25.978	3	2234.1008	2234.1008	L	K	22	41
PSM	KNLTELEDEHLAK	460	sp|O15381-5|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7859	20.967	3	1538.794	1538.7940	L	R	73	86
PSM	KNNISSGHVPHGPLT	461	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6735	19.447	3	1556.8059	1556.8059	L	R	392	407
PSM	KQEGHNLGLLHGDMDQSE	462	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	14-UNIMOD:35	ms_run[2]:scan=7201	20.136	3	2022.9065	2022.9065	L	R	400	418
PSM	KQEYDESGPSIVHR	463	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6060	18.535	3	1643.7903	1643.7903	S	K	359	373
PSM	KQLYESLMAAHASRD	464	sp|Q4VC31|CCD58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:35	ms_run[2]:scan=7561	20.592	3	1734.8359	1734.8359	C	R	54	69
PSM	KRIVITGDGDIDHDQALAQAI	465	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10536	24.249	3	2248.1812	2248.1812	E	R	956	977
PSM	KSDSHGPKEDGGF	466	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4489	16.367	2	1359.6055	1359.6055	L	R	381	394
PSM	KSHLVHGSSPGVMGTSVATSAS	467	sp|P35658-5|NU214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7028	19.89	3	2096.0321	2096.0321	A	K	1026	1048
PSM	KVAHSFNCTPIEGMLSHQL	468	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4	ms_run[2]:scan=11570	26.064	3	2168.0507	2168.0507	N	K	118	137
PSM	KVKQIGGGIQSITYTHNGDIS	469	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8881	22.198	3	2215.1597	2215.1597	S	R	1087	1108
PSM	KVLHEAEGHIVTCETNTGEVY	470	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	13-UNIMOD:4	ms_run[2]:scan=8313	21.498	3	2385.1271	2385.1271	I	R	8	29
PSM	KVQQLLHICSEHFDS	471	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	9-UNIMOD:4	ms_run[2]:scan=9793	23.294	3	1839.8938	1839.8938	L	K	449	464
PSM	KVVEVLAGHGHLYS	472	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8494	21.715	3	1507.8147	1507.8147	M	R	1241	1255
PSM	KYCVEEEEKAAEMH	473	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=6519	19.138	3	1767.7444	1767.7444	V	K	78	92
PSM	KYDEELEGERPHSF	474	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8171	21.333	3	1734.7849	1734.7849	S	R	336	350
PSM	KYLGVPKYWGSGLHD	475	sp|Q99986|VRK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10292	23.918	3	1718.878	1718.8780	L	K	106	121
PSM	RDVDDGSGSPHSPHQLSS	476	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4488	16.366	3	1876.83	1876.8300	S	K	1614	1632
PSM	RENQQHYGDLLNHCAVLE	477	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	14-UNIMOD:4	ms_run[2]:scan=9896	23.405	3	2195.0178	2195.0178	L	K	3002	3020
PSM	REQCCYNCGKPGHLA	478	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5011	17.115	3	1848.7818	1848.7818	E	R	77	92
PSM	RGPHPPGGLLGHGPQEM	479	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:35	ms_run[2]:scan=7446	20.443	3	1751.8526	1751.8526	M	R	811	828
PSM	RHDGSEPCVDVLFGDGH	480	sp|Q96EL3|RM53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4	ms_run[2]:scan=10882	24.796	3	1895.8221	1895.8221	V	R	56	73
PSM	RHVEDGNVTVQHAALSAL	481	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9580	23.049	2	1915.9864	1915.9864	D	R	277	295
PSM	RILEVNHVNVEGATH	482	sp|Q96L92-3|SNX27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7892	21.006	3	1686.8802	1686.8802	D	K	100	115
PSM	RKYTELPHGAISEDQAVGPADIPCDSTGQTST	483	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	24-UNIMOD:4	ms_run[2]:scan=9627	23.099	4	3400.5841	3400.5841	S	-	139	171
PSM	RLDAVKSNAAAYLQHLCY	484	sp|O60716-13|CTND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:4	ms_run[2]:scan=11619	26.166	4	2092.0524	2092.0524	F	R	324	342
PSM	RLGGHGPSFPLKGITEQQ	485	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9697	23.169	3	1921.017	1921.0170	F	K	184	202
PSM	RMRSELLVPGSQLILGPHES	486	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35	ms_run[2]:scan=11484	25.892	3	2234.1841	2234.1841	N	K	574	594
PSM	RQDDIKDESSEFSSHSN	487	sp|Q9Y5B6|PAXB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6520	19.139	3	1979.8457	1979.8457	R	K	487	504
PSM	RQETKEAQLYAAQAHL	488	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8782	22.069	3	1855.9541	1855.9541	K	K	192	208
PSM	RQLSILVHPDKNQDDAD	489	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8153	21.314	3	1962.9759	1962.9759	F	R	78	95
PSM	RQMEKDETVSDCSPHIANIG	490	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:4	ms_run[2]:scan=8105	21.257	3	2286.0369	2286.0369	T	R	195	215
PSM	RRIVDDWANDGWGL	491	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=12177	27.817	2	1671.8118	1671.8118	D	K	336	350
PSM	RSVFALTNGIYPHKLVF	492	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=12179	27.824	3	1961.0887	1961.0887	L	-	272	289
PSM	RTALDKIEEMEMTNSHLA	493	sp|Q9Y608-2|LRRF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=9488	22.943	3	2119.9878	2119.9878	L	K	366	384
PSM	RTIPELSVRPSELEDGHTALNTHSVSPME	494	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	28-UNIMOD:35	ms_run[2]:scan=10269	23.885	4	3217.5674	3217.5674	V	K	1113	1142
PSM	RVFLQDHCLAEGYGTK	495	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4	ms_run[2]:scan=8998	22.358	3	1892.9203	1892.9203	C	K	379	395
PSM	RVIHLSNLPHSGYSDSAVL	496	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10157	23.727	3	2064.0752	2064.0752	G	K	496	515
PSM	RVLAHLAPLFDNPKLD	497	sp|Q68E01-3|INT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11585	26.099	3	1818.0152	1818.0152	K	K	261	277
PSM	RYGDGGSSFQSTTGHCVHM	498	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=5995	18.444	4	2098.8585	2098.8585	H	R	275	294
PSM	RPGDFGSDVSHLNLH	499	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9726	23.199557235999997	3	1651.794008	1649.791017	C	K	739	754
PSM	RIHQIGPGMVQQIQSVCMECQGHGE	500	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	9-UNIMOD:35,17-UNIMOD:4,18-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=8723	21.98942995306667	4	2910.311676	2910.299337	I	R	161	186
PSM	KENGVTHPIDYHTTDYVDEIK	501	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9559	23.027477325866666	3	2474.164820	2473.176134	L	K	230	251
PSM	KLKVIGQDSSEIHF	502	sp|P63165|SUMO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9920	23.427916239466665	3	1600.868521	1599.862057	I	K	23	37
PSM	KKTDAPQPDVKEEEEE	503	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4587	16.502995018666667	2	1870.881334	1870.879617	Y	K	515	531
PSM	KKQGGLGPMNIPLVSDPK	504	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=10468	24.157003063733335	3	1878.039737	1878.039704	P	R	92	110
PSM	RKENGPVVETVQVPLSK	505	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8604	21.8390098824	3	1879.052127	1879.052711	S	R	600	617
PSM	KKVDDDLGTIESLEEAK	506	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=10419	24.0922409488	3	1888.963098	1888.962953	K	K	1378	1395
PSM	RKNQDEESQEAPELLK	507	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7090	19.978534730133333	3	1912.948247	1912.949034	R	R	588	604
PSM	KKMEDSVGCLETAEEVK	508	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	3-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7549	20.573143610133332	3	1967.915181	1967.917994	K	R	1371	1388
PSM	RKPEYPKPDTQQMIPFQP	509	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	13-UNIMOD:35	ms_run[1]:scan=9337	22.766222577866664	3	2215.111713	2215.109575	D	R	577	595
PSM	KKNVFIIGATNRPDIIDPAIL	510	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=12141	27.67393827333333	4	2307.332565	2307.331452	T	R	614	635
PSM	RKYSSTLPNDVQTTSGDLKLD	511	sp|Q9BSJ5|CQ080_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9614	23.083789507733332	3	2337.185309	2337.181219	D	K	187	208
PSM	KRLEEPEEPKVLTPEEQLAD	512	sp|O75822|EIF3J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9408	22.85072011813333	3	2349.210029	2349.206371	K	K	97	117
PSM	KKAIEDEGGNPDEIEITSEGNK	513	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7689	20.747312961333332	3	2372.132054	2372.134328	L	K	62	84
PSM	KRIQEIIEQLDVTTSEYEKE	514	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=12274	28.235086728533336	3	2450.259222	2450.254050	E	K	369	389
PSM	RRYADLTEDQLPSCESLKDTIA	515	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	14-UNIMOD:4	ms_run[1]:scan=10863	24.764661566666668	3	2580.250465	2580.248981	D	R	140	162
PSM	KKKPEDSPSDDDVLIVYELTPTAEQ	516	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=12042	27.31641999813333	4	2816.396423	2816.396751	E	K	2620	2645
PSM	KKQGEGSSGVSSLLLHPEPVPGPEKENV	517	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=10073	23.633902398133333	4	2898.514287	2898.508701	S	R	230	258
PSM	KAPKPDGPGGGPGGSHMGGNYGDD	518	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:35	ms_run[2]:scan=4245	16.006	3	2239.9553	2239.9553	C	R	447	471
PSM	KAVHNSVAAQLTGVAGH	519	sp|Q9NUD5-2|ZCHC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7915	21.032	3	1658.8853	1658.8853	P	-	223	240
PSM	KAVKSSEHINEGETAMLVC	520	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=7125	20.032	3	2118.0085	2118.0085	V	K	15	34
PSM	KEKVTNSTELQHQLD	521	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6081	18.561	3	1768.8955	1768.8955	L	K	470	485
PSM	KENVSSNAACPDHTPTPNDDGKSHELSNL	522	sp|Q8TBA6-2|GOGA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:4	ms_run[2]:scan=7490	20.498	4	3133.4007	3133.4007	S	R	199	228
PSM	KFDPYEHEALFHTPVEG	523	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10771	24.625	3	2014.9425	2014.9425	A	K	169	186
PSM	KGAAYAHAEESIK	524	sp|Q9UJ83-3|HACL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5091	17.227	2	1373.6939	1373.6939	G	K	140	153
PSM	KGAEHITTYTFNTH	525	sp|Q7Z7K6-3|CENPV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7814	20.917	2	1618.774	1618.7740	L	K	193	207
PSM	KGHVSELEADLAEQQHL	526	sp|O00291-3|HIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10256	23.867	3	1902.9436	1902.9436	L	R	406	423
PSM	KGMPPQSVVCKPQEPGHFYSEH	527	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=7246	20.199	4	2554.1733	2554.1733	F	R	245	267
PSM	KHFCPNVPIILVGNK	528	sp|P61586|RHOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:4	ms_run[2]:scan=10508	24.211	3	1734.9603	1734.9603	V	K	104	119
PSM	KHHGPQTLYLPVTLSSIPVFQ	529	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12547	29.53	3	2361.2845	2361.2845	Q	R	784	805
PSM	KHLDGKDENFAATDAIPSNVL	530	sp|Q99549|MPP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10890	24.804	3	2254.123	2254.1230	Q	R	550	571
PSM	KHLNEIDLFHCIDPNDS	531	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4	ms_run[2]:scan=11652	26.236	3	2065.9527	2065.9527	F	K	48	65
PSM	KHSGPNSADSANDGFVRL	532	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8726	21.994	3	1870.8922	1870.8922	L	R	98	116
PSM	KHSQFLGYPITLYLEKE	533	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12113	27.574	3	2065.0884	2065.0884	E	R	126	143
PSM	KHWDQDDDFEFTGSHLTV	534	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11401	25.707	3	2175.9498	2175.9498	L	R	550	568
PSM	KICHQIEYYFGDFNLPRD	535	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=12092	27.489	3	2314.0841	2314.0841	A	K	16	34
PSM	KKALGGDVSDQSLESHSQ	536	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5886	18.301	3	1884.9177	1884.9177	A	K	405	423
PSM	KKDEESGSGSNPFQHLE	537	sp|Q9UBF2-2|COPG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8514	21.738	3	1887.8599	1887.8599	D	K	7	24
PSM	KKLTQIQESQVTSHN	538	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5282	17.473	3	1739.9166	1739.9166	K	K	250	265
PSM	KKPGPPVLSSDPNMLSNEEAGHHFEQML	539	sp|O75694-2|NU155_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=9842	23.345	4	3120.4645	3120.4645	P	K	938	966
PSM	KKSEAGHASSPDSEVTSLCQ	540	sp|Q6NZY4|ZCHC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	19-UNIMOD:4	ms_run[2]:scan=6595	19.242	3	2116.9695	2116.9695	T	K	589	609
PSM	KKYEDICPSTHNMDVPNI	541	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4	ms_run[2]:scan=9663	23.136	3	2159.998	2159.9980	G	K	67	85
PSM	KLKELDEEHSQEL	542	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7242	20.195	2	1596.7995	1596.7995	Q	K	1132	1145
PSM	KLLETTDRPDGHQNNL	543	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7022	19.884	3	1849.9282	1849.9282	Q	R	364	380
PSM	KLTDIHGNVLQYH	544	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8868	22.179	3	1536.8049	1536.8049	G	K	206	219
PSM	KMETKTESSGIETEPTVHHLPLSTE	545	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:35	ms_run[2]:scan=8358	21.552	4	2796.3488	2796.3488	E	K	603	628
PSM	KNFLTTAIRPHGIFGP	546	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11654	26.24	3	1767.9784	1767.9784	E	R	191	207
PSM	KNTGSKIEEDFPHI	547	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9906	23.416	3	1613.8049	1613.8049	F	R	693	707
PSM	KQLHSGGPENDVTKIT	548	sp|Q9Y448-3|SKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6136	18.631	3	1722.8901	1722.8901	S	K	124	140
PSM	KSSGVKSTHQAAIVS	549	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4024	15.501	2	1498.8104	1498.8104	Q	K	398	413
PSM	KSVQPQSHKPQPT	550	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3398	14.568	2	1460.7736	1460.7736	H	R	108	121
PSM	KSWVGFSGGQHHTVCMDSEG	551	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=7763	20.834	3	2220.9317	2220.9317	T	K	294	314
PSM	KTFVEKLVQEQGSHS	552	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9719	23.194	3	1715.8842	1715.8842	D	K	547	562
PSM	KTGHIAAGTSTNGIKF	553	sp|P20933|ASPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7926	21.044	3	1601.8526	1601.8526	H	K	214	230
PSM	KTHEAEIVEGENHTYCI	554	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:4	ms_run[2]:scan=8719	21.985	3	2028.9211	2028.9211	G	R	2176	2193
PSM	KTKPSDEEMLFIYGHY	555	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11531	25.98	3	1956.9291	1956.9292	L	K	17	33
PSM	KVCHLGDQLEGVNTPRQ	556	sp|O00471|EXOC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=7796	20.875	3	1949.9741	1949.9741	T	R	109	126
PSM	KVSGHVITDIVEGK	557	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9173	22.567	3	1480.8249	1480.8249	P	K	332	346
PSM	RACDGNVDHAATHITN	558	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4	ms_run[2]:scan=4598	16.528	3	1750.7805	1750.7805	L	R	398	414
PSM	RADESHFLIENSTKEE	559	sp|Q92547|TOPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8255	21.43	3	1903.8912	1903.8912	K	R	730	746
PSM	RANTVYGLGFSSEHHLS	560	sp|Q86YM7-3|HOME1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9327	22.752	3	1873.9071	1873.9071	S	K	81	98
PSM	RAPSSVAHTSMSDNGGFK	561	sp|Q9Y5U2-2|TSSC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=4567	16.473	3	1863.8534	1863.8534	R	R	42	60
PSM	RCGESGHLAKDCDLQEDACYNCG	562	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=7183	20.113	4	2714.0578	2714.0578	Y	R	39	62
PSM	REAMEHPYFYTVVKDQA	563	sp|P68400-2|CSK21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10070	23.628	3	2082.9833	2082.9833	A	R	180	197
PSM	RELFPDGFSIHHAGML	564	sp|Q8N3C0|ASCC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:35	ms_run[2]:scan=11341	25.587	3	1841.8883	1841.8883	V	R	772	788
PSM	RFVPQEMGVHTVSVKY	565	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9796	23.296	3	1875.9665	1875.9665	V	R	2091	2107
PSM	RGLQKEEVVLLTHGDSVD	566	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9811	23.311	3	1994.0433	1994.0433	F	K	42	60
PSM	RGSSPSHSATSVHTSV	567	sp|Q13613|MTMR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4141	15.754	3	1595.7652	1595.7652	E	-	650	666
PSM	RHSDELTSLLGYFPNK	568	sp|Q92878|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12136	27.654	3	1875.9479	1875.9479	S	K	558	574
PSM	RIRDTPEDIVLEAPASGLAFHPA	569	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12096	27.504	4	2474.2918	2474.2918	T	R	27	50
PSM	RKITVPGNFQGHSGAQCITCSY	570	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	17-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=9270	22.689	3	2480.1689	2480.1689	N	K	324	346
PSM	RLDSYVNADHDLYCNTR	571	sp|Q9NWZ8|GEMI8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:4	ms_run[2]:scan=9038	22.404	3	2110.9491	2110.9491	E	R	167	184
PSM	RLLLEGISSTHVNHL	572	sp|Q9NR46|SHLB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10650	24.435	3	1687.937	1687.9370	T	R	236	251
PSM	RLQQSHPLSATQIQVK	573	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7440	20.437	3	1833.0221	1833.0221	D	R	320	336
PSM	RLSGPLKEQYAQEHGLNFQ	574	sp|Q15126|PMVK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9602	23.072	3	2214.1182	2214.1182	L	R	42	61
PSM	RMSIFGHSMGGHGALICAL	575	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=11398	25.7	3	2029.9648	2029.9648	Q	K	142	161
PSM	RNLAEDEAHACAILIK	576	sp|Q15334|L2GL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4	ms_run[2]:scan=10026	23.553	3	1822.936	1822.9360	L	-	1049	1065
PSM	RPAHLGPCSDGHYQSASGQ	577	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:4	ms_run[2]:scan=5202	17.372	3	2023.8919	2023.8919	L	K	297	316
PSM	RPAPGFHHGDGPGNAVQEIMIPAS	578	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	20-UNIMOD:35	ms_run[2]:scan=9721	23.195	4	2470.1812	2470.1812	G	K	172	196
PSM	RPAVQQLDSHVHAV	579	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7527	20.546	3	1555.8219	1555.8219	L	R	34	48
PSM	RPKFSVCVLGDQQHCDEA	580	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9169	22.564	3	2144.9732	2144.9732	P	K	60	78
PSM	RPLHPVANPHAEIST	581	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6253	18.785	2	1637.8638	1637.8638	Q	K	153	168
PSM	RQSTVDPTHCPYGHF	582	sp|Q9H5K3|SG196_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:4	ms_run[2]:scan=8030	21.17	3	1800.8002	1800.8002	P	R	46	61
PSM	RQVASHVGLHSASIPGILALDLCPSDTN	583	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	23-UNIMOD:4	ms_run[2]:scan=12257	28.163	4	2927.4923	2927.4923	Y	K	208	236
PSM	RSTDTSLKDGLFHEF	584	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11213	25.351	3	1751.8479	1751.8479	V	K	345	360
PSM	RTLDELGIHLTKEEL	585	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11402	25.71	3	1765.9574	1765.9574	P	K	359	374
PSM	RTQEQCVHNETKNELE	586	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:4	ms_run[2]:scan=4719	16.681	3	2013.9174	2013.9174	N	K	745	761
PSM	RYVPVKGDHVIGIVTA	587	sp|Q9NQT5|EXOS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9403	22.843	2	1722.9781	1722.9781	K	K	108	124
PSM	KHIYYITGETKDQVANSAFVE	588	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=12584	29.6709858024	4	2412.194379	2412.196141	Q	R	489	510
PSM	RGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSS	589	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	4-UNIMOD:35	ms_run[1]:scan=12442	29.03993132773333	7	6860.3755	6860.3703	N	K	44	108
PSM	RGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSS	590	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	36	4-UNIMOD:35	ms_run[1]:scan=12265	28.195091133333335	7	6860.3755	6860.3703	N	K	44	108
PSM	RDTLYEAVREVLHGNQ	591	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=12366	28.662900543466666	3	1899.963005	1898.959874	S	R	7	23
PSM	RQDDIKDESSEFSSHSN	592	sp|Q9Y5B6|PAXB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6488	19.09082173146667	3	1979.847235	1979.845691	R	K	487	504
PSM	KHAAENPGKYNILGTNTIMD	593	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	19-UNIMOD:35	ms_run[1]:scan=9371	22.80825154293333	3	2203.060549	2202.073918	T	K	516	536
PSM	RQLFHPEQLITGKEDAANNYA	594	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=10815	24.6983536296	3	2415.183947	2414.197872	Y	R	84	105
PSM	RGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKL	595	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=9400	22.8404470752	4	3516.660608	3515.677785	N	R	357	393
PSM	KVAHSFNCTPIEGMLSHQL	596	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	8-UNIMOD:4,14-UNIMOD:35	ms_run[1]:scan=9866	23.37454565386667	3	2184.058863	2184.045595	N	K	172	191
PSM	RSGSLLYLHDTLEDIK	597	sp|Q96JH7|VCIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=11440	25.795554793866664	3	1860.964978	1858.978878	D	R	184	200
PSM	KKSPDSDVAATLK	598	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5307	17.504669797066665	3	1358.742008	1358.740545	W	K	765	778
PSM	KKEEPSQNDISPKT	599	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=4056	15.566369996533332	3	1599.811449	1599.810415	K	K	79	93
PSM	KKITESVAETAQTIK	600	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7583	20.615543125600002	3	1645.922552	1645.925051	T	K	70	85
PSM	KKLEGELTEEVEMAK	601	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	13-UNIMOD:35	ms_run[1]:scan=8644	21.8840533664	3	1748.886722	1748.886617	Q	R	453	468
PSM	KIKAAVEDPRVLLLDL	602	sp|P36957-2|ODO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=12426	28.961236021599998	3	1792.081142	1792.082221	R	-	352	368
PSM	KKLTELSMQDEELMK	603	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	8-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=6979	19.818314948266668	3	1853.912943	1853.911452	G	R	67	82
PSM	KKDEKTDTLEDLFPTT	604	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=11464	25.843704510666665	3	1879.941850	1879.941489	A	K	465	481
PSM	KKILDSVGIEADDDRLN	605	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=9462	22.914852890933332	4	1899.989806	1899.990171	I	K	24	41
PSM	KKYDAFLASESLIKQIP	606	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=12147	27.696688357866666	3	1950.082972	1950.082615	A	R	105	122
PSM	KKEVNEGIQALSNSEEEK	607	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7409	20.399554793066667	3	2031.011271	2031.012028	V	K	301	319
PSM	KKCLELFSELAEDKENY	608	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	3-UNIMOD:4	ms_run[1]:scan=11516	25.95300166986667	3	2115.020071	2115.019422	V	K	410	427
PSM	RRVSEVEEEKEPVPQPLPSDDT	609	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8074	21.221597311733333	3	2535.252070	2535.245276	R	R	445	467
PSM	RKYGGISTASVDFEQPTRDGLGSDNIGS	610	sp|P98175|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=10376	24.035929051466667	4	2926.408084	2926.405693	R	R	836	864
PSM	KAFTVSSSLHNHV	611	sp|P58317|ZN121_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7513	20.525	3	1425.7365	1425.7365	G	K	291	304
PSM	KAIRDGVIEASINHE	612	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7922	21.039	3	1650.8689	1650.8689	A	K	440	455
PSM	KAVVTHSSGNHGQALTYAA	613	sp|Q9GZT4|SRR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5795	18.173	3	1910.9599	1910.9599	P	K	77	96
PSM	KCLHPLANETFVAKDN	614	sp|Q13642-3|FHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=7785	20.86	3	1855.9251	1855.9251	A	K	70	86
PSM	KDHASIQMNVAEVDKVTG	615	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9385	22.823	3	1940.9626	1940.9626	A	R	27	45
PSM	KDLEAHIDSANKN	616	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4683	16.63	3	1453.7161	1453.7161	L	R	1620	1633
PSM	KDLSDGIHVVKDA	617	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7738	20.805	3	1395.7358	1395.7358	L	R	213	226
PSM	KDNPKIVHAFDMEDLGD	618	sp|Q9NZ45|CISD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10746	24.589	3	1942.9095	1942.9095	Q	K	51	68
PSM	KEATKEVHTQAENAEFM	619	sp|P09601|HMOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:35	ms_run[2]:scan=5319	17.525	3	1977.9102	1977.9102	L	R	18	35
PSM	KEHMDEVCSSQLLTSVR	620	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8774	22.055	3	2033.951	2033.9510	L	R	1555	1572
PSM	KELHNTPYGTASEPSEKA	621	sp|Q9NXV2|KCTD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5237	17.414	3	1957.9381	1957.9381	S	K	207	225
PSM	KELIEKGHWDDVFLDSTQ	622	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11575	26.076	3	2159.0535	2159.0535	K	R	395	413
PSM	KFKILDAVVAQEPLH	623	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11643	26.22	3	1706.9719	1706.9719	V	R	753	768
PSM	KHCIMQANAEYHQSILA	624	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4,5-UNIMOD:35	ms_run[2]:scan=7659	20.711	3	2028.951	2028.9510	A	K	248	265
PSM	KHDSGAADLERVTDYAEE	625	sp|Q9NX55-3|HYPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9507	22.965	3	2004.9025	2004.9025	R	K	35	53
PSM	KHIANYISGIQTIGH	626	sp|Q15393-3|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9562	23.032	3	1650.8842	1650.8842	N	R	166	181
PSM	KHSPTEDEESAKAEADAYI	627	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9223	22.63	3	2089.944	2089.9440	S	R	968	987
PSM	KKDEESGGGSNPFQHLE	628	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8543	21.771	3	1857.8493	1857.8493	D	K	7	24
PSM	KKLDEAVAEAHLG	629	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7840	20.948	2	1379.7409	1379.7409	P	K	360	373
PSM	KKMTGTLETQFTCPFCNHE	630	sp|P60002|ELOF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=10316	23.944	3	2328.0337	2328.0337	K	K	14	33
PSM	KKNQDDFECVTTLEGHENEV	631	sp|O76071|CIAO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=9768	23.259	3	2391.0649	2391.0649	W	K	89	109
PSM	KKVVDDLLDQITGGDHS	632	sp|Q9H8M2-2|BRD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11874	26.781	3	1838.9374	1838.9374	S	R	46	63
PSM	KLFAECHVINPSK	633	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:4	ms_run[2]:scan=7956	21.086	3	1541.8024	1541.8024	E	K	156	169
PSM	KLIHPDEDISLEER	634	sp|O43670-3|ZN207_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8616	21.856	3	1692.8683	1692.8683	S	R	279	293
PSM	KLKGEMMDLQHGSLFL	635	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=10191	23.776	3	1877.9379	1877.9379	D	R	57	73
PSM	KNCLTNFHGMDLTRD	636	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4	ms_run[2]:scan=9737	23.213	3	1820.8298	1820.8298	G	K	94	109
PSM	KNLSDSEKELYIQHA	637	sp|Q00059|TFAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8419	21.627	3	1773.8897	1773.8897	W	K	190	205
PSM	KPTSALDEPVSHWRP	638	sp|Q96KA5-2|CLP1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9490	22.945	3	1718.874	1718.8740	K	R	158	173
PSM	KPVANHQYNIEYER	639	sp|P13984|T2FB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6609	19.257	3	1759.8642	1759.8642	Y	K	154	168
PSM	KQFEHLDPQNQHTFEA	640	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8299	21.48	3	1967.9126	1967.9126	L	R	136	152
PSM	KSEEEFIHINNKL	641	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9633	23.105	3	1599.8257	1599.8257	Y	R	164	177
PSM	KSILEKDPSIHQA	642	sp|Q99614|TTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6524	19.144	2	1464.7936	1464.7936	Y	R	213	226
PSM	KSKEESSGTPAHQMNL	643	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=3965	15.371	3	1758.8207	1758.8207	Y	R	408	424
PSM	KSWAQASVTHGAHGDGG	644	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5288	17.481	3	1664.7655	1664.7655	V	R	140	157
PSM	KTGTITTFEHAHNM	645	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=6089	18.569	3	1602.746	1602.7460	V	R	481	495
PSM	KTHPPKCIQCGQYLDDPDL	646	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9341	22.771	3	2284.0616	2284.0616	S	K	347	366
PSM	KTKSHDDGNIDLESDSFL	647	sp|P18583-6|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10732	24.566	3	2019.9385	2019.9385	S	K	139	157
PSM	KTLEEAIRSDTSGHFQ	648	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10332	23.965	3	1817.8908	1817.8908	K	R	287	303
PSM	KTLYEHYSGGESHNSSSS	649	sp|P33981-2|TTK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5060	17.189	3	1968.845	1968.8450	A	K	829	847
PSM	KTQDQISNIKYHEEFE	650	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8538	21.765	3	2007.9538	2007.9538	K	K	56	72
PSM	KTVFAEHISDECK	651	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:4	ms_run[2]:scan=6966	19.801	3	1562.7399	1562.7399	F	R	103	116
PSM	KTVIVHGFTLGEKGE	652	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9254	22.672	3	1613.8777	1613.8777	Y	K	649	664
PSM	KVGNTGGPPHTHGAS	653	sp|Q14781|CBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3408	14.582	3	1415.6906	1415.6906	Q	R	320	335
PSM	KVVDHYENPRNVGSLD	654	sp|Q9H1K1|ISCU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7269	20.238	3	1840.9068	1840.9068	K	K	38	54
PSM	MKLLTHNLLSSHV	655	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:35	ms_run[2]:scan=9260	22.677	2	1507.8181	1507.8181	-	R	1	14
PSM	RAGSQLGPGYQHHAQP	656	sp|Q02241-3|KIF23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5014	17.119	3	1702.8288	1702.8288	M	K	653	669
PSM	RAHLAALDETPVAGPPHL	657	sp|Q6P9B9|INT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10314	23.941	3	1863.9955	1863.9955	V	R	86	104
PSM	RANHFFTVTDPRNILLTNEQLESA	658	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12196	27.888	4	2785.4147	2785.4147	G	R	24	48
PSM	REAMEHPYFYTVVKDQA	659	sp|P68400-2|CSK21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10081	23.643	3	2082.9833	2082.9833	A	R	180	197
PSM	REQHLAQLQQLQQMHQ	660	sp|P49750-3|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=8178	21.341	3	2031.0068	2031.0068	F	K	54	70
PSM	REQLEEEEEAKHNLE	661	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6773	19.496	3	1881.8704	1881.8704	F	K	1342	1357
PSM	RFCNPGFPIGCYITDKGHA	662	sp|Q99805|TM9S2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=11403	25.712	3	2209.0197	2209.0197	Q	K	172	191
PSM	RGLAVNMVDSKHSMNILN	663	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=7989	21.126	3	2030.0037	2030.0037	K	R	327	345
PSM	RGLNSQSSDDHLNK	664	sp|A8CG34|P121C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3946	15.34	3	1569.7495	1569.7495	K	R	351	365
PSM	RGRGGPPGQFHDNANGGQNGTVQEIMIPAG	665	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	26-UNIMOD:35	ms_run[2]:scan=9284	22.705	4	3047.438	3047.4380	S	K	214	244
PSM	RGSLGDSDGKHETVNQEE	666	sp|P98172|EFNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4145	15.764	3	1956.8773	1956.8773	S	K	199	217
PSM	RHCQLEPDHEGVPEETDDFGEF	667	sp|Q9Y5L0-5|TNPO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:4	ms_run[2]:scan=10596	24.343	4	2642.098	2642.0980	A	R	378	400
PSM	RHMTLEGEEENGEVHQA	668	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:35	ms_run[2]:scan=5125	17.273	3	1980.8596	1980.8596	M	R	216	233
PSM	RHQDVPSQDDSKPTQ	669	sp|Q9NRN7|ADPPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3547	14.753	3	1736.8078	1736.8078	S	R	252	267
PSM	RIHEGCEEPATHNALA	670	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:4	ms_run[2]:scan=5365	17.583	3	1803.8322	1803.8322	A	K	865	881
PSM	RKDPEGTPYINHPIGVA	671	sp|Q8N4P3-2|MESH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8477	21.691	3	1862.9639	1862.9639	R	R	24	41
PSM	RKFSMEPGDEDLDCDNDHVS	672	sp|Q14135-2|VGLL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=7073	19.955	3	2380.9536	2380.9536	K	K	25	45
PSM	RKLAGANPAVITCDELLLGHE	673	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:4	ms_run[2]:scan=11508	25.939	3	2276.1947	2276.1947	K	K	4018	4039
PSM	RLAISEDHVASVK	674	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6978	19.817	3	1423.7783	1423.7783	R	K	51	64
PSM	RLSLNNGSITHLVIRPNG	675	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10614	24.369	3	1960.0966	1960.0966	L	R	251	269
PSM	RLVLTQEQLHQLHS	676	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9067	22.44	3	1700.9322	1700.9322	H	R	1122	1136
PSM	RNILDFPQHVSPSKDI	677	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10546	24.265	3	1864.9795	1864.9795	Q	R	79	95
PSM	RNIVQSTEHLHEDNGDVEV	678	sp|Q6PL18|ATAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8633	21.872	3	2190.0301	2190.0301	A	R	136	155
PSM	RPDVVEMHDVTAQDPKLLVHL	679	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35	ms_run[2]:scan=10503	24.204	4	2427.258	2427.2580	A	K	471	492
PSM	RSDTEHSTNEVGTLCH	680	sp|Q8N573-3|OXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	15-UNIMOD:4	ms_run[2]:scan=5149	17.305	3	1841.7962	1841.7962	L	K	328	344
PSM	RSHNNFVAILDLPEGEHQY	681	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11788	26.564	3	2238.0818	2238.0818	T	K	107	126
PSM	RSRGEQEGDEEEEGHIVDAEAEEGDADASDA	682	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8199	21.366	4	3301.3363	3301.3363	G	K	1385	1416
PSM	RVVVTKYCDPDSYH	683	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4	ms_run[2]:scan=7175	20.103	3	1737.8145	1737.8145	N	R	453	467
PSM	RYELPTDDDTYEEHR	684	sp|Q9P0P0|RN181_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8124	21.279	3	1937.8391	1937.8391	C	R	117	132
PSM	KVMQEQGTHPKFQ	685	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	3-UNIMOD:35	ms_run[1]:scan=4296	16.122570401866668	3	1573.749088	1572.771862	E	K	545	558
PSM	RGQTCVVHYTGMLEDGK	686	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	5-UNIMOD:4	ms_run[1]:scan=8769	22.048206449333335	3	1949.906602	1949.908766	K	K	19	36
PSM	KQSVDKVTSPTKV	687	sp|Q05682-4|CALD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4772	16.7663913512	2	1415.798896	1415.798394	E	-	526	539
PSM	KKPASSSSAPQNIPK	688	sp|Q96F86|EDC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=3924	15.305913303733332	3	1538.842620	1538.841656	V	R	105	120
PSM	KKGDIVDIKGMGTVQ	689	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=8750	22.0240400144	3	1587.865484	1587.865428	Y	K	35	50
PSM	KKAEPSEVDMNSPKS	690	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	10-UNIMOD:35	ms_run[1]:scan=3544	14.748444162133334	3	1661.792800	1661.793051	K	K	60	75
PSM	KKALAAAGYDVEKNNS	691	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=5488	17.757086793600003	3	1677.868065	1677.868599	L	R	66	82
PSM	KKALEQLNGFELAGRPM	692	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=10852	24.7482679944	3	1901.020672	1901.019303	A	K	305	322
PSM	KKMEDSVGCLETAEEVK	693	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:4	ms_run[1]:scan=8286	21.4650854128	3	1951.920982	1951.923079	K	R	1371	1388
PSM	KKQNADPQAVTMPATETK	694	sp|Q9UNF1|MAGD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	12-UNIMOD:35	ms_run[1]:scan=4215	15.934644599466667	3	1972.989958	1972.988791	T	K	107	125
PSM	RKILQDGGLQVVEKQNLS	695	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=9258	22.675196120800003	3	2024.136811	2024.137838	C	K	20	38
PSM	KKCSLPAEEDSVLEKLGE	696	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	3-UNIMOD:4	ms_run[1]:scan=10901	24.819327857066664	3	2031.020713	2031.019422	G	R	633	651
PSM	RKEADGEQDEEEKDDGEA	697	sp|Q8IX12|CCAR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=3482	14.681378124266667	3	2048.841006	2048.840666	E	K	605	623
PSM	KKAMEGAGTDEKALIEILAT	698	sp|P08133|ANXA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=11998	27.166979194400003	3	2088.116500	2088.113657	L	R	445	465
PSM	KKKGPEPVPLEFIPAQGLLG	699	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=12318	28.435750008	3	2117.226458	2117.224862	L	R	484	504
PSM	KKNDKEAAGEGPALYEDPPDQ	700	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7282	20.253605778933334	3	2271.066780	2271.065521	A	K	31	52
PSM	RKTCTTVAFTQVNSEDKGALA	701	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	4-UNIMOD:4	ms_run[1]:scan=8567	21.797410192799997	3	2296.149238	2296.148145	H	K	196	217
PSM	KKMGLEDTLEQLNAMITESK	702	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=12118	27.589445316000003	3	2311.151737	2310.144700	N	R	478	498
PSM	KRNQELLQSQLTEKDSMIENM	703	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:35,21-UNIMOD:35	ms_run[1]:scan=8610	21.847105708	3	2566.238557	2566.236703	L	K	743	764
PSM	KKQFSQYIKNSVTPDMMEEMY	704	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	16-UNIMOD:35,17-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=9105	22.482801503733334	3	2644.187748	2644.185913	Y	K	220	241
PSM	RRPQYSNPPVQGEVMEGADNQGAGEQGRPV	705	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	15-UNIMOD:35	ms_run[1]:scan=7897	21.010254950133334	4	3239.504740	3238.517386	G	R	204	234
PSM	KAETNDSYHIILK	706	sp|Q12800-3|TFCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8081	21.231	3	1530.8042	1530.8042	M	-	439	452
PSM	KAHVLAASVEQATENFLEKGD	707	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12153	27.719	4	2256.1386	2256.1386	K	K	57	78
PSM	KAKAEASSGDHPTDTEM	708	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:35	ms_run[2]:scan=3359	14.519	3	1789.7789	1789.7789	N	K	424	441
PSM	KALEHAFQLEHIMDLT	709	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=10965	24.93	3	1910.956	1910.9560	T	R	2435	2451
PSM	KAPAHHPAAISTA	710	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=3870	15.194	2	1270.6782	1270.6782	E	K	173	186
PSM	KDLIHDVSFDFHG	711	sp|Q96EE3|SEH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11443	25.8	3	1528.731	1528.7310	H	R	12	25
PSM	KEHEADTANMSDKEL	712	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:35	ms_run[2]:scan=4188	15.843	3	1732.7574	1732.7574	N	K	578	593
PSM	KENGVTHPIDYHTTDYVDEIK	713	sp|Q99536-2|VAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9331	22.759	4	2473.1761	2473.1761	L	K	96	117
PSM	KEYGFCIMDNHKE	714	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=7742	20.808	3	1685.7178	1685.7178	L	R	336	349
PSM	KGHYTEGAELVDSVLDVVR	715	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10958	24.921	4	2086.0695	2086.0695	A	K	103	122
PSM	KGVEAVAIHGGKDQEE	716	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5224	17.398	3	1665.8322	1665.8322	L	R	455	471
PSM	KHGTCAAQVDALNSQK	717	sp|O00584|RNT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=5003	17.105	3	1726.8421	1726.8421	E	K	117	133
PSM	KHIANYISGIQTIGH	718	sp|Q15393-3|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9554	23.023	3	1650.8842	1650.8842	N	R	166	181
PSM	KHIYYITGETKDQVANSAFVE	719	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12464	29.141	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHLEINPDHSIIETL	720	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10728	24.562	3	1757.9312	1757.9312	K	R	632	647
PSM	KHSTPHAAFQPNSQIGEEMSQNSFI	721	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11205	25.339	4	2784.2926	2784.2926	Q	K	113	138
PSM	KHTGPNSPDTANDGFVRL	722	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8983	22.342	3	1924.9391	1924.9391	L	R	98	116
PSM	KHTTSIFDDFSHYE	723	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11454	25.823	3	1725.7635	1725.7635	Y	K	498	512
PSM	KIDDTIRYLSLHDN	724	sp|Q6UXN9|WDR82_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10807	24.685	3	1701.8686	1701.8686	N	K	84	98
PSM	KIKSDHPGISITDLS	725	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9291	22.713	2	1609.8675	1609.8675	E	K	564	579
PSM	KIRYESGDHVAVYPANDSALVNQLG	726	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10657	24.444	4	2715.3616	2715.3616	S	K	311	336
PSM	KKADLILSYHPPIF	727	sp|Q9GZT8-3|NIF3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11817	26.637	3	1640.929	1640.9290	Q	R	84	98
PSM	KKDDEENYLDLFSH	728	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11670	26.279	3	1751.8002	1751.8002	S	K	138	152
PSM	KKEIIQDVTLHDLDVANA	729	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11028	25.034	3	2021.0793	2021.0793	K	R	231	249
PSM	KKPGQSFQEQVEHY	730	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7823	20.93	3	1703.8267	1703.8267	P	R	864	878
PSM	KKQLLCGAAIGTHEDD	731	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4	ms_run[2]:scan=7224	20.168	2	1754.8621	1754.8621	A	K	241	257
PSM	KKYEDICPSTHNMDVPNI	732	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=8565	21.795	3	2175.9929	2175.9929	G	K	67	85
PSM	KLHPGLLEVLGPHLE	733	sp|Q9H497-3|TOR3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11847	26.712	3	1650.9457	1650.9457	E	R	23	38
PSM	KLIQHANVQAHSSLI	734	sp|Q15833-2|STXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7971	21.103	3	1657.9264	1657.9264	A	R	421	436
PSM	KLNDHLNNMAHY	735	sp|Q96HY7|DHTK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=5953	18.388	3	1484.683	1484.6830	A	R	487	499
PSM	KLNYSDHDVIKWV	736	sp|Q96CW1|AP2M1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10907	24.827	3	1615.8358	1615.8358	P	R	410	423
PSM	KLQWFQNHLDPQK	737	sp|Q96EY4|TMA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9928	23.436	3	1680.8736	1680.8736	E	K	54	67
PSM	KMKETAENYLGHTA	738	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=6143	18.639	3	1607.7614	1607.7614	M	K	173	187
PSM	KMKQFAQDFVMHTDV	739	sp|O60678-2|ANM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=9048	22.418	3	1855.8597	1855.8597	Q	R	123	138
PSM	KNNISSGHVPHGPLT	740	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6699	19.386	2	1556.8059	1556.8059	L	R	392	407
PSM	KRGAPPSSNIEDFHGLLP	741	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11140	25.227	3	1934.001	1934.0010	K	K	269	287
PSM	KRPPNSVVTQHEPAGQNE	742	sp|Q8WWK9-4|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4699	16.652	3	1986.9872	1986.9872	L	K	382	400
PSM	KSFTQSSHLVQHQ	743	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5198	17.368	3	1525.7637	1525.7637	G	R	185	198
PSM	KSSKGELTTLIHQLQE	744	sp|Q86UP2-3|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11292	25.506	3	1810.9789	1810.9789	K	K	321	337
PSM	KSVKLLQALAQYQNHLQEQP	745	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11774	26.527	3	2335.2648	2335.2648	M	R	158	178
PSM	KTCHSFIINEKMNG	746	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=6544	19.17	2	1693.7916	1693.7916	W	K	740	754
PSM	KTGTITTFEHAHNM	747	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7804	20.891	2	1586.7511	1586.7511	V	R	481	495
PSM	KTHIQDNHDGTYTVAYVPDVTG	748	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9750	23.238	3	2430.1452	2430.1452	K	R	1593	1615
PSM	KTKPSDEEMLFIYGHY	749	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=10720	24.549	3	1972.9241	1972.9241	L	K	17	33
PSM	KTVSHEAEVHAESLQQ	750	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5529	17.812	3	1791.8751	1791.8751	L	K	1282	1298
PSM	KVAHHGENPVSCPELVQQL	751	sp|Q15648-3|MED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:4	ms_run[2]:scan=9612	23.082	3	2141.0688	2141.0688	V	R	124	143
PSM	KVKELEEQLENETLH	752	sp|A0MZ66-2|SHOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9897	23.406	3	1837.9422	1837.9422	Q	K	286	301
PSM	KVSHDNLTVERDESSS	753	sp|O15344-2|TRI18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4785	16.782	3	1801.8442	1801.8442	L	K	498	514
PSM	MKLLTHNLLSSHV	754	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:35	ms_run[2]:scan=9266	22.685	3	1507.8181	1507.8181	-	R	1	14
PSM	RASGNYATVISHNPETK	755	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6509	19.126	3	1843.9177	1843.9177	A	K	128	145
PSM	RAVGPHQFLGDQEAIQAAIK	756	sp|P07738|PMGE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10636	24.415	3	2148.144	2148.1440	L	K	227	247
PSM	RCGESGHLAKDCDLQEDEACYNCG	757	sp|P62633-8|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,12-UNIMOD:4,20-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=7510	20.523	4	2843.1004	2843.1004	Y	R	49	73
PSM	RDGQVINETSQHHDDLE	758	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6455	19.048	3	1991.8933	1991.8933	T	-	450	467
PSM	RDTPGHGSGWAETPRTD	759	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5932	18.365	3	1838.8296	1838.8296	E	R	301	318
PSM	RDYLHLPPEIVPATLR	760	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11904	26.867	3	1889.0523	1889.0523	L	R	80	96
PSM	REIAGHIMEFSQDQHGS	761	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8787	22.073	3	1940.8799	1940.8799	L	R	821	838
PSM	RFEFNQSLGQPEKIHN	762	sp|Q96RU2-2|UBP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9496	22.953	3	1942.965	1942.9650	S	K	369	385
PSM	RGDKDFPPAAAQVAHQ	763	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6852	19.621	3	1706.8489	1706.8489	A	K	65	81
PSM	RGFGHIGIAVPDVYSACK	764	sp|Q04760-2|LGUL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:4	ms_run[2]:scan=10889	24.803	3	1945.9833	1945.9833	P	R	108	126
PSM	RGKSGPLFNFDVHDDV	765	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11183	25.304	3	1801.8747	1801.8747	A	R	273	289
PSM	RKEPVDEDLYPEHY	766	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8561	21.791	3	1788.8319	1788.8319	P	R	960	974
PSM	RKNDPQSITADDLHQLLVVA	767	sp|Q9BTE3-3|MCMBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12250	28.13	3	2232.1862	2232.1862	M	R	406	426
PSM	RKVETDHIVAAVGLEPNVELA	768	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11206	25.34	3	2259.2223	2259.2223	G	K	35	56
PSM	RLHLQGQTMQDPFGEK	769	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=8290	21.469	3	1899.9261	1899.9261	D	R	181	197
PSM	RNHQEEDLTEFLCANHVL	770	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:4	ms_run[2]:scan=12306	28.381	3	2224.0331	2224.0331	Y	K	182	200
PSM	RNVESGEEELASKLDHY	771	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10382	24.044	3	1974.9283	1974.9283	K	K	76	93
PSM	RPGDLTGHSDFHLF	772	sp|O60573-2|IF4E2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11381	25.667	3	1597.7637	1597.7637	V	K	103	117
PSM	RPRNSEGWEQNGLYEFF	773	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12400	28.827	3	2127.9763	2127.9763	D	R	701	718
PSM	RPVILTYHDIGLNH	774	sp|Q9UGV2-2|NDRG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10233	23.844	3	1646.8893	1646.8893	N	K	42	56
PSM	RRGAEGILAPQPPPPQQHQE	775	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7190	20.121	3	2205.1403	2205.1403	L	R	70	90
PSM	RSKVDEAVAVLQAHQA	776	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9998	23.52	3	1720.922	1720.9220	L	K	515	531
PSM	RSPHQGFMPGAHVFSGGVLDAAD	777	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=10401	24.071	3	2368.1019	2368.1019	Q	R	49	72
PSM	RTQHLSVETSYLQHESG	778	sp|Q9Y276|BCS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8191	21.355	3	1970.9446	1970.9446	T	R	73	90
PSM	RTSPYDHMLPGAEHFAEYAG	779	sp|P25325|THTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=9946	23.457	3	2263.9957	2263.9957	D	R	68	88
PSM	RTSVIQGIHTDHNTL	780	sp|Q5U5X0|LYRM7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8084	21.234	3	1690.8751	1690.8751	L	K	67	82
PSM	RVLPVYGGPKGLHEE	781	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8436	21.644	3	1649.8889	1649.8889	H	R	1105	1120
PSM	RYAPTEVGLHEMHI	782	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:35	ms_run[2]:scan=8091	21.242	3	1667.809	1667.8090	V	K	1763	1777
PSM	RYGDSEFTVQSTTGHCVHM	783	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:4	ms_run[2]:scan=9104	22.482	3	2210.9473	2210.9473	H	R	275	294
PSM	RYHTSQSGDEMTSLSEYVS	784	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=9042	22.411	3	2191.9328	2191.9328	L	R	456	475
PSM	RLLIHQSLAGGIIGVKGA	785	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10587	24.3292269392	3	1802.089118	1802.089037	L	K	148	166
PSM	KDLSDGIHVVKDA	786	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7732	20.79798770613333	3	1395.735375	1395.735794	L	R	213	226
PSM	REATSVHDLNDKLENEIAN	787	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9372	22.809705665066666	3	2168.051987	2167.050539	Q	K	334	353
PSM	KKEETQPPVALK	788	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5134	17.282669051466666	2	1366.782015	1366.782016	D	K	91	103
PSM	KRAAEDDEDDDVDTK	789	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3507	14.708027767466666	3	1720.738042	1720.738767	G	K	89	104
PSM	KRPAEDMEEEQAFK	790	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	7-UNIMOD:35	ms_run[1]:scan=5241	17.420216113866665	3	1722.788033	1722.788300	G	R	21	35
PSM	KKLEGELTEEVEMAK	791	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9189	22.590100899200003	3	1732.892665	1732.891702	Q	R	453	468
PSM	RKLELDIPDDAKDLI	792	sp|Q15398|DLGP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=11971	27.076158985333333	3	1752.962866	1752.962165	D	R	453	468
PSM	RKLVPLDYGEDDKNAT	793	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8249	21.423277503199998	3	1832.930824	1832.926842	K	K	710	726
PSM	KKLENCNYAVELGKNQA	794	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:4	ms_run[1]:scan=7648	20.698115565066665	3	1977.991201	1977.994210	M	K	455	472
PSM	KKLVWVPSDKSGFEPASL	795	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=11057	25.0771282816	3	1987.077116	1987.077863	A	K	29	47
PSM	RKEGGLGPLNIPLLADVTR	796	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=12394	28.798085273333335	3	2018.163873	2018.163659	P	R	91	110
PSM	RKPEEEEEEELEETAQEK	797	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8347	21.537826494133334	3	2231.007318	2231.007731	P	K	61	79
PSM	KKKILATPPQEDAPSVDIANI	798	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10378	24.037885134133333	3	2247.249312	2247.247448	S	R	281	302
PSM	KKLGEMWNNTAADDKQPYE	799	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:35	ms_run[1]:scan=7941	21.060681865866666	3	2254.021662	2253.037198	A	K	127	146
PSM	RKVGNPFELDTQQGPQVDKEQFE	800	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10530	24.2429423144	4	2688.314419	2688.314359	Q	R	346	369
PSM	RRTEGVGPGVPGEVEMVKGQPFDVGP	801	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	16-UNIMOD:35	ms_run[1]:scan=10414	24.085782675733334	4	2709.358086	2709.354450	P	R	15	41
PSM	KAIEKLEEEQHALFA	802	sp|Q70UQ0-4|IKIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10452	24.136	3	1754.9203	1754.9203	T	R	236	251
PSM	KALEHSALAINH	803	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5962	18.401	2	1302.7044	1302.7044	I	K	319	331
PSM	KAVDALLTHCKS	804	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4	ms_run[2]:scan=6807	19.55	2	1341.7075	1341.7075	R	R	38	50
PSM	KDDEVQVVRGHY	805	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6736	19.45	3	1443.7106	1443.7106	R	K	51	63
PSM	KDHLVTAYNHLFET	806	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10510	24.214	3	1686.8366	1686.8366	N	K	56	70
PSM	KDSIVHQAGMLK	807	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=5450	17.71	2	1341.7075	1341.7075	S	R	106	118
PSM	KEAGHGTTKEEIT	808	sp|P23634-5|AT2B4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3609	14.825	2	1399.6943	1399.6943	L	K	1010	1023
PSM	KEAIHSQLLEKQ	809	sp|O60925|PFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6035	18.502	3	1422.7831	1422.7831	S	K	73	85
PSM	KEDITHSAQHAL	810	sp|Q96SI9-2|STRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5931	18.364	2	1348.6735	1348.6735	Q	R	289	301
PSM	KEHIAASVSIPSEKQ	811	sp|P46379-4|BAG6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6996	19.839	3	1622.8628	1622.8628	F	R	43	58
PSM	KEIAVHIGDRDNAV	812	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7762	20.832	2	1535.8056	1535.8056	L	R	1369	1383
PSM	KEVIKTNNVSEHEDTD	813	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4323	16.154	3	1856.8752	1856.8752	K	K	362	378
PSM	KGSGNLEAIHIIK	814	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8670	21.922	3	1378.7932	1378.7932	L	K	144	157
PSM	KGTEITHAVVIK	815	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6352	18.916	3	1294.7609	1294.7609	A	K	310	322
PSM	KHELQANCYEEVKD	816	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4	ms_run[2]:scan=6047	18.515	3	1761.7992	1761.7992	I	R	132	146
PSM	KHGYIGEFEIIDDH	817	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10879	24.792	3	1671.7893	1671.7893	M	R	43	57
PSM	KHLSPYATLTVGDSSH	818	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8417	21.623	3	1711.8529	1711.8529	T	K	817	833
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	819	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35,25-UNIMOD:4	ms_run[2]:scan=11638	26.208	3	2806.3167	2806.3167	L	K	91	118
PSM	KIHSANHMDDNDGELDTPINYSL	820	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=10350	23.99	3	2614.1606	2614.1606	H	K	906	929
PSM	KKLALHSGMDYAIMTGGDVAPMG	821	sp|Q9NVI7-3|ATD3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35,14-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=8366	21.563	3	2410.1331	2410.1331	A	R	284	307
PSM	KKQELEEICHDLEA	822	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:4	ms_run[2]:scan=9624	23.096	3	1740.8352	1740.8352	A	R	909	923
PSM	KLEPLGETHHNDFY	823	sp|Q3SXY8-2|AR13B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9051	22.421	3	1698.8002	1698.8002	P	R	286	300
PSM	KLKGEMMDLQHGSLFL	824	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:35	ms_run[2]:scan=11156	25.253	3	1861.943	1861.9430	D	R	57	73
PSM	KLKGEMMDLQHGSLFLQTP	825	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=10214	23.81	3	2204.097	2204.0970	D	K	58	77
PSM	KMKETAENYLGHTA	826	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7219	20.162	3	1591.7664	1591.7664	M	K	173	187
PSM	KNIHQSVSEQIK	827	sp|Q14012|KCC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4776	16.771	2	1409.7627	1409.7627	D	K	284	296
PSM	KPWVSDFSHPHYLAG	828	sp|Q96KP4-2|CNDP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10490	24.185	3	1739.842	1739.8420	G	R	299	314
PSM	KQQMLEQHLQDVR	829	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35	ms_run[2]:scan=6630	19.281	3	1667.8413	1667.8413	E	K	140	153
PSM	KRDQPAFTPSGILTPHALGS	830	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11019	25.019	3	2092.1065	2092.1065	M	R	350	370
PSM	KSEMEMAHLYSLCDAAHAQTEVAK	831	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,6-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=8721	21.987	4	2751.2302	2751.2302	A	K	576	600
PSM	KSGGASHSELIHNL	832	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7571	20.603	3	1448.7372	1448.7372	W	R	4	18
PSM	KSHLLNCCPHDVLSGT	833	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=8441	21.651	3	1836.8611	1836.8611	C	R	34	50
PSM	KSLAPSIHGHDYV	834	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7760	20.831	3	1422.7256	1422.7256	A	K	301	314
PSM	KSPHFQVVNEETPKD	835	sp|Q9Y3P9-3|RBGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6994	19.835	3	1753.8635	1753.8635	P	K	388	403
PSM	KSQLDIIIHSLK	836	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11489	25.905	3	1393.8293	1393.8293	S	K	144	156
PSM	KSREAIDSPVSFLALHNQI	837	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11990	27.141	3	2124.1328	2124.1328	A	R	547	566
PSM	KTAFHQEQGHQLL	838	sp|P51580|TPMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7210	20.147	3	1535.7845	1535.7845	G	K	37	50
PSM	KTFSQSSHLVQH	839	sp|Q6DD87|ZN787_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5002	17.104	2	1397.7052	1397.7052	G	R	101	113
PSM	KTIRNLSTVMDEIHTVL	840	sp|Q8IX12-2|CCAR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=11325	25.556	3	1985.0616	1985.0616	N	K	1098	1115
PSM	KTLEQHDNIVTHY	841	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6900	19.69	3	1596.7896	1596.7896	K	K	643	656
PSM	KVHQLDVAIPLHL	842	sp|Q9HAU5|RENT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11608	26.14	3	1481.8718	1481.8718	V	K	1134	1147
PSM	KVIQYLAYVASSHKS	843	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10525	24.235	3	1692.9199	1692.9199	K	K	186	201
PSM	KVLLQGKGDSEH	844	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4213	15.924	2	1309.699	1309.6990	V	K	1234	1246
PSM	KWAHLDIAGVMTNKDEVPYL	845	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=11879	26.795	4	2315.162	2315.1620	P	R	445	465
PSM	RAHGGPNFMMHSGISQASEYDDPPGL	846	sp|A5YKK6-3|CNOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=9502	22.958	4	2802.2126	2802.2126	D	R	1818	1844
PSM	RAKEMDLVGLGLHPLFSS	847	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12290	28.308	3	1969.0455	1969.0455	K	R	533	551
PSM	RALTQTGGPHVKA	848	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4624	16.559	3	1334.7419	1334.7419	A	R	1283	1296
PSM	RALTVAHELLCNKPEEE	849	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=9398	22.839	3	2008.0048	2008.0048	T	K	364	381
PSM	RALVDHENVISCPHLGAST	850	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:4	ms_run[2]:scan=8869	22.181	4	2075.0218	2075.0218	D	K	270	289
PSM	RATSLGRPEEEEDELAH	851	sp|P36551|HEM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7060	19.934	3	1937.9079	1937.9079	T	R	109	126
PSM	RCILPFDKETGFH	852	sp|Q9GZT3-2|SLIRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=10290	23.916	3	1618.7926	1618.7926	R	R	47	60
PSM	RDALSDLALHFLNKM	853	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:35	ms_run[2]:scan=12576	29.642	3	1758.9087	1758.9087	L	K	276	291
PSM	RDDSFFGETSHNYH	854	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8520	21.745	3	1710.7023	1710.7023	C	K	231	245
PSM	REAIQHPADEKLQE	855	sp|Q9NUQ9|CYRIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5296	17.491	3	1662.8325	1662.8325	I	K	64	78
PSM	RECLQALEFLHANQVIH	856	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:4	ms_run[2]:scan=11878	26.792	3	2077.0527	2077.0527	C	R	350	367
PSM	RFAEVECLAESHQHLS	857	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4	ms_run[2]:scan=9530	22.991	3	1911.8897	1911.8897	T	K	1821	1837
PSM	RFIIQSEKPPHYLES	858	sp|P14735-2|IDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9519	22.978	3	1842.9628	1842.9628	L	R	292	307
PSM	RGAGAESSHPVRNAQSNALQE	859	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4773	16.767	3	2178.0526	2178.0526	G	R	2425	2446
PSM	RGGHFAAFEEPELLAQDIR	860	sp|P07099|HYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11918	26.904	4	2155.0811	2155.0811	V	K	428	447
PSM	RGNHETDNMNQIYGFEGEVKA	861	sp|P53041|PPP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35	ms_run[2]:scan=9401	22.841	3	2424.0764	2424.0764	L	K	301	322
PSM	RGRAELVCLSGPHPVPDPPGPEGA	862	sp|Q8WZ82|OVCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4	ms_run[2]:scan=9844	23.347	3	2464.2281	2464.2281	L	R	34	58
PSM	RGVAGAHGLLCLLSDHVD	863	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=12012	27.218	3	1888.9578	1888.9578	E	K	47	65
PSM	RIDQVNQLLELDHQK	864	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10757	24.606	3	1847.9854	1847.9854	G	R	401	416
PSM	RIGGGDTTEHIQTHFES	865	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7727	20.794	3	1883.8762	1883.8762	W	K	1462	1479
PSM	RKPQLELAMVPHYGGIN	866	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10905	24.825	3	1922.0196	1922.0196	E	R	137	154
PSM	RKQEEQMETEHQTTCNLQ	867	sp|O75475-2|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=4025	15.506	3	2305.0063	2305.0063	K	-	316	334
PSM	RLAEDDKDGVMAH	868	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=3858	15.163	3	1471.6725	1471.6725	R	K	493	506
PSM	RLSDFGFSCHLEPGEKL	869	sp|P15735-2|PHKG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:4	ms_run[2]:scan=11305	25.524	3	1990.9571	1990.9571	I	R	168	185
PSM	RMHCSGLAWHPDVATQMVLASEDD	870	sp|O94979-6|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35,4-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=10603	24.355	4	2757.1945	2757.1945	N	R	213	237
PSM	RMHEDINEEWISDKT	871	sp|P28331-3|NDUS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=8833	22.136	3	1917.8527	1917.8527	P	R	165	180
PSM	RMLLQHQAEVNATDHTG	872	sp|Q8NB46|ANR52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=5876	18.287	3	1935.9221	1935.9221	L	R	875	892
PSM	RNAHSTAIAGLTFLH	873	sp|Q8NI36|WDR36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10665	24.454	3	1607.8532	1607.8532	M	R	329	344
PSM	RNKESPVFAPVYFPEELH	874	sp|P09601|HMOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11789	26.566	3	2158.0847	2158.0847	E	R	67	85
PSM	RPAPGFHHGDGPGNAVQEIMIPAS	875	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10559	24.284	3	2454.1863	2454.1863	G	K	172	196
PSM	RPPKPPTFGEFLSQH	876	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10963	24.928	3	1736.8998	1736.8998	A	K	323	338
PSM	RPVTEKLPANHPLLTGQ	877	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8065	21.21	3	1870.0425	1870.0425	V	R	182	199
PSM	RQALEQFHQLSQVLH	878	sp|Q9UJX6-2|ANC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10840	24.732	3	1832.9646	1832.9646	C	R	234	249
PSM	RQHIVNDMNPGNLHLFINAYNS	879	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=11285	25.495	3	2582.2448	2582.2448	Y	R	212	234
PSM	RQLYHLGVVEAYSGLTK	880	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10799	24.672	4	1933.0421	1933.0421	V	K	248	265
PSM	RRIQDPVLQAVTSQTSLPGH	881	sp|Q9UBP6|TRMB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10819	24.703	3	2202.1869	2202.1869	F	-	257	277
PSM	RSADWLGLFAPHHGPP	882	sp|A8MXV4|NUD19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12094	27.497	3	1756.8798	1756.8798	D	R	72	88
PSM	RSAGLPSHSSVISQHS	883	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5783	18.16	3	1648.8281	1648.8281	L	K	41	57
PSM	RSLHDALCVLAQTVKDS	884	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4	ms_run[2]:scan=11929	26.937	3	1911.9836	1911.9836	E	R	341	358
PSM	RSLLSQMLHYDPNK	885	sp|P24941-2|CDK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11593	26.112	3	1700.8668	1700.8668	G	R	226	240
PSM	RSVDEVNYWDKQDHPIS	886	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9063	22.435	3	2086.9708	2086.9708	Y	R	346	363
PSM	RTPLTSADEHVHS	887	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5143	17.298	3	1448.7008	1448.7008	G	K	956	969
PSM	RTVDATGKEIELTH	888	sp|O43395-3|PRPF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6849	19.619	3	1568.8158	1568.8158	G	R	128	142
PSM	RVAPEEHPVLLTEAPLNPKAN	889	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9822	23.322	3	2294.2383	2294.2383	L	R	95	116
PSM	RVHLPTQPAADTYSEFH	890	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9426	22.871	3	1967.949	1967.9490	P	K	342	359
PSM	RVLSAPPHFHFGQTN	891	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9487	22.942	3	1706.8641	1706.8641	V	R	30	45
PSM	RVPAKSTLLQVLQHQ	892	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10586	24.329	3	1716.9999	1716.9999	Y	R	339	354
PSM	RVREEVPLELVEAHV	893	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11574	26.074	3	1773.9737	1773.9737	S	K	724	739
PSM	RVRGVSSESSGD	894	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3524	14.727	2	1234.5902	1234.5902	Q	R	338	350
PSM	RVVDLMAHMASKE	895	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:35	ms_run[2]:scan=6764	19.485	3	1501.7381	1501.7381	N	-	281	294
PSM	RYAPTEVGLHEMHI	896	sp|O75369-6|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9921	23.429	3	1651.8141	1651.8141	V	K	1763	1777
PSM	RDGVYFLYEALHGPPK	897	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=12480	29.2160991152	3	1860.953987	1860.952269	V	K	232	248
PSM	RRSGGDGGDEVEGSGVGAGEGETVQHFPLA	898	sp|Q96DT7|ZBT10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=9896	23.405410234399998	4	2926.352850	2926.344155	S	R	208	238
PSM	RGKDAAEIVLEAFCAHASQ	899	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	14-UNIMOD:4	ms_run[1]:scan=12461	29.125043365866667	3	2073.014377	2072.010923	L	R	576	595
PSM	KIAAGIKNNSNGHQL	900	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5324	17.529713298133334	3	1564.856089	1563.848138	C	K	4664	4679
PSM	KKVVVEQLNLLVK	901	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=10161	23.730120582933335	3	1508.965841	1508.965400	E	R	206	219
PSM	KKLLDGPSTEKDLDE	902	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7120	20.027345129333334	3	1686.867972	1686.867596	W	K	74	89
PSM	KKEEDNDEIKIGTSC	903	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:4	ms_run[1]:scan=6161	18.6614578568	3	1764.819349	1764.819994	N	K	143	158
PSM	KKVYENYPTYDLTER	904	sp|P35659|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8710	21.975425765066667	3	1917.948598	1917.947243	C	K	348	363
PSM	KKALEQLNGFELAGRPM	905	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	17-UNIMOD:35	ms_run[1]:scan=9991	23.5142221608	3	1918.993626	1917.014218	A	K	305	322
PSM	KKETKPEPMEEDLPEN	906	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	9-UNIMOD:35	ms_run[1]:scan=5114	17.261075498399997	3	1928.904345	1928.903724	P	K	206	222
PSM	KRSQTSTADSDLKEDGISS	907	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5734	18.10159695626667	3	2023.965246	2023.965806	P	R	434	453
PSM	RRAPEEELPPLDPEEIR	908	sp|Q8IY67|RAVR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=10206	23.795111927466667	3	2045.054829	2045.054168	E	K	29	46
PSM	KKPKLSEEVVVAPNQESGM	909	sp|Q6PJT7|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	19-UNIMOD:35	ms_run[1]:scan=7410	20.400577829333333	3	2085.079005	2085.077606	L	K	470	489
PSM	KKMSADNQLQVIFITNDR	910	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	3-UNIMOD:35	ms_run[1]:scan=10811	24.68939745786667	3	2136.100624	2136.099738	L	R	161	179
PSM	KRTVEEEDQIFLDGQENK	911	sp|Q96HA1|P121A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=9152	22.540680337333335	3	2177.065478	2177.060041	K	R	322	340
PSM	KKLNSPEETAFQTPKSSQMP	912	sp|Q9BTX1|NDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	19-UNIMOD:35	ms_run[1]:scan=7336	20.31353869333333	3	2263.115476	2263.115448	P	R	402	422
PSM	KKTLDNVAIVEEEKMEAVPDVE	913	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:35	ms_run[1]:scan=9955	23.468113833866667	3	2501.272254	2501.257087	L	R	865	887
PSM	RKPDAKPENFITQIETTPTETAS	914	sp|Q96IY1|NSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=10940	24.880604529866666	3	2573.299731	2573.297311	H	R	226	249
PSM	KRNEDEDSPNKLYTLVTYVPVTTF	915	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=12527	29.441922458399997	4	2828.423925	2828.423240	R	K	91	115
PSM	KAETPHGAEEECKAETPHGAEEEC	916	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=4640	16.578	4	2695.1126	2695.1126	H	R	213	237
PSM	KAGKFPSLLTHNENMVA	917	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:35	ms_run[2]:scan=9132	22.515	3	1871.9564	1871.9564	N	K	130	147
PSM	KALYEHLTAKNT	918	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6186	18.696	3	1387.746	1387.7460	A	K	1338	1350
PSM	KAMAPLHPHPAGM	919	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=3915	15.293	3	1388.6693	1388.6693	Q	R	155	168
PSM	KCVACDASKPTH	920	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=3419	14.603	3	1372.6228	1372.6228	L	K	1800	1812
PSM	KDIQHWESLKPEE	921	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8566	21.797	3	1637.8049	1637.8049	S	R	111	124
PSM	KDSIVHQAGMLK	922	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6751	19.471	3	1325.7126	1325.7126	S	R	106	118
PSM	KDVFHMVVEVPRWSNA	923	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=11200	25.331	3	1928.9567	1928.9567	D	K	41	57
PSM	KDVQDLDGGKEHE	924	sp|Q96T51-3|RUFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4168	15.812	3	1468.6794	1468.6794	L	R	287	300
PSM	KEAHLTPYSLQAIKAS	925	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9396	22.835	3	1755.9519	1755.9519	N	R	1067	1083
PSM	KEDVFVHQTAIK	926	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6894	19.681	3	1413.7616	1413.7616	T	K	113	125
PSM	KEELQHEFDLLK	927	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10540	24.256	3	1527.7933	1527.7933	S	K	899	911
PSM	KELGITALHIKL	928	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11481	25.884	2	1334.8286	1334.8286	C	R	86	98
PSM	KEVVEAHVDQKN	929	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3748	14.983	3	1394.7154	1394.7154	V	K	223	235
PSM	KFICDASSLHQVR	930	sp|Q9BSH4|TACO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:4	ms_run[2]:scan=7650	20.7	3	1559.7878	1559.7878	F	K	231	244
PSM	KFNGGGHINHSIFWTNLSPNGGGEP	931	sp|P04179-3|SODM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11306	25.526	4	2636.252	2636.2520	L	K	89	114
PSM	KHESQMDSVVKDL	932	sp|Q00765|REEP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=7056	19.93	3	1530.7348	1530.7348	L	K	147	160
PSM	KHESQMDSVVKDL	933	sp|Q00765|REEP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9227	22.634	3	1514.7399	1514.7399	L	K	147	160
PSM	KHGDEIYIAPSGVQKE	934	sp|Q96GX9|MTNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7493	20.502	3	1769.8948	1769.8948	L	R	51	67
PSM	KHGSYEDAVHSGALND	935	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6505	19.121	3	1698.7598	1698.7598	D	-	541	557
PSM	KHIVLSGGSTMYPGLPSRLE	936	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=9980	23.501	3	2157.1252	2157.1252	Y	R	299	319
PSM	KHSLSLLDLEQKL	937	sp|P56589|PEX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11910	26.879	3	1522.8719	1522.8719	L	K	197	210
PSM	KHVINFDLPSDIEEYVH	938	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12315	28.422	3	2054.0109	2054.0109	V	R	495	512
PSM	KIEQSQHLFQAH	939	sp|P53367|ARFP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6780	19.505	3	1464.7474	1464.7474	P	K	289	301
PSM	KIGKVDCTQHYELCSGNQV	940	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7983	21.117	3	2235.0412	2235.0412	V	R	133	152
PSM	KINSQIKIDAHLN	941	sp|A0AVT1|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8278	21.457	3	1492.8362	1492.8362	L	K	531	544
PSM	KKAQDALPFFMMHLGYE	942	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=12261	28.174	3	2040.9801	2040.9801	R	K	1036	1053
PSM	KKFDPMGQQTCSAHPA	943	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:4	ms_run[2]:scan=6223	18.748	3	1801.824	1801.8240	L	R	18	34
PSM	KKFEEFQTDMAAHEE	944	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8374	21.573	3	1838.8145	1838.8145	Q	R	189	204
PSM	KKVEWTSDTVDNEHMG	945	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:35	ms_run[2]:scan=6258	18.791	3	1890.8418	1890.8418	E	R	39	55
PSM	KKVIQYLAYVASSH	946	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10573	24.306	3	1605.8879	1605.8879	T	K	185	199
PSM	KLDPHNHVLYSN	947	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6421	19.001	2	1435.7208	1435.7208	I	R	32	44
PSM	KLHNMIVDLDNVVK	948	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11201	25.334	3	1636.8971	1636.8971	G	K	298	312
PSM	KLHSLVKPSVDYVCQL	949	sp|O43813|LANC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4	ms_run[2]:scan=10288	23.914	3	1885.0132	1885.0132	G	K	239	255
PSM	KLHSTSQNINLGPSGNPHA	950	sp|Q96BR1-2|SGK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6554	19.185	3	1970.9922	1970.9922	Q	K	139	158
PSM	KLKECEDTHLGEEVD	951	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4	ms_run[2]:scan=6390	18.965	3	1800.82	1800.8200	I	R	1023	1038
PSM	KLLTQHENIKNEIDNYEEDYQ	952	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10416	24.088	4	2635.2402	2635.2402	E	K	1086	1107
PSM	KLPNLTHLNLSGNKL	953	sp|Q92688-2|AN32B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10872	24.784	3	1660.9624	1660.9624	E	K	86	101
PSM	KLRDYIWNTLNSG	954	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11865	26.753	2	1578.8154	1578.8154	E	R	327	340
PSM	KLREVVETPLLHPE	955	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9611	23.081	2	1658.9356	1658.9356	E	R	49	63
PSM	KNLESPEKHLQN	956	sp|P26374|RAE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4385	16.228	3	1435.7419	1435.7419	S	-	645	657
PSM	KNLVHVAHDLIQ	957	sp|Q9BPY3|F118B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9182	22.579	2	1385.7779	1385.7779	D	K	98	110
PSM	KPAFGTPLEEHLK	958	sp|Q68EM7-2|RHG17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8883	22.199	3	1465.7929	1465.7929	E	R	247	260
PSM	KQHAVINYDASTDEHLV	959	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8903	22.227	3	1938.9436	1938.9436	D	K	41	58
PSM	KQLLLQEVENHK	960	sp|Q12981-2|SEC20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8949	22.294	2	1477.8253	1477.8253	E	K	74	86
PSM	KQVEEALHQLHA	961	sp|O00233-2|PSMD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7832	20.94	2	1401.7365	1401.7365	M	R	91	103
PSM	KQYHQEIEEFVSNLVK	962	sp|Q6NZY4|ZCHC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12303	28.364	3	1990.016	1990.0160	S	R	106	122
PSM	KSKGESDDFHMDFDSAVAP	963	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10669	24.458	3	2081.9	2081.9000	K	R	1490	1509
PSM	KTHLPTIESAIHSVL	964	sp|Q70UQ0-4|IKIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12066	27.412	3	1644.9199	1644.9199	C	R	270	285
PSM	KTKDEYLINSQTTEHIV	965	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9381	22.819	3	2018.032	2018.0320	H	K	538	555
PSM	KTQDQISNIKYHEEFE	966	sp|Q14847-3|LASP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8516	21.74	3	2007.9538	2007.9538	K	K	56	72
PSM	KTVYSHLFDHVVN	967	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10111	23.671	3	1557.794	1557.7940	A	R	425	438
PSM	KVEPHATIAEIKNLFT	968	sp|Q9NZ01|TECR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12000	27.174	3	1809.9989	1809.9989	D	K	22	38
PSM	KVEWTSDTVDNEHMGR	969	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=6794	19.522	3	1918.8479	1918.8479	K	R	40	56
PSM	KVHVGDEDFVHL	970	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9984	23.505	2	1393.699	1393.6990	I	R	56	68
PSM	KVINDKHDDVMA	971	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=4059	15.57	2	1399.6766	1399.6766	S	K	715	727
PSM	KVTHTGQVYDDKDY	972	sp|O75380|NDUS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5489	17.758	3	1667.7791	1667.7791	E	R	38	52
PSM	KVVDHYENPRNVGSLD	973	sp|Q9H1K1|ISCU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7258	20.225	3	1840.9068	1840.9068	K	K	38	54
PSM	KYGIICMEDLIHEIYTVGK	974	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=12272	28.224	4	2297.1436	2297.1436	G	R	181	200
PSM	MKLLTHNLLSSHV	975	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10245	23.857	3	1491.8232	1491.8232	-	R	1	14
PSM	RAHPAAEEEDDPDRPIEFSSS	976	sp|Q4G0I0|CSMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8025	21.165	3	2354.0411	2354.0411	D	K	35	56
PSM	RAHPAAEEEDDPDRPIEFSSS	977	sp|Q4G0I0|CSMT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8040	21.182	3	2354.0411	2354.0411	D	K	35	56
PSM	RAHSSMVGVNLPQKAGGFLM	978	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=9732	23.207	3	2131.0667	2131.0667	H	K	143	163
PSM	RAKLCSSAETLESHPDIG	979	sp|O96028-6|NSD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4	ms_run[2]:scan=8052	21.195	3	1969.9527	1969.9527	R	K	402	420
PSM	RASVLFDTMQHHLALN	980	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11410	25.731	3	1851.9414	1851.9414	F	R	1833	1849
PSM	RDGVYFLYEALHGPPK	981	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12140	27.669	4	1860.9523	1860.9523	V	K	232	248
PSM	RDIKAGNILLNTEGHA	982	sp|Q13043-2|STK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9122	22.505	3	1720.922	1720.9220	H	K	148	164
PSM	RDLKPENILLDEEGHI	983	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11391	25.688	3	1889.9847	1889.9847	Y	K	192	208
PSM	RDLTHSDSESSLHMSD	984	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:35	ms_run[2]:scan=4663	16.609	3	1831.7643	1831.7643	Q	R	514	530
PSM	REDFEWVYTDQPHADR	985	sp|O15121|DEGS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10522	24.231	3	2062.9133	2062.9133	S	R	7	23
PSM	REDLHILFSNHGEI	986	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11302	25.521	3	1678.8427	1678.8427	C	K	246	260
PSM	REKLLEHLPQEVPYNVQQ	987	sp|O75616|ERAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10381	24.043	3	2219.1699	2219.1699	I	K	353	371
PSM	REYVNSTSEESHDEDEIRPVQQQDLH	988	sp|Q8NBU5|ATAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7678	20.735	5	3139.4079	3139.4079	V	R	312	338
PSM	RGITGVEDKESWHG	989	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7408	20.399	3	1569.7536	1569.7536	G	K	246	260
PSM	RGLEYLYLNVHDEDRDDQT	990	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10854	24.751	3	2350.0826	2350.0826	G	R	97	116
PSM	RGLNSQSSDDHLNK	991	sp|A8CG34|P121C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3927	15.311	3	1569.7495	1569.7495	K	R	351	365
PSM	RGVAGAHGLLCLLSDHVD	992	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:4	ms_run[2]:scan=12034	27.293	3	1888.9578	1888.9578	E	K	47	65
PSM	RHLTPEPDIVASTK	993	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7139	20.053	2	1562.8417	1562.8417	P	K	191	205
PSM	RHPWDDISYVLPEHMSM	994	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=11841	26.695	3	2143.9455	2143.9455	Y	-	814	831
PSM	RHPWDDISYVLPEHMSM	995	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=11970	27.074	3	2143.9455	2143.9455	Y	-	814	831
PSM	RIIGAKDHASIQMNVAEVD	996	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35	ms_run[2]:scan=7842	20.95	3	2082.0528	2082.0528	N	K	22	41
PSM	RILGIPTQLYSHHFQ	997	sp|Q86UA1|PRP39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11147	25.239	3	1808.9686	1808.9686	D	R	231	246
PSM	RLDHSTDFFSEAFEHNG	998	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11664	26.26	3	2007.8711	2007.8711	Q	R	662	679
PSM	RLHQEYVPSAHLSGTCTCLAWAPA	999	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	16-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=10933	24.866	3	2724.2901	2724.2901	N	R	47	71
PSM	RLMVHTVATFNSIKELNE	1000	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35	ms_run[2]:scan=10343	23.98	3	2117.0939	2117.0939	A	R	1176	1194
PSM	RLPAFTLSHLESH	1001	sp|Q969V3-2|NCLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10610	24.364	3	1506.7943	1506.7943	R	R	379	392
PSM	RLPPHGYPLEHPFN	1002	sp|Q9UBL3-2|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9276	22.697	3	1672.8474	1672.8474	Q	K	230	244
PSM	RLVEVHDPPLHQPSAN	1003	sp|O94864-2|ST65G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7488	20.496	3	1807.9329	1807.9329	F	K	28	44
PSM	RQATINIGTIGHVAHG	1004	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9144	22.532	3	1643.8856	1643.8856	S	K	38	54
PSM	RQLEIKQIPSDGHCMY	1005	sp|Q8N6M0-2|OTU6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=8390	21.592	3	1989.9401	1989.9401	A	K	44	60
PSM	RQLYVLGHEAMK	1006	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=7254	20.222	3	1459.7606	1459.7606	S	R	17	29
PSM	RQRQPPGTQQSHSSPGEITSSPQGLDNPALL	1007	sp|Q5TDH0-2|DDI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9995	23.517	4	3282.6341	3282.6341	P	R	108	139
PSM	RSAGIKVIMVTGDHPITA	1008	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9867	23.375	3	1865.0193	1865.0193	C	K	607	625
PSM	RSASASHQADIKEA	1009	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3649	14.875	3	1469.7223	1469.7223	R	R	96	110
PSM	RSGTPMKEAVGHTGYLTFAT	1010	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=9335	22.763	3	2139.0419	2139.0419	F	K	266	286
PSM	RSNAYHFPDEPYKDGYI	1011	sp|Q9NUQ7|UFSP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10422	24.097	3	2070.9436	2070.9436	K	R	245	262
PSM	RSQLESHSDQNMHQAEEWF	1012	sp|P07197|NFM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=9672	23.144	4	2374.0033	2374.0033	I	K	274	293
PSM	RVELHSTCQTISVDRQ	1013	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:4	ms_run[2]:scan=7106	20	3	1927.9534	1927.9534	A	R	729	745
PSM	RVFQSLPHENKPLTLSNYQTN	1014	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9760	23.25	4	2485.2714	2485.2714	L	K	68	89
PSM	RVPTANVSVVDLTCRLE	1015	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4	ms_run[2]:scan=11620	26.168	3	1928.0149	1928.0149	F	K	192	209
PSM	RVVDLMAHMASKE	1016	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=7185	20.115	3	1501.7381	1501.7381	N	-	281	294
PSM	RVVDLMAHMASKE	1017	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9641	23.113	3	1485.7432	1485.7432	N	-	281	294
PSM	RYDHLDPTEMEKVE	1018	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:35	ms_run[2]:scan=6848	19.618	3	1776.7989	1776.7989	E	K	725	739
PSM	RYTEFYHVPTHSDAS	1019	sp|Q96HC4-3|PDLI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8169	21.332	3	1808.8118	1808.8118	E	K	123	138
PSM	RHQGVMVGMGQKDSYVGDEAQS	1020	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6029	18.4943215256	4	2411.050607	2410.064158	P	K	41	63
PSM	RGQQHASVGAAFYVTGVTNQKM	1021	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	22-UNIMOD:35	ms_run[1]:scan=9313	22.7360562824	4	2366.196264	2365.159713	F	R	120	142
PSM	RQLFHPEQLITGKEDAANNYA	1022	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10826	24.71067857706667	3	2415.183947	2414.197872	Y	R	84	105
PSM	KTHLPGFVEQAEALKA	1023	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10740	24.57631707706667	3	1738.944786	1737.941370	S	K	102	118
PSM	RDLQSNVEHLTEKM	1024	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:35	ms_run[1]:scan=7880	20.991321831466667	3	1714.830740	1714.830834	I	K	613	627
PSM	KQPVTKITNHPSN	1025	sp|O95983|MBD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3691	14.919318199200001	3	1462.788266	1462.789226	F	K	109	122
PSM	RPPKPPTFGEFLSQH	1026	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10894	24.810097187466667	3	1737.926218	1736.899839	A	K	323	338
PSM	KENSTHFSQPNSTKVQ	1027	sp|Q06787|FMR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4663	16.608804686666666	3	1831.889424	1830.886040	I	R	359	375
PSM	RLVPYGNHSYLESLTDKS	1028	sp|Q14457|BECN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10406	24.076128506666667	3	2079.037477	2078.043269	Y	K	329	347
PSM	KDVVVQHVHFDGLG	1029	sp|Q9Y512|SAM50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9693	23.163576166933336	3	1549.803106	1548.804876	N	R	43	57
PSM	RELAFGDHELVIRGT	1030	sp|Q92581|SL9A6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10448	24.131388681866667	3	1711.923085	1711.900568	D	R	631	646
PSM	KHTPADVQLIGTDSQGNKF	1031	sp|P42684|ABL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9180	22.576150893866668	3	2055.053658	2055.038518	L	K	940	959
PSM	KKLTELGTVDPKN	1032	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6273	18.815836021066666	3	1441.814677	1441.814044	L	K	1464	1477
PSM	KKYDAFLASESLIKQIP	1033	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=12149	27.702250630666665	4	1950.082947	1950.082615	A	R	105	122
PSM	KKIYEDGDDDMK	1034	sp|Q9HB71|CYBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	11-UNIMOD:35	ms_run[1]:scan=3700	14.928436584266667	3	1471.648959	1471.650075	L	R	196	208
PSM	RDAAGSGDKPGADTGR	1035	sp|Q96EL3|RM53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3351	14.508243577866667	3	1529.719577	1529.718246	A	-	97	113
PSM	MKHYEVEILDAKT	1036	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:35	ms_run[1]:scan=8885	22.2011243376	2	1591.790974	1591.791595	-	R	1	14
PSM	KKGAAVDGGKLDVGNAEV	1037	sp|P51572|BAP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7681	20.739182187999997	3	1726.918270	1726.921363	L	K	158	176
PSM	KKLEAQETLNEEDKA	1038	sp|Q9UIF9|BAZ2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5654	17.9995330528	3	1744.883640	1744.884309	L	K	694	709
PSM	KKIIEDQQESLNKW	1039	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8591	21.823795462666666	3	1757.936143	1757.931199	L	K	316	330
PSM	KKAEAVVNTVDISERE	1040	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7462	20.463394171733334	3	1786.943494	1786.942492	R	K	762	778
PSM	RKPDYEPVENTDEAQK	1041	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5089	17.225527816266666	3	1917.905022	1917.906835	R	K	404	420
PSM	RKEGFGLSENPFASLSPDEQKDE	1042	sp|O15504|NUP42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=11665	26.26170377733333	4	2579.213915	2579.213976	N	K	91	114
PSM	KKTGQPMINLYTDRETG	1043	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:35	ms_run[1]:scan=7754	20.822470790666667	3	1966.978259	1966.978226	N	K	315	332
PSM	RERVTPPEGYEVVTVFPK	1044	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10538	24.251992012266665	3	2102.115421	2102.116040	A	-	312	330
PSM	KKGESQTDIEITREEDFT	1045	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8857	22.16551012	3	2125.017166	2125.017508	Y	R	248	266
PSM	RKTEDTYFISSAGKPTPGTQG	1046	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8005	21.142424913333333	3	2240.110433	2240.107326	P	K	1759	1780
PSM	KALAVVYGPHEIRGS	1047	sp|Q9NPD3|EXOS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8100	21.252	3	1595.8784	1595.8784	T	R	47	62
PSM	KAPLQGDHNHLFI	1048	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9553	23.022	3	1488.7837	1488.7837	Y	R	401	414
PSM	KCGAEDHVEAVK	1049	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4	ms_run[2]:scan=3847	15.142	3	1341.6347	1341.6347	L	K	265	277
PSM	KDDPSKPVHLTAFLGY	1050	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11607	26.138	3	1786.9254	1786.9254	P	K	34	50
PSM	KDIIHDPGRGAPLA	1051	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7449	20.447	3	1458.7943	1458.7943	V	K	46	60
PSM	KDKAATLPHEQ	1052	sp|Q6PD74-2|AAGAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3970	15.381	2	1236.6463	1236.6463	M	R	164	175
PSM	KDVVHLDSEKDF	1053	sp|Q14554|PDIA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8235	21.408	2	1430.7042	1430.7042	A	R	151	163
PSM	KEEIKDDNPHL	1054	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5659	18.01	3	1336.6623	1336.6623	P	K	127	138
PSM	KEFHQAGKPIGLCCIAPVLAA	1055	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=11444	25.802	4	2279.1919	2279.1919	L	K	164	185
PSM	KEHALAQAELLK	1056	sp|O15126-2|SCAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7609	20.646	3	1349.7667	1349.7667	A	R	78	90
PSM	KEIAENALGKH	1057	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4842	16.865	2	1208.6513	1208.6513	S	K	67	78
PSM	KEITEKYPEWLQSH	1058	sp|P40855-5|PEX19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9720	23.195	3	1786.889	1786.8890	L	R	155	169
PSM	KEIYHFTLEKIQP	1059	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10569	24.3	3	1644.8875	1644.8875	A	R	82	95
PSM	KEKNLLHVTDTGVGMT	1060	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=7835	20.944	3	1757.8982	1757.8982	D	R	140	156
PSM	KEKNLLHVTDTGVGMT	1061	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8959	22.31	3	1741.9033	1741.9033	D	R	140	156
PSM	KEKTHVADFAPEVAWVT	1062	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11497	25.92	3	1926.984	1926.9840	E	R	1089	1106
PSM	KELIDHSPKATPDN	1063	sp|O43674-2|NDUB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4779	16.776	3	1563.7893	1563.7893	D	-	124	138
PSM	KERGHTVTEPIQPLEPELPGEGQPEA	1064	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10372	24.028	4	2837.4196	2837.4196	K	R	428	454
PSM	KFAASGGFLHHMAGLSSS	1065	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10365	24.02	3	1803.8726	1803.8726	M	K	200	218
PSM	KFLGGDMEHTHLV	1066	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=8090	21.241	3	1498.7238	1498.7238	S	K	151	164
PSM	KHGEVCPAGWKPGSDTI	1067	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=8692	21.95	3	1837.8781	1837.8781	D	K	168	185
PSM	KHMGDLNGEEADKLDE	1068	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=5804	18.187	3	1815.7945	1815.7945	D	R	4761	4777
PSM	KHTDAAEEVLLEK	1069	sp|Q6NVY1-2|HIBCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8022	21.162	3	1481.7726	1481.7726	S	K	30	43
PSM	KHTTSIFDDFAHYE	1070	sp|Q9BYJ9|YTHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11684	26.312	3	1709.7686	1709.7686	Y	K	527	541
PSM	KIEDAIKVLQYH	1071	sp|O95989|NUDT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10628	24.392	3	1455.8086	1455.8086	F	K	121	133
PSM	KIKGIVEESVTGVH	1072	sp|Q96HN2-4|SAHH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8039	21.181	3	1494.8406	1494.8406	K	R	225	239
PSM	KKFDPMGQQTCSAHPA	1073	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=4456	16.323	3	1817.8189	1817.8189	L	R	18	34
PSM	KKMTGTLETQFTCPFCNHE	1074	sp|P60002|ELOF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9942	23.452	4	2344.0286	2344.0286	K	K	14	33
PSM	KKNIYGNIEDLVVHI	1075	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12302	28.361	3	1753.9727	1753.9727	M	K	322	337
PSM	KKVMSQEIQEQLH	1076	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7350	20.329	3	1596.8294	1596.8294	K	K	3253	3266
PSM	KLDKSQIHDIVLVGGST	1077	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9916	23.425	3	1808.9996	1808.9996	A	R	325	342
PSM	KLIDVNHYAKDEVAA	1078	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8660	21.909	3	1684.8784	1684.8784	Q	R	637	652
PSM	KLKDLFDYSPPLH	1079	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11339	25.583	3	1571.8348	1571.8348	E	K	502	515
PSM	KLKQESDQLVLNQHPASD	1080	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7381	20.365	3	2049.0491	2049.0491	N	K	328	346
PSM	KLLETHIHNQGLAAIE	1081	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9360	22.791	3	1785.9737	1785.9737	K	K	338	354
PSM	KLQFHNVKPECLEAYN	1082	sp|O75323|NIPS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=9427	22.872	3	1988.9778	1988.9778	Y	K	75	91
PSM	KLTDFLSFYTLPSTVMHHPAH	1083	sp|O60551|NMT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:35	ms_run[2]:scan=12349	28.58	4	2457.2151	2457.2151	G	K	395	416
PSM	KLYHNEVEIEKLN	1084	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8134	21.289	3	1627.857	1627.8570	F	K	227	240
PSM	KMQLPSAAGLHPTGHQSKEELG	1085	sp|Q15050|RRS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=7368	20.35	4	2331.1641	2331.1641	H	R	198	220
PSM	KMSPYKDILETHL	1086	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=10217	23.813	3	1589.8123	1589.8123	L	R	1407	1420
PSM	KNDAPLHEINGDHL	1087	sp|O75487|GPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8202	21.369	3	1571.7692	1571.7692	N	K	44	58
PSM	KNIHQSVSEQIK	1088	sp|Q14012|KCC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4790	16.79	3	1409.7627	1409.7627	D	K	284	296
PSM	KNKEDQYDHLDAADMT	1089	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7966	21.097	3	1892.8211	1892.8211	F	K	717	733
PSM	KNVTGHYISPFHDIPL	1090	sp|Q9H2U2-6|IPYR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11389	25.685	3	1836.9523	1836.9523	F	K	53	69
PSM	KPCNHVLSLSFPIR	1091	sp|P49448|DHE4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:4	ms_run[2]:scan=10971	24.938	3	1666.8977	1666.8977	I	R	110	124
PSM	KPEDQPHFDIKDEF	1092	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10543	24.261	3	1743.8104	1743.8104	F	-	159	173
PSM	KPHSVSLNDTETR	1093	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4715	16.676	3	1482.7427	1482.7427	P	K	161	174
PSM	KPIEVEHSVPK	1094	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5081	17.217	3	1261.703	1261.7030	G	R	66	77
PSM	KPNHYAPSNDIYGGEMHV	1095	sp|Q16625-6|OCLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:35	ms_run[2]:scan=7467	20.469	3	2043.9109	2043.9109	F	R	18	36
PSM	KPQEPGHFYSEH	1096	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5483	17.754	3	1454.6579	1454.6579	C	R	255	267
PSM	KPRPSADLTNSSAPSPSH	1097	sp|Q7KZI7-13|MARK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4739	16.72	3	1847.9126	1847.9126	L	K	343	361
PSM	KPRPSADLTNSSAPSPSH	1098	sp|Q7KZI7-13|MARK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4864	16.9	3	1847.9126	1847.9126	L	K	343	361
PSM	KPSNPSSHEVVAWIR	1099	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9332	22.76	3	1705.89	1705.8900	D	R	96	111
PSM	KQPEHLGLDQYIIK	1100	sp|Q9BPX6-2|MICU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10148	23.717	3	1680.9199	1680.9199	E	R	161	175
PSM	KQVDFWFGDANLHKD	1101	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11202	25.335	3	1818.8689	1818.8689	A	R	40	55
PSM	KSGNALFHASTLH	1102	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7453	20.452	3	1381.7102	1381.7102	W	R	251	264
PSM	KSHLEVPLEENVNR	1103	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8222	21.394	3	1662.8689	1662.8689	A	R	121	135
PSM	KSLYDSLIKDHE	1104	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10116	23.677	3	1446.7355	1446.7355	L	K	1149	1161
PSM	KTKAQYEQTLAELH	1105	sp|Q9UKS6|PACN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8402	21.606	3	1658.8628	1658.8628	E	R	201	215
PSM	KTKNIPEAHQDAF	1106	sp|Q96TA2-3|YMEL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5899	18.324	2	1497.7576	1497.7576	M	K	166	179
PSM	KTVSTLHHVLQ	1107	sp|O00764-3|PDXK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5776	18.15	2	1261.7143	1261.7143	E	R	185	196
PSM	KVAANAVDPKNDSHVLIELH	1108	sp|Q15642-5|CIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9102	22.48	4	2169.1542	2169.1542	M	K	253	273
PSM	KVHSESDKAITPQAQEELQ	1109	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6501	19.113	3	2137.0651	2137.0651	G	K	1645	1664
PSM	KVKIADLGNACWVH	1110	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=10035	23.562	3	1609.8399	1609.8399	L	K	476	490
PSM	KYLYPNIDKDHAFG	1111	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9631	23.103	3	1679.8308	1679.8308	L	K	665	679
PSM	KYWDLMNLSEKHD	1112	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11257	25.448	3	1677.7821	1677.7821	Q	K	299	312
PSM	RAKFSAACGPPVTPECEHCGQ	1113	sp|Q9NXH9-2|TRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=7019	19.877	3	2358.0304	2358.0304	A	R	340	361
PSM	RDALLAHGTSFLLHD	1114	sp|Q9H9Y6-5|RPA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11223	25.371	3	1664.8635	1664.8635	E	R	859	874
PSM	RDFPAMVQELHQGGR	1115	sp|P10253|LYAG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35	ms_run[2]:scan=7795	20.874	3	1755.8475	1755.8475	F	R	422	437
PSM	RDFTVSAMHGDMDQKE	1116	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:35	ms_run[2]:scan=6400	18.975	3	1881.7985	1881.7985	A	R	295	311
PSM	RDLNHVCVISETGKA	1117	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:4	ms_run[2]:scan=7296	20.27	3	1697.8519	1697.8519	F	K	200	215
PSM	RDPILFPSFIHSQK	1118	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11501	25.926	3	1683.9097	1683.9097	I	R	156	170
PSM	RDSLHQPQYVEKLE	1119	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8253	21.428	3	1740.8795	1740.8795	L	K	401	415
PSM	REAYHAVVLSYGAEDH	1120	sp|P22570-4|ADRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8608	21.845	3	1815.854	1815.8540	L	R	71	87
PSM	RGKITDLANLSAANHDAAIFPGGFGAA	1121	sp|P0DPI2|GAL3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12127	27.62	4	2654.3565	2654.3565	A	K	114	141
PSM	RGLDFLHANCIVH	1122	sp|P11802-2|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:4	ms_run[2]:scan=10969	24.935	3	1550.7776	1550.7776	L	R	6	19
PSM	RGRIVETEAYLGPEDEAAHS	1123	sp|P29372-5|3MG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8607	21.844	3	2199.0556	2199.0556	L	R	101	121
PSM	RHSIAQLDPEALGNIK	1124	sp|Q53HL2|BOREA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10080	23.642	3	1760.9533	1760.9533	Q	K	248	264
PSM	RIMYTVFEHTFHV	1125	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=11555	26.024	3	1694.8239	1694.8239	G	R	583	596
PSM	RKVDATDASYPSVNTCVHYL	1126	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:4	ms_run[2]:scan=9985	23.506	3	2295.0954	2295.0954	V	K	2564	2584
PSM	RKYWDVPPPGFEHITPMQY	1127	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:35	ms_run[2]:scan=11297	25.514	3	2376.1361	2376.1361	V	K	89	108
PSM	RLDLAGRDLTDYLM	1128	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=12065	27.407	3	1666.8349	1666.8349	L	K	177	191
PSM	RLNFHPDQEDQFFSLVHE	1129	sp|Q969Z0-2|FAKD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12107	27.547	3	2257.0552	2257.0552	A	K	268	286
PSM	RPLHDAVENDHLEIV	1130	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9466	22.92	3	1755.8904	1755.8904	T	R	1480	1495
PSM	RQAELEEGRPQHQEQL	1131	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5991	18.44	3	1946.9559	1946.9559	Q	R	462	478
PSM	RQELSHALYQHDAAC	1132	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:4	ms_run[2]:scan=6846	19.616	3	1797.8217	1797.8217	T	R	100	115
PSM	RQGELHLTPLHGILQL	1133	sp|Q9NVU0-3|RPC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12069	27.42	3	1824.037	1824.0370	Y	R	120	136
PSM	RQGFPIIFHGVMGKDE	1134	sp|Q9HCE1-2|MOV10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:35	ms_run[2]:scan=10459	24.144	3	1845.9196	1845.9196	P	R	771	787
PSM	RQHEEYIADMALDPAK	1135	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35	ms_run[2]:scan=8160	21.321	3	1901.8942	1901.8942	M	K	165	181
PSM	RQIEETLAHFHLT	1136	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11031	25.037	3	1593.8263	1593.8263	H	K	456	469
PSM	RRAPTCSLDGALPLGAQIPAVH	1137	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=11224	25.373	4	2299.2219	2299.2219	P	R	38	60
PSM	RSHTEEDCTEELFDFLHA	1138	sp|P07919|QCR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4	ms_run[2]:scan=12472	29.18	4	2234.9539	2234.9539	S	R	60	78
PSM	RSLSNTKPTVNEHDLL	1139	sp|O75351|VPS4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8486	21.705	3	1822.9537	1822.9537	L	K	416	432
PSM	RSTSSHGTDEMESSSYRD	1140	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=3565	14.77	3	2046.8185	2046.8185	T	R	146	164
PSM	RTKQGPFTLEEHALPED	1141	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9652	23.125	3	1966.9749	1966.9749	T	K	277	294
PSM	RVAQAQAQHELEIK	1142	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6242	18.773	3	1619.8744	1619.8744	E	K	662	676
PSM	RVENEAEKDLQCHAPV	1143	sp|Q9NPI1|BRD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:4	ms_run[2]:scan=8117	21.27	3	1893.9003	1893.9003	D	R	96	112
PSM	RVLEENQEHYHIVQ	1144	sp|P57740-3|NU107_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7412	20.403	3	1792.8856	1792.8856	K	K	352	366
PSM	RVPVPDERFDFLCQYH	1145	sp|Q9NTK5-3|OLA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4	ms_run[2]:scan=11776	26.531	3	2076.984	2076.9840	S	K	63	79
PSM	RVVDLMAHMASKE	1146	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5013	17.118	3	1517.733	1517.7330	N	-	281	294
PSM	RYPMEHGIVKDWNDME	1147	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=8315	21.5	3	2050.8877	2050.8877	I	R	72	88
PSM	KVILHLKEDQTEYLEE	1148	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9596	23.067539652533334	3	1987.051724	1986.030973	T	R	159	175
PSM	KHIYYITGETKDQVANSAFVE	1149	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=12445	29.055068831733333	4	2412.194379	2412.196141	Q	R	489	510
PSM	KKWDTCAPEVILHAVGG	1150	sp|O95861|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	6-UNIMOD:4	ms_run[1]:scan=11821	26.6480033368	3	1879.989077	1879.961454	C	K	244	261
PSM	RGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSS	1151	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	4-UNIMOD:35	ms_run[1]:scan=12546	29.5248073008	7	6860.3755	6860.3703	N	K	44	108
PSM	KKDEIENSIVH	1152	sp|Q9NYH9|UTP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6075	18.550381473599998	2	1310.685747	1310.683030	F	R	80	91
PSM	RLVPYGNHSYLESLTDKS	1153	sp|Q14457|BECN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10371	24.026849978666668	3	2079.037477	2078.043269	Y	K	329	347
PSM	RVWDLSDIDKDGHLD	1154	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=11378	25.659999488533334	3	1783.856710	1782.853677	G	R	166	181
PSM	RAHVIVMAATNRPNSIDPAL	1155	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:35	ms_run[1]:scan=9057	22.427989432	3	2162.140533	2161.142606	Q	R	338	358
PSM	RNIVQSTEHLHEDNGDVEV	1156	sp|Q6PL18|ATAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8601	21.835534929599998	3	2190.028617	2190.030138	A	R	136	155
PSM	KKLALAGIGQPVK	1157	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7979	21.111727457333334	3	1321.844126	1321.844556	F	K	236	249
PSM	KKLEEEEAEVK	1158	sp|Q9H0E9|BRD8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4435	16.2917880784	2	1330.697200	1330.698011	K	R	149	160
PSM	KKPASGPGAVVRPP	1159	sp|Q9GZR2|REXO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5511	17.7910323424	3	1359.799087	1359.798669	S	K	47	61
PSM	KKESDLNGAQIKL	1160	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8161	21.322090394133333	3	1442.809474	1442.809293	A	R	123	136
PSM	KKGDIVDIKGMGTVQ	1161	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:35	ms_run[1]:scan=6582	19.226754361066664	3	1603.859604	1603.860343	Y	K	35	50
PSM	RKTVTAMDVVYALK	1162	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:35	ms_run[1]:scan=9667	23.138666039466667	3	1609.885310	1609.886164	K	R	79	93
PSM	KKLEELELDEQQK	1163	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7483	20.492002269066667	3	1628.861412	1628.862117	Q	K	39	52
PSM	KKVTQLDLDGPKELS	1164	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8432	21.639875955466668	3	1669.924859	1669.925051	T	R	94	109
PSM	KKLVESLPQEIKANVA	1165	sp|P52815|RM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9771	23.263548746399998	3	1766.030412	1766.030185	A	K	162	178
PSM	KRDPALNSGVSQKPDPA	1166	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4886	16.92696512186667	3	1778.928910	1778.927511	T	K	1442	1459
PSM	RKTLTTVQGIADDYDK	1167	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8804	22.0989730152	3	1822.942799	1822.942492	G	K	41	57
PSM	RKPEILPLFQEAEDKN	1168	sp|Q8NCM8|DYHC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=11313	25.538725179999997	3	1926.023576	1926.021077	E	R	979	995
PSM	KKIEDLIKYLDPEYID	1169	sp|O75935|DCTN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=12618	29.827888751733333	3	1994.062658	1994.061210	Y	R	59	75
PSM	RKVGNPFELDTQQGPQVDKEQFE	1170	sp|P30837|AL1B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10471	24.161009733866667	4	2688.314419	2688.314359	Q	R	346	369
PSM	KKFFDANYDGKDYDPVAA	1171	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9907	23.416370802133333	3	2062.966231	2062.963622	F	R	112	130
PSM	RKGLPLGSAVSSPVLFSPVGR	1172	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=11448	25.810142304800003	3	2123.222649	2123.221508	S	R	34	55
PSM	RKLEEVLSTEGAEENGNSDK	1173	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7815	20.918347178933335	3	2205.039741	2204.055684	K	K	520	540
PSM	RKQPPVSPGTALVGSQKEPSEVPTP	1174	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9050	22.4198416208	3	2585.384416	2585.381316	P	K	30	55
PSM	KKQFSQYIKNSVTPDMMEEMY	1175	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	16-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=9833	23.33574404453333	4	2628.194673	2628.190998	Y	K	220	241
PSM	KKGGPSPGDVEAIKNAIANASTLAEVE	1176	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=12444	29.049716818933334	4	2665.394448	2665.392275	K	R	192	219
PSM	KAAEVLNKHSLSG	1177	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5424	17.672	2	1352.7412	1352.7412	K	R	127	140
PSM	KACQSIYPLHDVFVR	1178	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4	ms_run[2]:scan=10695	24.506	4	1831.9403	1831.9403	E	K	199	214
PSM	KAGKFPSLLTHNENMVA	1179	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9926	23.435	3	1855.9615	1855.9615	N	K	130	147
PSM	KALEEETKNHEAQIQDM	1180	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:35	ms_run[2]:scan=5501	17.776	3	2028.9422	2028.9422	K	R	1181	1198
PSM	KALLSHDSGSDHLAFV	1181	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9990	23.512	3	1695.858	1695.8580	V	R	886	902
PSM	KALNHEIEELEK	1182	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8142	21.298	3	1451.762	1451.7620	I	R	275	287
PSM	KAPIRPDIVNFVHTNL	1183	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11640	26.212	3	1833.0261	1833.0261	F	R	29	45
PSM	KAVHISNPKTAEFQVA	1184	sp|Q9NSD9|SYFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8013	21.152	3	1738.9366	1738.9366	T	R	435	451
PSM	KAVTHQVKFGQQNP	1185	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5231	17.407	3	1580.8423	1580.8423	I	R	44	58
PSM	KCRAPEVSQHVYQAYETIL	1186	sp|Q10567-4|AP1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=11317	25.545	3	2291.1369	2291.1369	L	K	899	918
PSM	KDDDHNGHIDFITAASNL	1187	sp|A0AVT1|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11623	26.173	4	1981.913	1981.9130	E	R	851	869
PSM	KDLLHPSPEEEK	1188	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5682	18.042	3	1420.7198	1420.7198	A	R	5	17
PSM	KDVVHLDSEKDF	1189	sp|Q14554|PDIA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8233	21.407	3	1430.7042	1430.7042	A	R	151	163
PSM	KEDAEAPGIRDHESL	1190	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6851	19.62	3	1665.7958	1665.7958	T	-	219	234
PSM	KEEHIYPTIIGTERDE	1191	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9177	22.573	3	1928.948	1928.9480	F	R	341	357
PSM	KEFLHAQEEVK	1192	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5882	18.297	3	1356.7038	1356.7038	K	R	70	81
PSM	KGHVSSHDEQQVEAGAVQL	1193	sp|Q92667-2|AKAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7894	21.007	3	2017.9817	2017.9817	K	R	30	49
PSM	KGIVKDIIHDPG	1194	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7775	20.848	2	1290.7296	1290.7296	I	R	42	54
PSM	KGKISIVEALTLLNNH	1195	sp|Q9P032|NDUF4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12344	28.557	3	1749.0149	1749.0149	P	K	111	127
PSM	KHAVTEAEIQQLK	1196	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7178	20.106	3	1493.8202	1493.8202	I	R	677	690
PSM	KHFVGMLPEKDC	1197	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6183	18.691	2	1475.6901	1475.6901	F	R	52	64
PSM	KHIEVANGPASHFET	1198	sp|Q92558|WASF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7506	20.519	3	1635.8005	1635.8005	H	R	223	238
PSM	KHNGPNDASDGTVRL	1199	sp|P31942-2|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6004	18.456	3	1579.7703	1579.7703	M	R	6	21
PSM	KHQLQVQMENTLKEQ	1200	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35	ms_run[2]:scan=5562	17.854	3	1868.9414	1868.9414	L	K	898	913
PSM	KHQQALEVVNNNEEKA	1201	sp|Q0VDG4-2|SCRN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5712	18.074	3	1849.9282	1849.9282	Q	K	345	361
PSM	KIEQSQHLFQAH	1202	sp|P53367|ARFP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6793	19.52	2	1464.7474	1464.7474	P	K	289	301
PSM	KIHNAENIQPGEQKYEY	1203	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7301	20.275	3	2059.9963	2059.9963	D	K	540	557
PSM	KILFYHPNEVEKNE	1204	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8518	21.744	3	1758.8941	1758.8941	N	K	44	58
PSM	KIPGEKSVHEGAL	1205	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6254	18.787	3	1363.746	1363.7460	Q	K	822	835
PSM	KKADVIPVHYYLIPPPT	1206	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11193	25.319	3	1950.0979	1950.0979	G	K	982	999
PSM	KKFEEFQTDMAAHEE	1207	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:35	ms_run[2]:scan=6739	19.452	3	1854.8094	1854.8094	Q	R	189	204
PSM	KKIIPTLEEYQHY	1208	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9694	23.166	3	1660.8825	1660.8825	L	K	102	115
PSM	KKLDAGNQLALIEELH	1209	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11431	25.777	3	1790.989	1790.9890	T	K	2221	2237
PSM	KKLQIVQQEQQLHASN	1210	sp|Q8IZD4-2|DCP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7142	20.058	3	1891.0276	1891.0276	L	R	352	368
PSM	KKLTLLPAVVMHL	1211	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=11449	25.812	3	1477.9054	1477.9054	L	K	261	274
PSM	KKVDLVVHPSMDQNDPLV	1212	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=9295	22.717	3	2049.0565	2049.0565	K	R	686	704
PSM	KLDLIHESILH	1213	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10521	24.229	3	1316.7452	1316.7452	G	K	219	230
PSM	KLLQHGINADDK	1214	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5270	17.459	2	1350.7256	1350.7256	C	R	865	877
PSM	KLTEVHEELQK	1215	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5501	17.776	2	1352.73	1352.7300	E	K	514	525
PSM	KLVSDSLSEHEKN	1216	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5418	17.666	3	1484.7471	1484.7471	L	K	756	769
PSM	KMLLHSEQHPGQL	1217	sp|P32322-2|P5CR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=6178	18.685	3	1532.7769	1532.7769	A	K	215	228
PSM	KNPPKNVQQHE	1218	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3329	14.473	3	1317.6789	1317.6789	F	K	55	66
PSM	KPAEFTVDAKHGG	1219	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5406	17.65	3	1355.6834	1355.6834	N	K	691	704
PSM	KPFHGDIQCGGHAPGSS	1220	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4	ms_run[2]:scan=5259	17.445	3	1750.7846	1750.7846	Y	K	343	360
PSM	KQKVEQNAAPSHT	1221	sp|P82912-2|RT11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3363	14.524	3	1436.7372	1436.7372	A	K	45	58
PSM	KSGNLTEDDKHNNA	1222	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3436	14.63	3	1541.707	1541.7070	V	K	528	542
PSM	KSGYHQSASEHGLVVIAPDTSP	1223	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8984	22.343	3	2279.1182	2279.1182	S	R	64	86
PSM	KSHLLDCCPHDILAGT	1224	sp|Q9NQ29-2|LUC7L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=9935	23.442	3	1835.8658	1835.8658	C	R	37	53
PSM	KSLFTTHSSAK	1225	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4970	17.062	2	1205.6404	1205.6404	Y	R	279	290
PSM	KSSVHQPGSHYCQGCAY	1226	sp|Q9P021|CRIPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5193	17.361	3	1964.8258	1964.8258	C	K	62	79
PSM	KSVELEDVKFHQCV	1227	sp|Q9Y6Q5|AP1M2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=9110	22.491	3	1716.8505	1716.8505	N	R	229	243
PSM	KTFHFNTVEEVHS	1228	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8461	21.672	3	1573.7525	1573.7525	S	R	56	69
PSM	KTFQTLECQHK	1229	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:4	ms_run[2]:scan=5255	17.439	2	1418.6976	1418.6976	E	R	1711	1722
PSM	KTHDHQLESSLSPVEVFA	1230	sp|Q9H410-4|DSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11145	25.235	3	2023.0011	2023.0011	S	K	3	21
PSM	KTKNIPEAHQDAF	1231	sp|Q96TA2-3|YMEL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5915	18.343	3	1497.7576	1497.7576	M	K	166	179
PSM	KTKPADMVIEAYGHGQ	1232	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8870	22.183	3	1743.8614	1743.8614	S	R	47	63
PSM	KTSMESLIHHF	1233	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10243	23.853	3	1328.6547	1328.6547	M	K	372	383
PSM	KVDEKISHATEELETY	1234	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9399	22.84	3	1890.9211	1890.9211	S	R	378	394
PSM	KVHITLSTHECAGLSE	1235	sp|P61457|PHS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=8519	21.744	3	1780.8778	1780.8778	N	R	72	88
PSM	KVHLVGIDIFTGK	1236	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11453	25.821	3	1425.8344	1425.8344	A	K	55	68
PSM	KVKISPQLLLAAH	1237	sp|Q6P4Q7-2|CNNM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10373	24.029	3	1416.8817	1416.8817	L	R	30	43
PSM	KVPHDPVALEEHF	1238	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9548	23.015	2	1516.7674	1516.7674	L	R	44	57
PSM	KWHLEQQQAIQTTEAEKQELENQ	1239	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10027	23.554	4	2808.3678	2808.3678	E	R	466	489
PSM	RAKSSTATHPPGPAVQLN	1240	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6080	18.56	3	1830.97	1830.9700	R	K	640	658
PSM	RASVLFDTMQHHLALN	1241	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=9911	23.419	3	1867.9363	1867.9363	F	R	1833	1849
PSM	RDEHQDFMDEQK	1242	sp|Q9Y291|RT33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35	ms_run[2]:scan=3951	15.346	3	1592.6525	1592.6525	Y	R	72	84
PSM	RDLIHGAPVGKPAAN	1243	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6386	18.962	3	1514.8318	1514.8318	L	R	62	77
PSM	REASIDILHSIVK	1244	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11101	25.16	3	1479.8409	1479.8409	D	R	20	33
PSM	RELEAENYHDIK	1245	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6310	18.859	3	1515.7318	1515.7318	A	R	473	485
PSM	RETAQAIKGMHI	1246	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:35	ms_run[2]:scan=5218	17.391	3	1369.7136	1369.7136	T	R	30	42
PSM	RFDSLTDLVEHYK	1247	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11949	27.006	3	1621.81	1621.8100	E	K	186	199
PSM	RFEFNQSLGQPEKIHN	1248	sp|Q96RU2-2|UBP28_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9471	22.925	3	1942.965	1942.9650	S	K	369	385
PSM	RGGIQELIGLIKHT	1249	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12301	28.355	3	1533.8991	1533.8991	D	K	730	744
PSM	RHADNCAGPDGVEGENGGETK	1250	sp|P49711|CTCF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=4093	15.636	3	2168.9141	2168.9141	A	K	572	593
PSM	RHGLLVPNNTTDQELQHI	1251	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9949	23.461	3	2084.0763	2084.0763	N	R	67	85
PSM	RHPWDDISYVLPEHMSM	1252	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:35	ms_run[2]:scan=12191	27.867	3	2127.9506	2127.9506	Y	-	814	831
PSM	RIHFPLATYAPVISAE	1253	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12259	28.167	3	1783.9621	1783.9621	P	K	229	245
PSM	RITSLQEEVKHL	1254	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9574	23.044	3	1451.8096	1451.8096	A	K	630	642
PSM	RLPKDFVDLSTGEDAH	1255	sp|O75794|CD123_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10221	23.826	3	1798.885	1798.8850	Y	K	305	321
PSM	RLPNVTGSHMHLPFAGDIYSED	1256	sp|Q96P16-3|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:35	ms_run[2]:scan=11143	25.231	3	2471.154	2471.1540	S	-	255	277
PSM	RLTQTSGQSTHTH	1257	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3382	14.548	3	1452.707	1452.7070	E	K	2261	2274
PSM	RLYYVCTAPHCGH	1258	sp|P36954|RPB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=7233	20.18	3	1632.729	1632.7290	M	R	109	122
PSM	RMEELHNQEVQK	1259	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4553	16.458	3	1539.7464	1539.7464	R	R	325	337
PSM	RMESTEKCEAVIGHFNG	1260	sp|P29558-2|RBMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7849	20.958	3	1979.8829	1979.8829	A	K	187	204
PSM	RMSIFGHSMGGHGALICAL	1261	sp|P10768|ESTD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35,9-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=10730	24.564	3	2045.9598	2045.9598	Q	K	142	161
PSM	RNLNHSLPSDFTFQNMNSK	1262	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:35	ms_run[2]:scan=9491	22.946	3	2265.0597	2265.0597	Y	R	247	266
PSM	RNRNELAETLALL	1263	sp|Q96T23-2|RSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12397	28.811	2	1511.842	1511.8420	V	K	162	175
PSM	RPMIHELLTEGR	1264	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=8359	21.552	3	1466.7664	1466.7664	A	R	695	707
PSM	RPVILTYHDIGMNH	1265	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=9001	22.362	3	1680.8406	1680.8406	N	K	56	70
PSM	RQGTTPPIWHLTDK	1266	sp|P55265-3|DSRAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9504	22.961	3	1648.8685	1648.8685	Y	K	345	359
PSM	RQSQESGLLHTH	1267	sp|P05549-2|AP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5222	17.396	3	1391.6906	1391.6906	Q	R	100	112
PSM	RRFDDAVVQSDM	1268	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=6992	19.833	2	1453.662	1453.6620	G	K	76	88
PSM	RRIQLVEEELD	1269	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9594	23.064	2	1398.7467	1398.7467	N	R	54	65
PSM	RSLLSQMLHYDPNK	1270	sp|P24941-2|CDK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=8784	22.071	3	1716.8617	1716.8617	G	R	226	240
PSM	RSQLGAHHTTPVGDGAAGT	1271	sp|Q5BJD5-3|TM41B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4723	16.689	3	1831.8925	1831.8925	E	R	9	28
PSM	RTYPCPPHFNHLGSDVA	1272	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4	ms_run[2]:scan=9159	22.55	3	1966.9108	1966.9108	G	R	805	822
PSM	RVAIHYINPPNPAKDNFTF	1273	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11330	25.564	3	2213.1382	2213.1382	G	K	239	258
PSM	RVLEAVSANPGRFHTSE	1274	sp|Q9NXH9-2|TRM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8007	21.144	3	1868.9493	1868.9493	G	R	381	398
PSM	RVTILCDKFSGHP	1275	sp|A6NDY0-2|EPAB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=9044	22.414	3	1528.782	1528.7820	H	K	175	188
PSM	KSGNLTEDDKHNNA	1276	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3422	14.608247097066668	3	1541.707257	1541.707013	V	K	573	587
PSM	RVDPPMGEEGNHK	1277	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	6-UNIMOD:35	ms_run[1]:scan=3561	14.766708539466666	3	1480.673145	1480.672876	F	R	1025	1038
PSM	KHLNEIDLFHCID	1278	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	11-UNIMOD:4	ms_run[1]:scan=11260	25.4518465688	3	1652.7975	1652.7976	F	P	48	61
PSM	RKPTDGASSSNCVTDISHLV	1279	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:4	ms_run[1]:scan=10477	24.168530037333333	3	2144.023089	2143.032781	S	R	697	717
PSM	RVPPVPDYVAHPERWT	1280	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10520	24.2279505768	3	1918.980255	1917.984966	P	K	148	164
PSM	RASVLFDTMQHHLALN	1281	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=11384	25.6758076936	3	1851.941935	1851.941387	F	R	1833	1849
PSM	KSVTVTQKVEEHEETFEE	1282	sp|P07197|NFM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8107	21.259299228	3	2149.039873	2148.022259	T	K	875	893
PSM	KQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPSQPQQ	1283	sp|O75909|CCNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	4-UNIMOD:35	ms_run[1]:scan=8412	21.617265522399997	5	4873.355500	4873.359042	G	K	262	305
PSM	KVEQHVVDGKE	1284	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3624	14.849212269066667	3	1266.656323	1266.656815	A	R	357	368
PSM	KHSGLLQSAQEELTK	1285	sp|Q9NS87|KIF15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9434	22.8818613856	3	1667.899259	1667.884249	K	K	1081	1096
PSM	RDLKPENVLLDAHMNA	1286	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:35	ms_run[1]:scan=9411	22.854297068266664	3	1851.935615	1850.930882	H	K	149	165
PSM	KEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGG	1287	sp|P78536|ADA17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	27-UNIMOD:4	ms_run[1]:scan=9777	23.270631963466666	4	3730.630215	3729.623761	T	K	397	432
PSM	KKETEGDVTSVKDA	1288	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4173	15.819928628000001	3	1505.755763	1505.757317	F	K	224	238
PSM	RKGDEVDGVDEVAK	1289	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5331	17.5400173784	3	1515.753048	1515.752900	K	K	208	222
PSM	RKGDEVDGVDEVAK	1290	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4795	16.794770141066667	3	1515.753172	1515.752900	K	K	208	222
PSM	RKTVTAMDVVYALK	1291	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:35	ms_run[1]:scan=9715	23.189061407466667	2	1609.885360	1609.886164	K	R	79	93
PSM	RKEALESVEVLIKNP	1292	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10967	24.9324625728	3	1723.984006	1723.983235	E	K	296	311
PSM	KKLSDDNTIGKEEIQQ	1293	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6095	18.574116793066665	3	1844.947783	1844.947972	G	R	1828	1844
PSM	KKDEPKSGEEALIIPPDAVAVDC	1294	sp|Q9Y287|ITM2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	23-UNIMOD:4	ms_run[1]:scan=10791	24.6599309888	4	2480.247482	2480.246856	A	K	16	39
PSM	KKQGGLGPMNIPLVSDPK	1295	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:35	ms_run[1]:scan=9059	22.429724836800002	3	1894.035837	1894.034619	P	R	92	110
PSM	RKNEGVIEFVSYSDMK	1296	sp|Q08170|SRSF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	15-UNIMOD:35	ms_run[1]:scan=9854	23.3623749024	3	1916.937603	1916.930213	G	R	139	155
PSM	KKALEQLNGFELAGRPM	1297	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	17-UNIMOD:35	ms_run[1]:scan=10016	23.539659288	4	1917.004486	1917.014218	A	K	305	322
PSM	KKEGKPTIVEEDDPELF	1298	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10030	23.555934178399998	3	1973.001306	1972.999338	L	K	142	159
PSM	KKLVWVPSDKSGFEPASL	1299	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=11030	25.035763865333333	3	1987.077116	1987.077863	A	K	29	47
PSM	KKGEDEDKGPPCGPVNCNE	1300	sp|Q06323|PSME1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=4709	16.6660814224	3	2128.916160	2128.915368	K	K	90	109
PSM	KKIEYYLEEEQGPADHPS	1301	sp|Q9BYV8|CEP41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8727	21.994829916266667	3	2132.010771	2132.006215	L	R	308	326
PSM	KKLTELGTVDPKN	1302	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6279	18.8223547824	2	1441.814376	1441.814044	L	K	1464	1477
PSM	RKNVPQFAEPTETLFGPDSGKGA	1303	sp|Q9H3C7|GGNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10700	24.511886107733336	3	2445.230879	2445.228838	H	K	601	624
PSM	KKQKVEGTEPTTAFNLFVGNLNFN	1304	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=12513	29.377095856	4	2695.397244	2695.396966	A	K	294	318
PSM	RKLSPTEPKNYGSYSTQASAAAATAELL	1305	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=11105	25.167038082399998	4	2924.488704	2924.487966	S	K	73	101
PSM	KAAHEALGQFCCALH	1306	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8947	22.292	3	1711.7923	1711.7923	R	K	715	730
PSM	KAAVHLEGKIEQAQ	1307	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5892	18.31	3	1520.8311	1520.8311	A	R	488	502
PSM	KADIPKFCHGILT	1308	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:4	ms_run[2]:scan=9647	23.119	3	1498.7966	1498.7966	C	K	943	956
PSM	KAIKELGDHVTNL	1309	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8032	21.172	3	1436.7987	1436.7987	V	R	144	157
PSM	KAKAEASSGDHPTDTEM	1310	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3978	15.398	3	1773.7839	1773.7839	N	K	424	441
PSM	KAKLPLGLLLHPF	1311	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12368	28.669	3	1445.9122	1445.9122	N	R	541	554
PSM	KCGGAGHIASDCKFQ	1312	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5168	17.334	3	1634.7293	1634.7293	T	R	281	296
PSM	KCHFDYNPYNDNLIPCKEAGL	1313	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=11148	25.24	4	2567.1573	2567.1573	V	K	221	242
PSM	KCMIDQAHQEERPI	1314	sp|Q9UBQ5-2|EIF3K_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4	ms_run[2]:scan=6909	19.701	3	1753.824	1753.8240	C	R	86	100
PSM	KDPDDHTVCHLLFANQTEKDILL	1315	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4	ms_run[2]:scan=12111	27.568	4	2721.3432	2721.3432	M	R	173	196
PSM	KEHSSDQPAAASVWK	1316	sp|Q7L5Y9-5|MAEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6479	19.078	3	1639.7954	1639.7954	L	R	107	122
PSM	KEKVAGIESHSELQIS	1317	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7827	20.935	3	1753.921	1753.9210	A	R	853	869
PSM	KELHEQLVALDKQN	1318	sp|P23786|CPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7868	20.977	3	1663.8893	1663.8893	G	K	93	107
PSM	KEMIEKDQDHLD	1319	sp|Q9NUG6|PDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=4342	16.176	3	1515.6875	1515.6875	T	K	74	86
PSM	KENHTESTVNSLPH	1320	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5392	17.626	3	1591.759	1591.7590	D	-	326	340
PSM	KFIEEHATKLS	1321	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6140	18.635	2	1301.698	1301.6980	S	R	629	640
PSM	KGHQFSCVCLHGD	1322	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7003	19.848	3	1543.666	1543.6660	K	R	408	421
PSM	KGHYTEGAELVDSVLDVVR	1323	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12613	29.805	3	2086.0695	2086.0695	A	K	103	122
PSM	KGPGPTVKPSGHLFF	1324	sp|Q5VW32-2|BROX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10090	23.651	3	1567.8511	1567.8511	T	R	263	278
PSM	KGSGNLEAIHIIK	1325	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8676	21.928	2	1378.7932	1378.7932	L	K	144	157
PSM	KGVVHDDMECSHYM	1326	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=5653	17.998	3	1722.68	1722.6800	G	K	348	362
PSM	KHLEINPDHPIVETL	1327	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10089	23.649	3	1753.9363	1753.9363	K	R	624	639
PSM	KHSQFIGYPITLFVEK	1328	sp|Q58FG0|HS905_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12175	27.807	3	1906.0353	1906.0353	K	K	39	55
PSM	KHSTIVPENAAHQGAN	1329	sp|Q9UPY3-2|DICER_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4582	16.497	3	1672.8281	1672.8281	C	R	1123	1139
PSM	KHTPVDHPDYPLLQDAL	1330	sp|Q12979-4|ABR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11470	25.858	3	1957.9898	1957.9898	L	R	209	226
PSM	KIAGYVTHLMK	1331	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8716	21.983	3	1259.706	1259.7060	N	R	49	60
PSM	KIEFEHGTTSGK	1332	sp|Q9NVQ4|FAIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5104	17.244	2	1332.6674	1332.6674	H	R	18	30
PSM	KIIKDGEQHEDLNEVA	1333	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6753	19.473	3	1836.9218	1836.9218	R	K	238	254
PSM	KIITVEKHPDADSLYVE	1334	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9078	22.453	3	1956.0204	1956.0204	G	K	374	391
PSM	KKADVDAIHEYLLL	1335	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11875	26.783	3	1626.8981	1626.8981	E	K	441	455
PSM	KKDEIENSIVH	1336	sp|Q9NYH9|UTP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6108	18.592	2	1310.683	1310.6830	F	R	80	91
PSM	KKISSNPNPVVQMSVGH	1337	sp|A0FGR8-4|ESYT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=5495	17.765	3	1836.9516	1836.9516	G	K	348	365
PSM	KKLETLSLNNNHL	1338	sp|Q8N9N7|LRC57_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8685	21.943	3	1522.8467	1522.8467	L	R	85	98
PSM	KLGAQLADLHLDNK	1339	sp|Q9HA64|KT3K_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9783	23.28	4	1534.8467	1534.8467	A	K	102	116
PSM	KLIHLEIKPAI	1340	sp|Q02750-2|MP2K1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10302	23.928	3	1273.8122	1273.8122	R	R	97	108
PSM	KLKEADEMHTLLQLECE	1341	sp|Q86UP2-3|KTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=10095	23.656	3	2102.0024	2102.0024	H	K	1098	1115
PSM	KLLDIACWIHH	1342	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4	ms_run[2]:scan=12126	27.619	3	1404.7336	1404.7336	C	K	111	122
PSM	KLVEESVKHSD	1343	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3969	15.377	2	1269.6565	1269.6565	T	K	792	803
PSM	KMETKTESSGIETEPTVHHLPLSTE	1344	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:35	ms_run[2]:scan=8367	21.565	4	2796.3488	2796.3488	E	K	603	628
PSM	KNMMAACDPRHG	1345	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=3323	14.462	3	1418.5853	1418.5853	A	R	297	309
PSM	KNVALLSQLYHSPAR	1346	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10043	23.576	4	1695.942	1695.9420	N	R	191	206
PSM	KPRNEEENIYSVPHDSTQG	1347	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7067	19.944	3	2199.0192	2199.0192	V	K	1096	1115
PSM	KQKQLQATSVPHPVS	1348	sp|O14965|AURKA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5885	18.3	3	1646.9104	1646.9104	Q	R	75	90
PSM	KQQGPILTKHG	1349	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4048	15.554	2	1205.6881	1205.6881	V	K	519	530
PSM	KQVHPDTGISS	1350	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4187	15.84	2	1167.5884	1167.5884	L	K	47	58
PSM	KRVIISAPSADAPMFVMGVNHE	1351	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=9776	23.269	3	2400.193	2400.1930	A	K	75	97
PSM	KSASSKTEVHI	1352	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4793	16.793	2	1185.6354	1185.6354	L	R	193	204
PSM	KSGQKPVLDVHAELD	1353	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8377	21.576	3	1634.8628	1634.8628	K	R	486	501
PSM	KSGVKIHVSDQELQSANASVDDS	1354	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8325	21.511	4	2413.1721	2413.1721	P	R	762	785
PSM	KSKEESSGTPAHQMNL	1355	sp|Q96AC1-2|FERM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5819	18.205	3	1742.8257	1742.8257	Y	R	408	424
PSM	KSPPHCELMAGHL	1356	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6454	19.048	3	1491.6963	1491.6963	A	R	185	198
PSM	KSPPHCELMAGHL	1357	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4	ms_run[2]:scan=8121	21.276	3	1475.7013	1475.7013	A	R	185	198
PSM	KSVEMHHEALSEALPGDNVGFNV	1358	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35	ms_run[2]:scan=10909	24.829	4	2495.1751	2495.1751	V	K	290	313
PSM	KTEWLDGKHVVFG	1359	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9961	23.478	3	1514.7882	1514.7882	A	K	118	131
PSM	KTGKPLPFGTLGVH	1360	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9556	23.024	3	1450.8296	1450.8296	N	K	480	494
PSM	KTKEGVVHGVATVAE	1361	sp|P37840-2|SYUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5733	18.1	2	1523.8308	1523.8308	S	K	43	58
PSM	KTLHPDLGTDKD	1362	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5032	17.148	3	1338.6779	1338.6779	L	K	212	224
PSM	KTNLSVHEDKN	1363	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3650	14.875	3	1283.647	1283.6470	S	R	150	161
PSM	KVEQHVVDGKE	1364	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3636	14.862	3	1266.6568	1266.6568	A	R	357	368
PSM	KVHVGDEDFVHL	1365	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9969	23.487	3	1393.699	1393.6990	I	R	56	68
PSM	KVKEDPDGEHA	1366	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3392	14.56	3	1223.5782	1223.5782	L	R	143	154
PSM	KVLGQPHHELDS	1367	sp|Q96DH6-2|MSI2H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4688	16.635	2	1358.6943	1358.6943	D	K	73	85
PSM	KVLHEAEGHIVTCETNTGEVY	1368	sp|P62318-2|SMD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:4	ms_run[2]:scan=8294	21.472	3	2385.1271	2385.1271	I	R	8	29
PSM	KVLQQVKAESEH	1369	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4705	16.661	3	1394.7518	1394.7518	V	K	1241	1253
PSM	KVPRPDALDNESWGFVHP	1370	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11493	25.913	3	2063.0225	2063.0225	I	R	115	133
PSM	KVVEEEKQEHVE	1371	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3716	14.947	3	1481.7362	1481.7362	E	K	1418	1430
PSM	KYCCEHLLDHITNNQDF	1372	sp|P35813|PPM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=10766	24.617	3	2205.9572	2205.9572	A	K	69	86
PSM	KYEEGINIHLAK	1373	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8353	21.548	3	1413.7616	1413.7616	N	K	192	204
PSM	KYKPAVNQIECHPYLTQE	1374	sp|P15121|ALDR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=8709	21.975	3	2217.0888	2217.0888	L	K	177	195
PSM	RAAEPVTFHVPWK	1375	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10591	24.333	3	1536.8201	1536.8201	R	R	5	18
PSM	RAKAQELIQATNQILSH	1376	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10888	24.802	3	1920.0541	1920.0541	S	R	1121	1138
PSM	RAQSDIEHLFQHN	1377	sp|Q8TCG1-2|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9891	23.399	3	1593.7648	1593.7648	E	R	543	556
PSM	RDFTVSAMHGDMDQKE	1378	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=7037	19.903	3	1881.7985	1881.7985	A	R	295	311
PSM	RDGFIDKEDLHDMLASLG	1379	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=11355	25.612	3	2046.9681	2046.9681	N	K	44	62
PSM	RDIKSDSILLTHDG	1380	sp|O96013-2|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8428	21.635	3	1568.8158	1568.8158	H	R	274	288
PSM	RDLQSNVEHLTEKM	1381	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=7902	21.02	3	1714.8308	1714.8308	I	K	605	619
PSM	REDSVKPGAHLTV	1382	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6671	19.348	3	1407.747	1407.7470	S	K	113	126
PSM	REESGKPGAHVTV	1383	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4449	16.315	3	1365.7001	1365.7001	A	K	87	100
PSM	REREQCCYNCG	1384	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=3805	15.062	2	1530.5762	1530.5762	K	K	75	86
PSM	RETNLDSLPLVDTHSK	1385	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9535	22.995	4	1823.9377	1823.9377	L	R	424	440
PSM	RFEPVHFVASSSKDE	1386	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8773	22.054	3	1733.8373	1733.8373	P	R	56	71
PSM	RFVLQDGAHHMVDSNEISFI	1387	sp|Q96RP9|EFGM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=11542	26	4	2330.1114	2330.1114	L	R	608	628
PSM	RGHGDSVDQLCWHPSNPDLFVTASGD	1388	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=11764	26.5	4	2866.2729	2866.2729	Y	K	96	122
PSM	RGLAVNMVDSKHSMNILN	1389	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=9322	22.746	3	2014.0088	2014.0088	K	R	327	345
PSM	RHVVSCSSQDSTHCAENLL	1390	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=8029	21.169	4	2198.9797	2198.9797	L	K	7	26
PSM	RIADPEHDHTGFLTEYVAT	1391	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10908	24.828	3	2171.0283	2171.0283	A	R	189	208
PSM	RIGYPKPALLHSTFFPALQGAQT	1392	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12095	27.499	4	2512.3591	2512.3591	P	K	285	308
PSM	RKLTATPTPLGGMTGFHMQTED	1393	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=8216	21.387	4	2420.1464	2420.1464	A	R	429	451
PSM	RKPQLELAMVPHYGGIN	1394	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:35	ms_run[2]:scan=9994	23.517	3	1938.0146	1938.0146	E	R	137	154
PSM	RKYWDVPPPGFEHITPMQY	1395	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:35	ms_run[2]:scan=11932	26.949	3	2376.1361	2376.1361	V	K	89	108
PSM	RLLASTLVHSVK	1396	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8848	22.156	3	1322.8034	1322.8034	D	K	567	579
PSM	RLLGVFEQNQDPKH	1397	sp|Q8NFP7|NUD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9279	22.7	3	1679.8744	1679.8744	G	R	78	92
PSM	RLPEEHIPFFLHNN	1398	sp|Q5NDL2-2|EOGT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11480	25.881	3	1761.8951	1761.8951	I	R	41	55
PSM	RLPEYTLSQEGGPAHK	1399	sp|O75569-3|PRKRA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7882	20.993	3	1781.906	1781.9060	W	R	116	132
PSM	RLQLLTGEHRPEDEEELE	1400	sp|Q13505-3|MTX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9523	22.981	3	2192.0709	2192.0709	E	K	150	168
PSM	RLQPHPQLSPEIR	1401	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7495	20.505	3	1569.874	1569.8740	L	R	406	419
PSM	RLVSNHSLHETSSVFVDSLT	1402	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10640	24.42	3	2227.1233	2227.1233	P	K	2512	2532
PSM	RMLFDYLADKHGF	1403	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:35	ms_run[2]:scan=11538	25.991	3	1627.7817	1627.7817	G	R	111	124
PSM	RNVTHIDQALQEAH	1404	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7337	20.315	3	1630.8176	1630.8176	I	R	220	234
PSM	RNVVAVGTGGRGTHD	1405	sp|Q969S3|ZN622_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4399	16.246	3	1494.7651	1494.7651	A	R	156	171
PSM	RPKILMDSPEDADLFHSEEI	1406	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35	ms_run[2]:scan=11194	25.321	3	2357.1209	2357.1209	D	K	33	53
PSM	RQATINIGTIGHVAHG	1407	sp|Q2VIR3-2|IF2GL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9147	22.535	4	1643.8856	1643.8856	S	K	38	54
PSM	RSAGIKVIMVTGDHPITA	1408	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:35	ms_run[2]:scan=9117	22.499	3	1881.0142	1881.0142	C	K	607	625
PSM	RSFSQPEAGGSHH	1409	sp|Q8WVV9-3|HNRLL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3923	15.305	3	1395.628	1395.6280	G	K	53	66
PSM	RSHTSEGAHLDITPNSGAAGNSAGP	1410	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7313	20.287	3	2403.1163	2403.1163	S	K	363	388
PSM	RSKCEELSGLHGQLQEA	1411	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4	ms_run[2]:scan=7986	21.121	3	1940.9374	1940.9374	V	R	497	514
PSM	RSSQDHVDEEVFK	1412	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6616	19.265	3	1574.7325	1574.7325	E	R	414	427
PSM	RSVLLQHQLTHGNE	1413	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6997	19.84	3	1630.854	1630.8540	D	K	674	688
PSM	RTDDCHPWVLPVVK	1414	sp|P17174|AATC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4	ms_run[2]:scan=10774	24.629	3	1720.8719	1720.8719	Y	K	42	56
PSM	RTHVNPMDEEENEVNHVNGEQEN	1415	sp|Q8TAF3-4|WDR48_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=5964	18.404	4	2735.1478	2735.1478	P	R	394	417
PSM	RTPLEQEIFNLLHKN	1416	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12652	29.972	3	1851.0003	1851.0003	A	K	13	28
PSM	RTTEEALHASHGFMWYT	1417	sp|Q9P0J0|NDUAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=10259	23.871	3	2051.916	2051.9160	L	-	128	145
PSM	RVAFDPEQKPLHGVL	1418	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10031	23.557	3	1704.9311	1704.9311	S	K	694	709
PSM	RVGEEEHVYSFPNKQ	1419	sp|P49023-2|PAXI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7567	20.597	3	1817.8697	1817.8697	S	K	110	125
PSM	RVNEVDVRDVTHS	1420	sp|Q12959-8|DLG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6737	19.451	3	1524.7645	1524.7645	L	K	162	175
PSM	RVVDLMAHMASKE	1421	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6792	19.519	3	1517.733	1517.7330	N	-	281	294
PSM	RVVQVVKPHTPLI	1422	sp|P82909|RT36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8890	22.207	3	1484.9191	1484.9191	S	R	11	24
PSM	RYAEIVHLTLPDGTK	1423	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10448	24.131	3	1711.9257	1711.9257	P	R	67	82
PSM	KHIYYITGETKDQVANSAFVE	1424	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=12626	29.863884317333333	4	2412.194379	2412.196141	Q	R	489	510
PSM	KGKSLTGVVNAQALTSAFSPHT	1425	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=11490	25.907614530133333	4	2214.182184	2213.180431	V	K	308	330
PSM	KDRPENVHGGILADDMGLG	1426	sp|Q14527|HLTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:35	ms_run[1]:scan=8624	21.8628659968	3	2009.965699	2008.963639	E	K	281	300
PSM	KKLASQGDSISSQLGPIHPPP	1427	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9346	22.777193606133334	3	2156.161671	2156.158967	S	R	121	142
PSM	RYGDGGSTFQSTTGHCVHM	1428	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=6031	18.49681732213333	4	2113.848345	2112.874172	H	R	275	294
PSM	RLVPVHYDETEAERE	1429	sp|Q8NEJ9|NGDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7612	20.650274005333333	3	1843.888606	1841.890791	P	K	175	190
PSM	MRDSTGAGNSLVHK	1430	sp|Q9Y483|MTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:35	ms_run[1]:scan=4069	15.583701014133334	3	1487.714974	1487.715075	-	R	1	15
PSM	KPIHQGPDAAVTGHI	1431	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6823	19.574037558666664	3	1539.815197	1539.815775	E	R	913	928
PSM	KKVETLMVPSK	1432	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:35	ms_run[1]:scan=5615	17.945771129066667	3	1274.726941	1274.726809	D	R	179	190
PSM	KKLEEEEAEVK	1433	sp|Q9H0E9|BRD8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4446	16.3091692384	2	1330.697200	1330.698011	K	R	149	160
PSM	KKLNVTEQEKID	1434	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5366	17.5841421152	3	1443.792162	1443.793309	S	K	80	92
PSM	RKPEEEEEEELEETAQEK	1435	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8302	21.483441367733334	3	2231.007318	2231.007731	P	K	61	79
PSM	KKEAPPMEKPEVV	1436	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:35	ms_run[1]:scan=4838	16.859869730933333	3	1496.790742	1496.790866	A	K	64	77
PSM	KKMQAGEEVTELR	1437	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	3-UNIMOD:35	ms_run[1]:scan=5431	17.681614453599998	3	1533.781644	1533.782092	Y	R	823	836
PSM	RTVDATGKEIELTH	1438	sp|O43395|PRPF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6878	19.65696592373333	3	1568.816597	1568.815835	G	R	263	277
PSM	RKTVTAMDVVYALK	1439	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=11170	25.281149794666664	3	1593.890656	1593.891249	K	R	79	93
PSM	KKEAELDVNEELDK	1440	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7433	20.429000570133333	3	1658.836725	1658.836296	F	K	32	46
PSM	KKSADTLWDIQKDL	1441	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=11509	25.941297807466665	3	1659.883890	1659.883186	L	K	318	332
PSM	KKPMSLASGLVPAAPPK	1442	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	4-UNIMOD:35	ms_run[1]:scan=8368	21.565301456533334	3	1706.975620	1706.975313	N	R	738	755
PSM	KARPEYMLPVHFYG	1443	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:35	ms_run[1]:scan=10608	24.361802198400003	3	1722.854469	1722.855198	E	R	192	206
PSM	KKMVDPEKPQLGMID	1444	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8832	22.13507273786667	3	1727.894105	1727.895013	S	R	141	156
PSM	KKLSEGLEGTKYSNVM	1445	sp|Q5JPH6|SYEM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:35	ms_run[1]:scan=6937	19.737574001600002	3	1798.912810	1798.913501	L	K	470	486
PSM	RKFGEAIGMGFPVKVPY	1446	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35	ms_run[1]:scan=11311	25.53613171546667	3	1911.010631	1911.007676	S	R	878	895
PSM	KKYDDDISPSEDKDTDST	1447	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5138	17.286571069333334	3	2057.892304	2057.891304	L	K	155	173
PSM	KKIGDEYFTFITDCKDP	1448	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	14-UNIMOD:4	ms_run[1]:scan=11587	26.102786367733334	3	2075.984249	2075.987394	I	K	353	370
PSM	KKGEDEDKGPPCGPVNCNE	1449	sp|Q06323|PSME1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=4820	16.837199128800002	3	2128.916160	2128.915368	K	K	90	109
PSM	RKSQVAELNDDDKDDEIVF	1450	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10222	23.828220013333336	4	2235.065527	2235.065521	R	K	245	264
PSM	KVVYPSKADLATAPPHVTVVR	1451	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8875	22.187924262133333	4	2247.274237	2247.273938	L	-	563	584
PSM	KKVGTFFSEVKPAGPTVEQQGEMA	1452	sp|P54886|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	23-UNIMOD:35	ms_run[1]:scan=9501	22.9575817768	4	2580.286283	2580.289390	G	R	347	371
PSM	RKLGVVPVNGSGLSTPAWPPLQQEGPPTGPAEGANSHTTLPQR	1453	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=11373	25.645972462133333	5	4398.283857	4398.283281	K	R	525	568
PSM	KAETAAKHGEAQV	1454	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3510	14.711	3	1338.6892	1338.6892	N	K	100	113
PSM	KAMGIMNSFVNDIFE	1455	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=12443	29.044	2	1746.7957	1746.7957	S	R	58	73
PSM	KATIAGGGVIPHIH	1456	sp|Q71UI9|H2AV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8453	21.662	3	1369.783	1369.7830	I	K	102	116
PSM	KCLLLVHEPKL	1457	sp|Q99661-2|KIF2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=9843	23.346	3	1348.7901	1348.7901	S	K	232	243
PSM	KCPSTHSEELHDCIQ	1458	sp|P48507|GSH0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5554	17.844	3	1839.788	1839.7880	K	K	34	49
PSM	KDNPKIVHAFDMEDLGD	1459	sp|Q9NZ45|CISD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=9222	22.629	3	1958.9044	1958.9044	Q	K	51	68
PSM	KEHEADTANMSDKEL	1460	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5796	18.174	3	1716.7625	1716.7625	N	K	578	593
PSM	KEIGVQNVKGIH	1461	sp|P13984|T2FB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6176	18.682	3	1320.7514	1320.7514	L	K	218	230
PSM	KEKGNIQLSYSDGDDCGHG	1462	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:4	ms_run[2]:scan=6622	19.271	3	2078.8963	2078.8963	M	K	557	576
PSM	KEKGPQNATDSYVH	1463	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4564	16.47	3	1572.7532	1572.7532	L	K	66	80
PSM	KEKPEEAGHEAEE	1464	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3394	14.564	3	1481.6634	1481.6634	I	R	4912	4925
PSM	KELEQNANHPH	1465	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3410	14.585	2	1315.6269	1315.6269	L	R	80	91
PSM	KEPFFHGHDNYDQLV	1466	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10192	23.778	3	1844.8482	1844.8482	R	R	93	108
PSM	KEQIQNQLDHLK	1467	sp|P14373|TRI27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7673	20.728	3	1492.7998	1492.7998	F	R	140	152
PSM	KEWSQHINGASHS	1468	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4879	16.919	3	1479.6855	1479.6855	N	R	304	317
PSM	KFLQVHASSGH	1469	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5583	17.888	2	1209.6255	1209.6255	S	K	239	250
PSM	KGGVHLTKDPNVVGQLA	1470	sp|Q96I99|SUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8703	21.968	3	1731.9632	1731.9632	L	K	101	118
PSM	KGIHQSTIDLKNEL	1471	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9022	22.385	3	1594.8679	1594.8679	I	K	335	349
PSM	KGPKPAFGQQHQQQP	1472	sp|P49750-3|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4615	16.55	3	1674.859	1674.8590	W	K	643	658
PSM	KHAVSEGTKAVT	1473	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3474	14.672	3	1226.6619	1226.6619	A	K	109	121
PSM	KHDSSWVEELLMLH	1474	sp|P22413|ENPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=12639	29.916	3	1738.8349	1738.8349	G	R	872	886
PSM	KHFEDLEFQQLEHES	1475	sp|Q86SQ0-2|PHLB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10325	23.955	3	1914.8748	1914.8748	S	R	677	692
PSM	KHLAEEKPDGLINEAT	1476	sp|Q8IUF1|CBWD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7751	20.819	3	1763.9054	1763.9054	L	R	176	192
PSM	KHNGPNDASDGTVRL	1477	sp|P31942-2|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6030	18.495	2	1579.7703	1579.7703	M	R	6	21
PSM	KHQLLEADISAHED	1478	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7860	20.968	3	1604.7794	1604.7794	K	R	1679	1693
PSM	KIAGYVTHLMK	1479	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=6901	19.692	3	1275.7009	1275.7009	N	R	49	60
PSM	KKSDCSLFMFGSHN	1480	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=9566	23.035	3	1672.7338	1672.7338	S	K	83	97
PSM	KKSWMEGLTLQDYSEHC	1481	sp|O00487|PSDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=10058	23.607	3	2126.9401	2126.9401	H	K	222	239
PSM	KKTATQTGHTLLEDYQIVDNSQ	1482	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10455	24.14	4	2489.2398	2489.2398	V	R	614	636
PSM	KLDKDNLSYIEHIFEIS	1483	sp|Q15121|PEA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12651	29.966	3	2063.0575	2063.0575	N	R	54	71
PSM	KLDKSQIHDIVLVGGST	1484	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10246	23.858	3	1808.9996	1808.9996	A	R	325	342
PSM	KLEHLITELVHQ	1485	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11106	25.168	3	1458.8195	1458.8195	R	R	1807	1819
PSM	KLHDMLGPHML	1486	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7253	20.221	3	1322.6475	1322.6475	K	R	945	956
PSM	KLHGVNINVEASKN	1487	sp|Q9BWF3-2|RBM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7025	19.887	3	1521.8263	1521.8263	Y	K	59	73
PSM	KLLAVKEFESHLD	1488	sp|Q9NRG4-2|SMYD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10678	24.472	3	1527.8297	1527.8297	E	K	127	140
PSM	KLPVDQKCEH	1489	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=3872	15.198	2	1252.6234	1252.6234	L	K	9	19
PSM	KLSVTVDPKYHP	1490	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8093	21.244	3	1382.7558	1382.7558	F	K	1021	1033
PSM	KMEGHYVHAGNIIATQ	1491	sp|Q9P0M9|RM27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=6942	19.744	3	1783.8676	1783.8676	K	R	55	71
PSM	KMKLPEHPEGGEPEDDEAPA	1492	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=5645	17.983	3	2190.9739	2190.9739	K	K	286	306
PSM	KMLQHEPDRAFYGL	1493	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=9513	22.971	3	1719.8403	1719.8403	Y	K	283	297
PSM	KNDPYHPDHFNCANCG	1494	sp|P48059|LIMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=6072	18.548	3	1944.7632	1944.7632	F	K	150	166
PSM	KNFDVGHVPIRLP	1495	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11074	25.11	4	1490.8358	1490.8358	M	R	362	375
PSM	KNTEKENATVAHLVGAL	1496	sp|Q13158|FADD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10673	24.466	4	1793.9636	1793.9636	W	R	149	166
PSM	KPKPCGLCNQFGHEV	1497	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7939	21.059	3	1769.8341	1769.8341	N	K	183	198
PSM	KPVPLDEESHK	1498	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4214	15.929	2	1277.6616	1277.6616	G	R	31	42
PSM	KQAVHCIHAIFTN	1499	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=8159	21.32	3	1537.7824	1537.7824	A	K	737	750
PSM	KQHVTEAFQFHF	1500	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11109	25.173	3	1517.7415	1517.7415	W	-	522	534
PSM	KSEAHTADGISIRFP	1501	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10331	23.963	3	1627.8318	1627.8318	S	R	704	719
PSM	KSLHQVEISHCDA	1502	sp|Q9Y2I1-4|NISCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:4	ms_run[2]:scan=5375	17.596	3	1522.7198	1522.7198	F	K	217	230
PSM	KSLTELFVKENHEL	1503	sp|Q96Q11-2|TRNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10916	24.84	3	1685.8988	1685.8988	L	R	46	60
PSM	KSRPEFMLPVHFYG	1504	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=11498	25.922	3	1722.8552	1722.8552	E	K	158	172
PSM	KTCQQTWEKLHAATS	1505	sp|P21283|VATC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=7494	20.504	3	1787.8625	1787.8625	E	K	13	28
PSM	KTFEINPRHPLI	1506	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10120	23.681	3	1463.8249	1463.8249	K	R	683	695
PSM	KTKETPPTAHLILPEQHMSLAQQ	1507	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	18-UNIMOD:35	ms_run[2]:scan=8733	22.001	4	2613.3585	2613.3585	N	K	1549	1572
PSM	KTLLKNDHIQVG	1508	sp|Q8IXB1-2|DJC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7237	20.187	2	1364.7776	1364.7776	L	R	342	354
PSM	KTSAKEEDAFHFVSYVPVNG	1509	sp|Q9Y5K5-2|UCHL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11338	25.582	3	2224.08	2224.0800	T	R	154	174
PSM	KVAEIEHAEKE	1510	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4075	15.595	3	1281.6565	1281.6565	A	K	216	227
PSM	KVESPAKIHVFYIDYGN	1511	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11113	25.18	3	1979.0153	1979.0153	E	R	752	769
PSM	KVIKNPVSDHFPVGCM	1512	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:4,16-UNIMOD:35	ms_run[2]:scan=8943	22.285	3	1842.9121	1842.9121	L	K	157	173
PSM	KVLGQPHHELDS	1513	sp|Q96DH6-2|MSI2H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4670	16.618	3	1358.6943	1358.6943	D	K	73	85
PSM	KVLPGMHHPIQM	1514	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=4575	16.483	2	1418.7163	1418.7163	M	K	66	78
PSM	KVPDKLLDSSTVTHLF	1515	sp|P60900-2|PSA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11795	26.582	3	1798.9829	1798.9829	K	K	36	52
PSM	KVRAPMVNPTLGVHEADLL	1516	sp|Q13423|NNTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=10637	24.416	3	2075.1197	2075.1197	V	K	127	146
PSM	KVSMHYSDPKP	1517	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=4226	15.963	2	1303.6231	1303.6231	Q	K	124	135
PSM	KWTSQHSNTQTLGK	1518	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4600	16.53	3	1614.8114	1614.8114	A	-	1006	1020
PSM	RALEELGEELHK	1519	sp|Q2M1P5|KIF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8850	22.158	3	1422.7467	1422.7467	R	R	927	939
PSM	RAMVEEMQGHLK	1520	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=3760	14.996	3	1459.6912	1459.6912	H	R	406	418
PSM	RASSLDAHEETISIEK	1521	sp|Q8TF05-2|PP4R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7566	20.596	3	1784.8905	1784.8905	L	R	518	534
PSM	RDETAVQDYHGH	1522	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4165	15.81	3	1426.6226	1426.6226	Y	K	11	23
PSM	RDFPAMVQELHQGGR	1523	sp|P10253|LYAG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9834	23.337	3	1739.8526	1739.8526	F	R	422	437
PSM	REAEAAIYHLQLFEELR	1524	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12236	28.067	3	2087.08	2087.0800	A	R	368	385
PSM	REHSNPNYDKTSAPITCELLN	1525	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:4	ms_run[2]:scan=9558	23.026	3	2458.1547	2458.1547	L	K	1983	2004
PSM	RELLPLIYHHLL	1526	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12099	27.516	3	1515.8926	1515.8926	R	R	8	20
PSM	RELNLQDFSHLDH	1527	sp|Q5VZK9-4|CARL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10898	24.816	3	1622.7801	1622.7801	T	R	31	44
PSM	REPEEHQVEEEH	1528	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3629	14.854	3	1546.6648	1546.6648	R	R	328	340
PSM	REQQIDEKEHTPDIV	1529	sp|Q9H1K0|RBNS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7347	20.326	3	1835.9014	1835.9014	K	K	262	277
PSM	RETAQAIKGMHI	1530	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7955	21.083	3	1353.7187	1353.7187	T	R	30	42
PSM	RFLINTIKNTLPSH	1531	sp|P0DPB5|RPC22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10409	24.081	3	1652.9362	1652.9362	K	K	45	59
PSM	RFPPEASGYLHIGHA	1532	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10742	24.578	4	1650.8267	1650.8267	V	K	201	216
PSM	RFQSSHHPTDITSLDQYVE	1533	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10423	24.098	3	2259.0556	2259.0556	L	R	511	530
PSM	RFSSELEQIELHNSIRD	1534	sp|Q96EY4|TMA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10760	24.609	3	2072.0287	2072.0287	N	R	84	101
PSM	RGAIQFVTQYQHSSGQR	1535	sp|Q15436-2|SC23A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8910	22.238	3	1961.982	1961.9820	G	R	274	291
PSM	RGEEGHDPKEPEQL	1536	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5232	17.408	3	1619.754	1619.7540	R	R	21	35
PSM	RGEPPHSELHPM	1537	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=4190	15.847	3	1401.6459	1401.6459	A	K	214	226
PSM	RGISHVIVDEIHE	1538	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9034	22.4	3	1502.7841	1502.7841	I	R	503	516
PSM	RGPGTHMSEPPHNNMQVYA	1539	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=4840	16.862	3	2153.9371	2153.9371	Q	-	2453	2472
PSM	RHALDAHQQSIPAVLEIPS	1540	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10994	24.971	4	2081.1018	2081.1018	V	K	75	94
PSM	RHYLLSQGWWDEEQE	1541	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11987	27.129	3	1974.886	1974.8860	L	K	365	380
PSM	RIPEKVFQASPEDHE	1542	sp|Q8TCC3-3|RM30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7758	20.829	3	1780.8744	1780.8744	S	K	40	55
PSM	RIRATQTGDAS	1543	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3513	14.714	2	1174.6054	1174.6054	Y	K	1605	1616
PSM	RKEYEQELSDDLHVE	1544	sp|Q7Z7F7|RM55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9650	23.123	3	1888.8803	1888.8803	S	R	103	118
PSM	RKGFSEGLWEIENNPTV	1545	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11811	26.62	3	1974.9799	1974.9799	K	K	72	89
PSM	RLELLELDHEQTR	1546	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10326	23.956	4	1650.8689	1650.8689	Q	R	795	808
PSM	RLLFPPKDDHTL	1547	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10662	24.45	3	1450.7932	1450.7932	A	K	815	827
PSM	RLRGWEAFLNAPEAN	1548	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12116	27.582	3	1742.8853	1742.8853	E	R	365	380
PSM	RLVQAEYWHDPIKEDVY	1549	sp|P50897-2|PPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10993	24.97	3	2160.064	2160.0640	E	R	76	93
PSM	RNPDRPTHLSLVSAPEVEDDSLE	1550	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10457	24.142	4	2575.2514	2575.2514	M	R	365	388
PSM	RPLEQALEDCRGHT	1551	sp|Q9HD15|SRA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=7586	20.619	3	1680.8002	1680.8002	L	R	116	130
PSM	RQDPQLHPEDPER	1552	sp|Q13084|RM28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5152	17.314	3	1615.7703	1615.7703	A	R	171	184
PSM	RQLHNSLDPSELPGKQGLPESG	1553	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9030	22.394	3	2358.1928	2358.1928	Y	R	1037	1059
PSM	RQQTDMAVNWAGGLHHA	1554	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=8511	21.734	3	1906.8857	1906.8857	N	K	97	114
PSM	RSDHLIQTDTVNLH	1555	sp|P51151|RAB9A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8029	21.169	3	1647.8329	1647.8329	D	R	178	192
PSM	RTGQPMIHIYLDKETG	1556	sp|Q01844-2|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9786	23.283	4	1857.9407	1857.9407	K	K	319	335
PSM	RTHLTEDTPKVNADIE	1557	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7435	20.431	3	1837.917	1837.9170	A	K	15	31
PSM	RVLHMVGDKPVFSFQP	1558	sp|Q9NP81|SYSM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35	ms_run[2]:scan=10464	24.15	3	1871.9716	1871.9716	A	R	187	203
PSM	RVNVCEHCLVANHA	1559	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6666	19.341	3	1677.7828	1677.7828	H	K	20	34
PSM	RVPVFSHEVVPDHL	1560	sp|Q96G25-3|MED8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10331	23.963	3	1629.8627	1629.8627	G	R	7	21
PSM	RVPVFSHEVVPDHL	1561	sp|Q96G25-3|MED8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10347	23.985	4	1629.8627	1629.8627	G	R	7	21
PSM	RIEPHTGLLLLSVQK	1562	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10807	24.684957930666666	3	1703.004964	1703.009390	C	R	2191	2206
PSM	RYGDGGSTFQSTTGHCVHM	1563	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=6795	19.523591758666665	3	2113.858208	2112.874172	H	R	275	294
PSM	RSSDLIQHQATHTGE	1564	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4839	16.86087807013333	3	1680.816550	1678.802310	Y	K	273	288
PSM	KKYEDICPSTHNMDVPNI	1565	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=8855	22.1628642536	3	2176.978252	2175.992890	G	K	67	85
PSM	KINHSNNAIVKPPEMTPQAAA	1566	sp|Q8WXA9|SREK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:35	ms_run[1]:scan=6411	18.9865911136	3	2246.147976	2246.147751	L	K	136	157
PSM	REAIQHPADEKLQE	1567	sp|Q9NUQ9|CYRIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5288	17.4806760152	3	1662.833173	1662.832548	I	K	64	78
PSM	REKPSIFYQQSLPSSHLTEEA	1568	sp|Q8TCU4|ALMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10218	23.8141802664	3	2447.217734	2446.212854	Y	K	1290	1311
PSM	KLVELNEDVRPHI	1569	sp|Q05D32|CTSL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9586	23.056879047200002	3	1561.847956	1560.862391	E	R	441	454
PSM	KDVKDAVVQHSQLAAAVENL	1570	sp|O60645|EXOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=11396	25.697459851466665	3	2135.146013	2134.138232	L	K	97	117
PSM	KVMQEQGTHPKFQ	1571	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35	ms_run[1]:scan=4328	16.161624550933333	3	1573.749088	1572.771862	E	K	545	558
PSM	KKLITDEFVKQ	1572	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8157	21.318900898133332	3	1347.776956	1347.776202	V	K	413	424
PSM	KQSVDKVTSPTKV	1573	sp|Q05682-4|CALD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4693	16.642902425333332	3	1415.798836	1415.798394	E	-	526	539
PSM	KKLLEDTLFPSSK	1574	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9930	23.437645257333333	3	1504.855567	1504.850095	P	K	605	618
PSM	KRPDDVPLSLSPSK	1575	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8003	21.140395955733332	3	1537.847162	1537.846407	L	R	233	247
PSM	KRVCEEIAIIPSK	1576	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=8420	21.6276904816	3	1541.860103	1541.859949	N	K	32	45
PSM	KKSGGATIEELTEKC	1577	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:4	ms_run[1]:scan=7573	20.604347145066665	3	1649.828141	1649.829437	A	K	2095	2110
PSM	RKAAPAPGKVGDVTPQV	1578	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6784	19.509025269333332	3	1689.952146	1689.952603	A	K	236	253
PSM	KKVNPDLQVEVKPSI	1579	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8825	22.1261999112	3	1692.977198	1692.977421	K	R	612	627
PSM	KKMVDPEKPQLGMID	1580	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:35	ms_run[1]:scan=7792	20.8711476048	3	1743.889702	1743.889928	S	R	141	156
PSM	RKAEVTLDGVWPTDKTS	1581	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10006	23.5281426216	3	1902.986140	1901.984691	N	R	817	834
PSM	KKNPQAVLDVLEFYNSK	1582	sp|Q13153|PAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=11995	27.157891664266668	3	1992.069729	1992.068027	Q	K	118	135
PSM	KKMDPQKTLQTMQNFQ	1583	sp|Q9UQN3|CHM2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=5855	18.254537669866668	3	1996.973051	1996.971033	N	K	114	130
PSM	RKGAGDGSDEEVDGKADGAEA	1584	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3884	15.226768475733333	3	2032.899136	2032.893370	A	K	1936	1957
PSM	KKCLELFTELAEDKENY	1585	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:4	ms_run[1]:scan=11691	26.3260408368	3	2129.038229	2129.035072	V	K	418	435
PSM	KKNYQSQADIPIRSPFGIV	1586	sp|Q14966|ZN638_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=11522	25.963585509866668	3	2160.168222	2160.169138	S	K	370	389
PSM	RKSALEQPETGKAGADGGTPTD	1587	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4882	16.9222111928	3	2185.062182	2185.061104	V	R	1192	1214
PSM	KRPVFPPLCGDGLLSGKEET	1588	sp|Q9NRX1|PNO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:4	ms_run[1]:scan=11274	25.475571512266665	3	2199.136880	2199.135789	A	R	56	76
PSM	RKTCTTVAFTQVNSEDKGALA	1589	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=8564	21.794649882133335	4	2296.149559	2296.148145	H	K	196	217
PSM	KKLNECLQEVYEPDWPGRDEAN	1590	sp|O00499|BIN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:4	ms_run[1]:scan=10725	24.5574129304	3	2689.245474	2689.244230	S	K	80	102
PSM	KAFSQHSNLTQHQ	1591	sp|Q99676|ZN184_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4432	16.286	3	1524.7433	1524.7433	G	K	425	438
PSM	KALSDHHIYLEGTLL	1592	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11108	25.172	3	1708.9148	1708.9148	Y	K	215	230
PSM	KALSQRDPPHNNFFFFDGM	1593	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	19-UNIMOD:35	ms_run[2]:scan=11787	26.562	4	2283.0531	2283.0531	V	K	316	335
PSM	KAPGTPHSHT	1594	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3283	14.37	2	1031.5148	1031.5148	G	K	125	135
PSM	KASLLHSMPTHSSP	1595	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=5015	17.121	2	1507.7453	1507.7453	N	R	1001	1015
PSM	KAYCPQIGCSHTDIR	1596	sp|Q96MF7|NSE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6726	19.428	4	1804.8349	1804.8349	K	K	207	222
PSM	KAYHPGCFTCVVCH	1597	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8171	21.333	3	1734.7429	1734.7429	G	R	356	370
PSM	KDENKLSSANGHEE	1598	sp|Q14498-2|RBM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3560	14.766	3	1556.7067	1556.7067	K	R	17	31
PSM	KDVGHNIYILAHQLA	1599	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11517	25.955	3	1690.9155	1690.9155	P	R	2102	2117
PSM	KDVSHEIIQHEV	1600	sp|Q7Z6E9-4|RBBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7478	20.483	3	1432.731	1432.7310	T	K	538	550
PSM	KEGPDKCSISGHGSLNSIS	1601	sp|O75044|SRGP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4	ms_run[2]:scan=6740	19.453	3	1971.932	1971.9320	P	R	887	906
PSM	KEHPYLFSQCQAIHC	1602	sp|P09960-4|LKHA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9287	22.709	3	1916.8662	1916.8662	G	R	103	118
PSM	KELHDLFNLPHD	1603	sp|Q9NUQ7|UFSP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10896	24.812	3	1476.7361	1476.7361	R	R	228	240
PSM	KEPHFQSLLEAHDIVAS	1604	sp|Q9NZW5|MPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11092	25.146	4	1919.9741	1919.9741	L	K	85	102
PSM	KEYVEHTVKE	1605	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4087	15.621	2	1260.635	1260.6350	G	R	127	137
PSM	KFPDELAHVEKAS	1606	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8806	22.101	3	1469.7514	1469.7514	L	R	1012	1025
PSM	KFSHEEIAMATVTALR	1607	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10789	24.656	4	1802.9349	1802.9349	Q	R	243	259
PSM	KHELLSLASSNHLG	1608	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9365	22.796	3	1504.7998	1504.7998	D	K	227	241
PSM	KHIYYITGETKDQVANSAFVE	1609	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12383	28.743	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHNGPNDASDGTVRL	1610	sp|P31942-2|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5873	18.283	3	1579.7703	1579.7703	M	R	6	21
PSM	KHNLMTVEQNNGSSQK	1611	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=3718	14.949	3	1829.869	1829.8690	A	K	610	626
PSM	KHNLMTVEQNNGSSQK	1612	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4916	16.976	3	1813.8741	1813.8741	A	K	610	626
PSM	KHSPEDPEKYSCFALFV	1613	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=11945	26.995	3	2052.9615	2052.9615	L	K	692	709
PSM	KHTPVDHPDYPLLQDAL	1614	sp|Q12979-4|ABR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11394	25.694	3	1957.9898	1957.9898	L	R	209	226
PSM	KHVLFPLKSEFVIL	1615	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12243	28.103	3	1668.9967	1668.9967	I	R	265	279
PSM	KHWPFQVINDGDKP	1616	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10329	23.961	3	1679.842	1679.8420	M	K	88	102
PSM	KIISKIENHEGV	1617	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6542	19.168	3	1365.7616	1365.7616	I	R	251	263
PSM	KINHSNNAIVKPPEMTPQAAA	1618	sp|Q8WXA9|SREK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:35	ms_run[2]:scan=6435	19.023	3	2246.1478	2246.1478	L	K	136	157
PSM	KIPNFLHLTPVAIK	1619	sp|P82673-2|RT35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11858	26.734	4	1589.9657	1589.9657	L	K	107	121
PSM	KIPVHPNDHVN	1620	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4522	16.419	2	1268.6626	1268.6626	S	K	129	140
PSM	KITPHTLNFVK	1621	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8279	21.458	3	1296.7554	1296.7554	A	K	3333	3344
PSM	KIVQKYGYTHLSTGDLL	1622	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10277	23.897	3	1935.0466	1935.0466	E	R	27	44
PSM	KKALIEVLQPLIAEHQA	1623	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11975	27.091	4	1900.1146	1900.1146	L	R	390	407
PSM	KKLEFVPTNLHIQ	1624	sp|Q96PE3-2|INP4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10399	24.068	3	1565.893	1565.8930	D	R	329	342
PSM	KKLPSVEGLHAIVVSD	1625	sp|Q9UHA4-2|LTOR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10190	23.776	3	1690.9618	1690.9618	Y	R	11	27
PSM	KKLTLLPAVVMHL	1626	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12083	27.46	3	1461.9105	1461.9105	L	K	261	274
PSM	KKNLLESIPTHSDQE	1627	sp|Q4LE39-4|ARI4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8621	21.86	3	1737.8897	1737.8897	S	K	153	168
PSM	KKSEAQHEQPEDGCPFGALTQ	1628	sp|O75528-2|TADA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:4	ms_run[2]:scan=9018	22.381	3	2356.0754	2356.0754	L	R	242	263
PSM	KKVMSQEIQEQLH	1629	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=5517	17.798	3	1612.8243	1612.8243	K	K	3253	3266
PSM	KLDDLVRPYVH	1630	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10138	23.703	3	1353.7405	1353.7405	Y	K	562	573
PSM	KLEPLHFLQCHS	1631	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=10749	24.594	3	1507.7606	1507.7606	V	K	272	284
PSM	KLFCTSCNVVLNHVR	1632	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9570	23.039	4	1845.9342	1845.9342	G	K	40	55
PSM	KLHPEDFPEEDK	1633	sp|O95298-2|NDUC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6743	19.459	3	1482.6991	1482.6991	M	K	71	83
PSM	KLKGEMMDLQHGSLFLQTP	1634	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=11116	25.184	4	2188.102	2188.1020	D	K	58	77
PSM	KLLECPHLNVR	1635	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4	ms_run[2]:scan=8318	21.503	3	1377.7551	1377.7551	F	K	704	715
PSM	KLLLNHASDNIPKADEI	1636	sp|Q9Y248|PSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9650	23.123	3	1890.0211	1890.0211	T	R	97	114
PSM	KLPPVLVLHLK	1637	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11004	24.988	3	1255.838	1255.8380	E	R	677	688
PSM	KLSPKHPESNTAGMDIFA	1638	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:35	ms_run[2]:scan=7909	21.026	3	1957.9568	1957.9568	L	K	106	124
PSM	KMTNYDVEHTIK	1639	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35	ms_run[2]:scan=5727	18.093	3	1493.7184	1493.7184	I	K	536	548
PSM	KPHTVPCKVTG	1640	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4	ms_run[2]:scan=3840	15.127	2	1222.6492	1222.6492	G	R	176	187
PSM	KPQHYPSIHITAYENDE	1641	sp|Q4J6C6-4|PPCEL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9118	22.5	3	2040.9541	2040.9541	I	R	541	558
PSM	KQSVEDILKDHWQ	1642	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11128	25.206	3	1624.8209	1624.8209	R	K	406	419
PSM	KRGFAFVTFDDHDTVD	1643	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11335	25.573	3	1868.8693	1868.8693	K	K	166	182
PSM	KSITHDIEEKGV	1644	sp|Q9UHD8-4|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6364	18.935	3	1354.7092	1354.7092	I	R	92	104
PSM	KSKGESDDFHMDFDSAVAP	1645	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=9216	22.623	3	2097.8949	2097.8949	K	R	1490	1509
PSM	KSKVTLLEGDHV	1646	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7802	20.889	3	1324.7351	1324.7351	T	R	274	286
PSM	KSVYVPGNHTHQASY	1647	sp|Q8WU76|SCFD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5666	18.018	3	1686.8114	1686.8114	F	K	558	573
PSM	KSWVGFSGGQHHTVCMDSEG	1648	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:4	ms_run[2]:scan=8843	22.148	3	2204.9368	2204.9368	T	K	294	314
PSM	KTFNLEKQNHTP	1649	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5814	18.2	3	1455.747	1455.7470	N	R	5	17
PSM	KTIAQVLVHLH	1650	sp|Q99747-2|SNAG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10311	23.939	3	1257.7557	1257.7557	K	R	114	125
PSM	KTLNQQLTNHIRESLPAL	1651	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11621	26.17	3	2075.1487	2075.1487	Q	R	279	297
PSM	KTVKHGAGAEISTVNPEQYS	1652	sp|P48426-2|PI42A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7710	20.77	3	2115.0596	2115.0596	A	K	316	336
PSM	KVAHSDKPGSTSTASF	1653	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4892	16.935	3	1618.7951	1618.7951	R	R	205	221
PSM	KVKEVLFQHSGFQQS	1654	sp|Q96CD2-2|COAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8673	21.926	3	1760.921	1760.9210	D	-	113	128
PSM	KVLKQVHPDTGISS	1655	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5303	17.498	2	1507.8358	1507.8358	Y	K	44	58
PSM	KWVPEITHHCP	1656	sp|P60953-1|CDC42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=7806	20.898	3	1402.6816	1402.6816	E	K	96	107
PSM	RAIQGGTSHHLGQNFS	1657	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5894	18.313	3	1708.8394	1708.8394	G	K	1234	1250
PSM	RALDHAMSVASDHNV	1658	sp|Q9Y5B6|PAXB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=5787	18.163	3	1637.758	1637.7580	V	K	893	908
PSM	RALEHFTDLYDIK	1659	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10683	24.485	3	1619.8308	1619.8308	Q	R	625	638
PSM	RAQQACIEAKHD	1660	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=3583	14.789	3	1425.6783	1425.6783	V	K	122	134
PSM	RATFHTPFSHLGQSPEGCSSYTFP	1661	sp|O75521-2|ECI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	18-UNIMOD:4	ms_run[2]:scan=11473	25.868	4	2710.2234	2710.2234	D	K	230	254
PSM	RDAVTYTEHAK	1662	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4041	15.545	3	1289.6364	1289.6364	I	R	68	79
PSM	RDILQDYTHEFH	1663	sp|O95249-2|GOSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10808	24.686	3	1572.7321	1572.7321	H	K	47	59
PSM	RDLAQYDAAHHEEF	1664	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8139	21.296	3	1700.7543	1700.7543	T	K	163	177
PSM	RDLLHPSLEEEK	1665	sp|Q71UM5|RS27L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8197	21.363	3	1464.7573	1464.7573	A	K	5	17
PSM	RDLLVHVEYCSK	1666	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=8662	21.911	3	1517.766	1517.7660	H	-	453	465
PSM	REKQAPELSLSSQDLEVGGNQGH	1667	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9620	23.093	3	2478.2099	2478.2099	L	-	246	269
PSM	RHATALEELSEQLEQAK	1668	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11933	26.955	4	1951.9963	1951.9963	Q	R	1200	1217
PSM	RHQYYNQEWTLWD	1669	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11926	26.928	3	1837.8172	1837.8172	P	R	904	917
PSM	RIEPHTGLLLLSVQK	1670	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10779	24.64	3	1703.0094	1703.0094	C	R	2191	2206
PSM	RIFILGPSHHVPLS	1671	sp|Q9Y316-2|MEMO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10195	23.781	3	1571.8936	1571.8936	R	R	50	64
PSM	RIRDVTNNQE	1672	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3926	15.308	2	1243.6269	1243.6269	K	K	108	118
PSM	RKVSQPIEGHAASFAQF	1673	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9421	22.866	3	1871.9642	1871.9642	D	K	188	205
PSM	RLDPNKYPVPENWLH	1674	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11070	25.101	4	1876.9584	1876.9584	R	K	198	213
PSM	RLEAVSHTSDMH	1675	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4701	16.655	3	1381.6408	1381.6408	G	R	17	29
PSM	RLGSFHELLLEPPK	1676	sp|Q5H9R7-6|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10921	24.848	3	1634.9144	1634.9144	G	K	312	326
PSM	RLLFPPKDDHTL	1677	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10425	24.101	3	1450.7932	1450.7932	A	K	815	827
PSM	RLMSELYHPDDHVL	1678	sp|P49770|EI2BB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=9438	22.889	2	1739.8301	1739.8301	Y	-	338	352
PSM	RLPGLIDVHVHL	1679	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11720	26.397	3	1367.8038	1367.8038	V	R	1463	1475
PSM	RLVLVLGDLHIPH	1680	sp|Q9UBQ0-2|VPS29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12198	27.897	3	1480.8878	1480.8878	H	R	5	18
PSM	RLVQAFQYTDKHGEVCPAGW	1681	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:4	ms_run[2]:scan=10874	24.786	4	2361.1324	2361.1324	L	K	230	250
PSM	RMKEYGEQIDPSTH	1682	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35	ms_run[2]:scan=5362	17.58	3	1705.773	1705.7730	D	R	88	102
PSM	RNDIASHPPVEGSYAPR	1683	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7105	19.996	2	1864.918	1864.9180	M	R	715	732
PSM	RPIMSNHTATHILNFAL	1684	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=11310	25.534	3	1951.0098	1951.0098	R	R	599	616
PSM	RPPHGELQYLGQIQHIL	1685	sp|P04818-3|TYSY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12053	27.358	3	1998.0799	1998.0799	P	R	25	42
PSM	RPVAVAAGEFLHK	1686	sp|Q8WVM7-2|STAG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8963	22.314	3	1393.783	1393.7830	H	K	425	438
PSM	RQAGEVTYADAHKG	1687	sp|Q08170|SRSF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4239	15.994	3	1501.7274	1501.7274	M	R	125	139
PSM	RQIESGHQQEVETLK	1688	sp|Q13615-3|MTMR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5322	17.527	3	1780.9068	1780.9068	L	K	1032	1047
PSM	RRTLLEQLDDDQ	1689	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10763	24.614	2	1500.7532	1500.7532	R	-	919	931
PSM	RRVDIDEFDEN	1690	sp|Q9BPX5|ARP5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8745	22.017	2	1406.6426	1406.6426	F	K	11	22
PSM	RSMSGHPEAAQMVR	1691	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=3509	14.71	3	1587.7246	1587.7246	A	R	1468	1482
PSM	RSNLPAKAIGH	1692	sp|P18077|RL35A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4551	16.457	3	1162.6571	1162.6571	F	R	89	100
PSM	RSQSSHSYDDSTLPLIDRNQ	1693	sp|O60716-13|CTND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9139	22.525	4	2318.0887	2318.0887	S	K	798	818
PSM	RTHNGESVSYLFSHVPL	1694	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11986	27.126	3	1941.9697	1941.9697	R	-	235	252
PSM	RVYVVGTAHFSDDSK	1695	sp|Q9H4I3-2|TRABD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8447	21.655	3	1679.8267	1679.8267	P	R	28	43
PSM	KLDKSQIHDIVLVGGST	1696	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10224	23.8303447624	3	1809.000664	1808.999613	A	R	325	342
PSM	KHSTIVPENAAHQGAN	1697	sp|Q9UPY3|DICER_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4574	16.482170171733333	3	1672.830558	1672.828131	C	R	1123	1139
PSM	RKPQLELAMVPHYGGIN	1698	sp|Q9BQ67|GRWD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10888	24.80238213386667	3	1922.018944	1922.019637	E	R	137	154
PSM	RPQFHQFTAVPHPNV	1699	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9569	23.0380521224	3	1774.893425	1773.906322	L	K	470	485
PSM	KHMPPNLQKVDLF	1700	sp|Q9BRT9|SLD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35	ms_run[1]:scan=9862	23.3705728896	3	1581.846776	1581.833734	L	R	147	160
PSM	KLYHNEVEIEKLN	1701	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8125	21.279586552	3	1627.855071	1627.856972	F	K	227	240
PSM	KYWDLMNLSEKHD	1702	sp|Q9BZE4|NOG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:35	ms_run[1]:scan=9990	23.511936488533333	3	1693.777889	1693.777007	Q	K	415	428
PSM	RKGPEDTAQLAHAVLA	1703	sp|Q15833|STXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9369	22.8068414176	3	1675.891105	1675.900568	Y	K	192	208
PSM	RDIKAANVLLSEHGEV	1704	sp|Q9Y6E0|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9526	22.985350437066664	3	1749.937500	1749.937347	H	K	155	171
PSM	KQVDFWFGDANLHKD	1705	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11184	25.305647773066667	3	1818.870242	1818.868933	A	R	40	55
PSM	KKFDPMGQQTCSAHPA	1706	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=4540	16.4446163896	3	1817.818093	1817.818889	L	R	18	34
PSM	RLEHSSFPEGPGPGSGDEANGPRGE	1707	sp|O15020|SPTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7454	20.4528003136	4	2535.136395	2535.137457	Q	R	2157	2182
PSM	RKPLVLCGDLNVAHEEIDL	1708	sp|P27695|APEX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=11649	26.230139556533334	3	2190.150275	2190.146688	S	R	202	221
PSM	KHTTSIFDDFAHYE	1709	sp|Q9BYJ9|YTHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11673	26.284999511733336	3	1709.768734	1709.768550	Y	K	527	541
PSM	KHIEVANGPASHFET	1710	sp|Q92558|WASF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7402	20.391073567466666	3	1635.799701	1635.800519	H	R	223	238
PSM	KEKYPLFTFVNGHS	1711	sp|Q96DT6|ATG4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11436	25.785748655733336	3	1666.841435	1665.851492	S	R	410	424
PSM	RAHVIVMAATNRPNSIDPAL	1712	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:35	ms_run[1]:scan=9070	22.442870544	3	2162.140533	2161.142606	Q	R	338	358
PSM	KTKPADMVIEAYGHGQ	1713	sp|O94903|PLPHP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:35	ms_run[1]:scan=7439	20.435542197333334	3	1759.859850	1759.856320	S	R	47	63
PSM	KHNLMTVEQNNGSSQK	1714	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:35	ms_run[1]:scan=3680	14.906468110666667	3	1829.866362	1829.869010	A	K	610	626
PSM	KKSDLEIELLK	1715	sp|Q9H098|F107B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9877	23.385220885866666	3	1314.782762	1314.775868	K	R	76	87
PSM	RKEPPLTPVPLK	1716	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7577	20.6084617672	3	1373.837374	1373.839471	S	R	213	225
PSM	KKTSEVDLAKPLV	1717	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8517	21.74248357813333	3	1426.841959	1426.839531	L	K	10	23
PSM	KKLASAAYPDPSKQ	1718	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5023	17.132803566133337	3	1502.809499	1502.809293	L	K	334	348
PSM	RKVQPGYPVVPAEK	1719	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6653	19.319334852266664	3	1566.887171	1566.888212	P	R	176	190
PSM	KKGFDQEEVFEKPT	1720	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8001	21.139104333066665	3	1680.838907	1680.835902	S	R	820	834
PSM	KKMVDPEKPQLGMID	1721	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=7088	19.976751567466668	3	1759.883842	1759.884843	S	R	141	156
PSM	KKGLDPYNVLAPKGASGT	1722	sp|P10606|COX5B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9264	22.681973233066667	3	1814.989954	1814.989048	A	R	56	74
PSM	RKTIPVILDGKDVVAMA	1723	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11119	25.18811734746667	3	1825.049758	1825.049540	Q	R	124	141
PSM	RKPAVPPKAGPAEAVAGQQ	1724	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5475	17.742507857333333	3	1871.038464	1871.037730	P	K	342	361
PSM	KKILDSVGIEADDDRLN	1725	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9555	23.02327516933333	3	1899.989912	1899.990171	I	K	24	41
PSM	RKEMAPVPGTTTTTTSVK	1726	sp|O75150|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:35	ms_run[1]:scan=4949	17.021472850133332	3	1920.003662	1919.998627	N	K	561	579
PSM	KKTGQPMINLYTDRETG	1727	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8769	22.048206449333335	3	1950.983511	1950.983311	N	K	315	332
PSM	KKIGDEYFTFITDCKDP	1728	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:4	ms_run[1]:scan=11621	26.170096013333332	3	2075.984249	2075.987394	I	K	353	370
PSM	KKYGEFFPVPESILTSMK	1729	sp|Q9UGM6|SYWM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:35	ms_run[1]:scan=11876	26.784767021333334	3	2116.085120	2116.091465	N	K	198	216
PSM	RKLQELSSKADEASELACPTP	1730	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	18-UNIMOD:4	ms_run[1]:scan=8940	22.281790318933336	3	2329.159727	2329.158375	L	K	2185	2206
PSM	KKEAELDVNEELDK	1731	sp|P43034|LIS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7447	20.444437851466667	2	1658.838440	1658.836296	F	K	32	46
PSM	KAAVMVHQLSK	1732	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=4324	16.155	3	1226.6805	1226.6805	N	K	170	181
PSM	KADQLKDEGNNHM	1733	sp|Q96EQ0|SGTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:35	ms_run[2]:scan=3475	14.673	3	1514.6784	1514.6784	G	K	84	97
PSM	KAGVENGKPTHFTVYT	1734	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7579	20.61	3	1747.8893	1747.8893	S	K	857	873
PSM	KAHQLEEDIVSVTH	1735	sp|Q86VP1-3|TAXB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9083	22.46	3	1604.8158	1604.8158	S	K	46	60
PSM	KAKQNQVASPQPPHPGEITNAHNSSCISN	1736	sp|Q8IWZ8-2|SUGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	26-UNIMOD:4	ms_run[2]:scan=6643	19.306	4	3110.4952	3110.4952	Q	K	53	82
PSM	KATDDYHYEKF	1737	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7370	20.354	3	1415.6357	1415.6357	E	K	272	283
PSM	KCLYHTEGEHCQFC	1738	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=6667	19.342	3	1867.744	1867.7440	L	R	999	1013
PSM	KCNAAFGAHDFH	1739	sp|O75150-4|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=6527	19.149	3	1373.5935	1373.5935	P	R	885	897
PSM	KDFYVAFQDLPTRH	1740	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11073	25.107	4	1735.8682	1735.8682	A	K	108	122
PSM	KDFYVAFQDLPTRH	1741	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11066	25.094	3	1735.8682	1735.8682	A	K	108	122
PSM	KDHQYQFLEDAVRNQ	1742	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10237	23.847	4	1889.902	1889.9020	H	R	156	171
PSM	KEAGDFHFQPAVK	1743	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8111	21.265	3	1472.7412	1472.7412	L	K	15	28
PSM	KEHELLEQQK	1744	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4482	16.359	3	1280.6725	1280.6725	L	R	173	183
PSM	KEISGHTSGIK	1745	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3572	14.778	3	1155.6248	1155.6248	P	K	137	148
PSM	KELTEEKESAFEFLSSA	1746	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12033	27.29	3	1943.9364	1943.9364	A	-	229	246
PSM	KERDEMETHLQSLQFD	1747	sp|Q08378-2|GOGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=9154	22.543	3	2020.916	2020.9160	Q	K	927	943
PSM	KEVHDSESHQLALQ	1748	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5718	18.081	3	1619.7903	1619.7903	K	K	717	731
PSM	KGEAGKFEANGSHTEITPEA	1749	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6974	19.81	3	2071.9811	2071.9811	L	K	866	886
PSM	KGEHPGLSIGDVAK	1750	sp|B2RPK0|HGB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7726	20.793	3	1406.7518	1406.7518	I	K	114	128
PSM	KGKNPEDLIWHTPEGISI	1751	sp|P22033|MUTA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11962	27.041	4	2033.0582	2033.0582	L	K	52	70
PSM	KGVSKAVEHIN	1752	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4042	15.547	3	1180.6564	1180.6564	G	K	60	71
PSM	KHALLEADVAAHQD	1753	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6969	19.805	3	1516.7634	1516.7634	K	R	719	733
PSM	KHFTILDAPGH	1754	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8472	21.685	3	1234.6459	1234.6459	K	K	152	163
PSM	KHFVGMLPEKDC	1755	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6187	18.697	3	1475.6901	1475.6901	F	R	52	64
PSM	KHIYYITGETKDQVANSAFVE	1756	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12287	28.299	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHPSKPDPSGECNPDL	1757	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:4	ms_run[2]:scan=5171	17.337	3	1776.8101	1776.8101	T	R	121	137
PSM	KHPVSCKDTPGFIVN	1758	sp|Q16836|HCDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=7589	20.622	3	1697.8559	1697.8559	G	R	206	221
PSM	KHQALQAEIAGHEP	1759	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7489	20.497	3	1527.7794	1527.7794	K	R	825	839
PSM	KILEVHIDKGM	1760	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8780	22.065	3	1281.7115	1281.7115	K	K	206	217
PSM	KIPVHPNDHVN	1761	sp|P07954-2|FUMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4548	16.454	3	1268.6626	1268.6626	S	K	129	140
PSM	KKDEVCVNPYHYQ	1762	sp|P84022-3|SMAD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=7265	20.234	3	1678.7773	1678.7773	M	R	11	24
PSM	KKGTMTTGHNVADLVVIL	1763	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=11458	25.829	3	1912.0452	1912.0452	Y	K	109	127
PSM	KKLASQGDSISSQLGPIHPPP	1764	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9387	22.826	4	2156.159	2156.1590	S	R	121	142
PSM	KKLDAQVQELHA	1765	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7000	19.845	3	1378.7569	1378.7569	R	K	1255	1267
PSM	KKLLELDPEHQ	1766	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8077	21.227	3	1348.7351	1348.7351	T	R	229	240
PSM	KKVGSLYPEMSAHE	1767	sp|Q14203-5|DCTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35	ms_run[2]:scan=5673	18.027	3	1590.7712	1590.7712	Y	R	549	563
PSM	KLNECVDHTPKL	1768	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4	ms_run[2]:scan=7153	20.071	3	1452.7395	1452.7395	M	K	155	167
PSM	KLTEVHEELQK	1769	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5518	17.799	3	1352.73	1352.7300	E	K	514	525
PSM	KMNPGEKEPIH	1770	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=3595	14.802	3	1294.634	1294.6340	S	R	1215	1226
PSM	KNQAVCHDYDIHFYPTF	1771	sp|Q6ZRP7|QSOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=11558	26.03	3	2153.9629	2153.9629	E	R	126	143
PSM	KPKGQTEHDEGMLEYLEDIIGCG	1772	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:35,22-UNIMOD:4	ms_run[2]:scan=12381	28.732	3	2634.1942	2634.1942	M	R	239	262
PSM	KPKVDNVEVLDHEEE	1773	sp|O00443-2|P3C2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7434	20.43	3	1778.8687	1778.8687	S	K	278	293
PSM	KQHVPLEQVEALK	1774	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8662	21.911	3	1517.8566	1517.8566	Q	K	1096	1109
PSM	KQIFLGGVDKHTQFW	1775	sp|P12236|ADT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11324	25.555	3	1802.9468	1802.9468	Y	R	96	111
PSM	KQLVAEAIHSGK	1776	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5672	18.026	3	1279.7248	1279.7248	G	K	411	423
PSM	KQQHVIETLIGK	1777	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8659	21.906	3	1392.8089	1392.8089	M	K	502	514
PSM	KRFTAQGLPDLNHSQVYAV	1778	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10519	24.227	3	2143.1174	2143.1174	P	K	461	480
PSM	KSRPEFMLPVHFYG	1779	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11816	26.635	3	1706.8603	1706.8603	E	K	158	172
PSM	KSTKPGAAPTEH	1780	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3315	14.444	3	1222.6306	1222.6306	G	K	788	800
PSM	KTKDVEILHL	1781	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9529	22.99	3	1194.6972	1194.6972	A	R	193	203
PSM	KTPFLGDMAHIR	1782	sp|Q9H857-4|NT5D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9889	23.398	3	1384.7285	1384.7285	M	-	379	391
PSM	KTSMESLIHHF	1783	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=7925	21.043	3	1344.6496	1344.6496	M	K	372	383
PSM	KVEKSELHLMD	1784	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35	ms_run[2]:scan=6009	18.461	2	1343.6755	1343.6755	E	R	292	303
PSM	KVIEPLKDFH	1785	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8463	21.675	3	1224.6867	1224.6867	G	K	307	317
PSM	KVIQKVEAFEH	1786	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7207	20.143	3	1326.7296	1326.7296	K	R	792	803
PSM	KVWIKPGAEQSFLYGNHVL	1787	sp|Q9Y221|NIP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11611	26.147	3	2185.1684	2185.1684	Y	K	96	115
PSM	KYRPQTLNDLISHQDILSTIQ	1788	sp|P40937-2|RFC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12195	27.882	3	2482.318	2482.3180	E	K	4	25
PSM	KYSHLQPGDHLTDITL	1789	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10353	23.998	3	1836.937	1836.9370	Q	K	111	127
PSM	RAINEAYKEDYH	1790	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5619	17.951	3	1507.7056	1507.7056	I	K	439	451
PSM	RAKGVSIPLMHEAMQ	1791	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=6939	19.739	3	1698.8545	1698.8545	H	K	514	529
PSM	RDGFIDKEDLHDMLASLG	1792	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12522	29.421	3	2030.9731	2030.9731	N	K	44	62
PSM	RDVHHEPVYPQPPFSYSDLS	1793	sp|Q14181-2|DPOA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11096	25.153	3	2369.1077	2369.1077	L	R	219	239
PSM	REDAMAMVDHCLK	1794	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,7-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=5474	17.742	3	1606.6902	1606.6902	T	K	542	555
PSM	RENPHDAVVFHP	1795	sp|P08397-4|HEM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7604	20.642	3	1416.6898	1416.6898	K	K	99	111
PSM	RENTQTTIKLFQECCPHSTD	1796	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9478	22.932	4	2464.1111	2464.1111	L	R	147	167
PSM	RGHPPGQDDGGGDHEPVPSL	1797	sp|Q9UBU6|FA8A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7799	20.885	3	2022.9144	2022.9144	A	R	9	29
PSM	RHPWDDISYVLPEHMSM	1798	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35	ms_run[2]:scan=12084	27.463	3	2127.9506	2127.9506	Y	-	814	831
PSM	RIIAHAQLLEQH	1799	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7683	20.741	3	1427.7997	1427.7997	K	R	842	854
PSM	RIIFSPVAPKEEHV	1800	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9359	22.79	4	1620.8988	1620.8988	N	R	889	903
PSM	RIPASQTSVPFDHLGK	1801	sp|P49674|KC1E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9015	22.378	3	1751.9319	1751.9319	S	-	401	417
PSM	RIPGSTEAFPHQH	1802	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6599	19.245	3	1475.727	1475.7270	R	R	19	32
PSM	RKLVQNGPEVHPGANFIQQ	1803	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8727	21.995	3	2131.1287	2131.1287	L	R	405	424
PSM	RKQLGQDPFFDMHMMVS	1804	sp|Q96AT9-4|RPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:35,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=9127	22.51	3	2113.9384	2113.9384	L	K	58	75
PSM	RLAHGGQVNLDMEDH	1805	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:35	ms_run[2]:scan=5668	18.02	3	1706.7795	1706.7795	R	R	113	128
PSM	RLLETYLILVKHGSGT	1806	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11829	26.666	3	1799.0305	1799.0305	K	K	321	337
PSM	RLNVDFALIHKE	1807	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10532	24.245	3	1453.8041	1453.8041	D	R	117	129
PSM	RLQICTQHHTEAIG	1808	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4	ms_run[2]:scan=7005	19.85	2	1662.826	1662.8260	S	K	149	163
PSM	RLVQAEYWHDPIKEDVY	1809	sp|P50897-2|PPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11013	25.008	4	2160.064	2160.0640	E	R	76	93
PSM	RMEELHNQEMQK	1810	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3449	14.645	3	1603.7083	1603.7083	R	R	548	560
PSM	RNDIASHPPVEGSYAPR	1811	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7035	19.901	3	1864.918	1864.9180	M	R	715	732
PSM	RNYFTDKAASYTEEDENHTA	1812	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8853	22.161	4	2361.0145	2361.0145	L	K	773	793
PSM	RPIMSNHTATHILNFAL	1813	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11665	26.262	3	1935.0149	1935.0149	R	R	599	616
PSM	RPKSSQIGAVVSHQSSVIPD	1814	sp|Q9NVS9-3|PNPO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8584	21.819	3	2091.1073	2091.1073	S	R	143	163
PSM	RPMAHPDEDPRNTQTSQI	1815	sp|Q15018|ABRX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=5521	17.801	3	2107.9705	2107.9705	S	-	398	416
PSM	RQASTLIDRPAPHFE	1816	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8546	21.774	3	1736.8958	1736.8958	T	R	526	541
PSM	RRNENSEVDTSAGSGSAPSVLHQ	1817	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6711	19.403	3	2397.1269	2397.1269	E	R	1475	1498
PSM	RRYTLNVLEDLGDGQ	1818	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12157	27.735	3	1747.8853	1747.8853	M	K	458	473
PSM	RSFVPDKGAHYCVPCYEN	1819	sp|Q13643|FHL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9106	22.486	3	2197.9673	2197.9673	S	K	139	157
PSM	RSGSLLYLHDTLEDIK	1820	sp|Q96JH7|VCIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11459	25.83	3	1858.9789	1858.9789	D	R	184	200
PSM	RSMSGHPEAAQMVR	1821	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=3525	14.729	3	1587.7246	1587.7246	A	R	1468	1482
PSM	RTTEEALHASHGFMWYT	1822	sp|Q9P0J0|NDUAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35	ms_run[2]:scan=10240	23.851	3	2051.916	2051.9160	L	-	128	145
PSM	RVAHEPVAPPEDKESESEA	1823	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5230	17.406	3	2075.976	2075.9760	Q	K	7	26
PSM	RVKEVLPHVPLGVIQ	1824	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10876	24.788	3	1683.0196	1683.0196	Q	R	303	318
PSM	RVLSAPPHFHFGQTN	1825	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9581	23.051	2	1706.8641	1706.8641	V	R	30	45
PSM	RVQIEHISSLIKLS	1826	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11181	25.299	4	1621.9515	1621.9515	S	K	344	358
PSM	RVSVADHSLHLS	1827	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7735	20.801	3	1319.6946	1319.6946	S	K	66	78
PSM	RYDHLDPTEMEKVE	1828	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9079	22.454	3	1760.8039	1760.8039	E	K	725	739
PSM	RYLPPQTVDHISQEHEGDLDLHTNDVD	1829	sp|Q9Y6D6|BIG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9578	23.047	4	3142.4592	3142.4592	L	K	247	274
PSM	RYGDGGSTFQSTTGHCVHM	1830	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	16-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=6052	18.521175622133335	3	2114.854405	2112.874172	H	R	275	294
PSM	KILEVHIDKGM	1831	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:35	ms_run[1]:scan=7438	20.433267043199997	3	1297.705696	1297.706408	K	K	206	217
PSM	KPGHIINPIKAEDVGY	1832	sp|Q9BVJ6|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9194	22.594290454133333	3	1750.949135	1749.941370	T	R	724	740
PSM	KSRPEFMLPVHFYG	1833	sp|P06737|PYGL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	7-UNIMOD:35	ms_run[1]:scan=10608	24.361802198400003	3	1722.8540	1722.8547	E	K	192	206
PSM	KLIHLEIKPAI	1834	sp|Q02750|MP2K1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10274	23.891421561066668	3	1273.811836	1273.812194	R	R	97	108
PSM	KYGEGHQAWIIGIVEKGN	1835	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=11577	26.079546911466664	3	1999.050468	1998.032310	P	R	344	362
PSM	KLKASNGDTPTHEDLT	1836	sp|P11171|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5056	17.183601065599998	3	1726.847181	1725.853343	Q	K	52	68
PSM	KGHVSSHDEQQVEAGAVQL	1837	sp|Q92667|AKAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7896	21.0093945872	4	2019.989264	2017.981731	K	R	30	49
PSM	RLYAHVYGNGQSEKPDENE	1838	sp|Q6P3X3|TTC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6882	19.662903418133332	3	2205.992672	2205.008674	W	K	713	732
PSM	KHQFNSNAVTDINLDNVCK	1839	sp|Q70CQ2|UBP34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	18-UNIMOD:4	ms_run[1]:scan=9602	23.0717331544	3	2217.067291	2216.064415	H	K	839	858
PSM	KMKEALLSIGK	1840	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35	ms_run[1]:scan=7345	20.3237969648	3	1232.715244	1232.716245	K	-	128	139
PSM	KMKEALLSIGK	1841	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35	ms_run[1]:scan=7362	20.343267992	3	1232.715244	1232.716245	K	-	128	139
PSM	KKPIPLENPKE	1842	sp|Q8WTT2|NOC3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5088	17.224796581866666	3	1291.749625	1291.749987	S	K	59	70
PSM	KKMEEVKEANI	1843	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35	ms_run[1]:scan=4531	16.43303089573333	2	1333.691357	1333.691152	N	R	441	452
PSM	KKPASGPGAVVRPP	1844	sp|Q9GZR2|REXO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5580	17.881627828533333	3	1359.799087	1359.798669	S	K	47	61
PSM	KKGPGLAVQSGDKT	1845	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4232	15.9759421976	3	1384.767079	1384.767428	Q	K	152	166
PSM	RKNPSIAVPIVLK	1846	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9716	23.191349269866667	3	1433.907585	1433.908219	L	R	685	698
PSM	KAKGEIPEVAFMK	1847	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9522	22.9796609488	3	1446.789646	1446.790472	L	-	607	620
PSM	KKEAPPMEKPEVV	1848	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6196	18.705853465333334	3	1480.795681	1480.795951	A	K	64	77
PSM	RKNPLPPSVGVVDK	1849	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6970	19.8061443848	3	1504.872016	1504.872562	D	K	78	92
PSM	KNQTAEKEEFEHQQ	1850	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4506	16.3989373688	3	1745.789060	1744.801642	D	K	583	597
PSM	RKAIVICPTDEDLKD	1851	sp|Q9BUJ2|HNRL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:4	ms_run[1]:scan=8131	21.28491564426667	3	1771.913643	1771.913835	Q	R	526	541
PSM	KKQNADPQAVTMPATETK	1852	sp|Q9UNF1|MAGD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5777	18.15174900586667	3	1956.994434	1956.993876	T	K	107	125
PSM	MREIVHIQAGQCGNQIGA	1853	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=8635	21.874324310400002	3	1996.977723	1996.957114	-	K	1	19
PSM	KNLTELEDEHLAK	1854	sp|O15381|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7865	20.973017856800002	2	1541.803573	1538.794037	L	R	73	86
PSM	KKLVESLPQEIKANVA	1855	sp|P52815|RM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9804	23.304967279733333	2	1766.030313	1766.030185	A	K	162	178
PSM	KKINELTGIKESDTGLAPPALWDLAAD	1856	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=12372	28.689860959999997	4	2865.516588	2865.512390	L	K	57	84
PSM	KAHTDFFEAFKNYDESGSP	1857	sp|P61201|CSN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11649	26.23	3	2188.9702	2188.9702	E	R	253	272
PSM	KAKVPLQTLHMTSENQE	1858	sp|Q6P158|DHX57_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=6259	18.793	3	1968.9939	1968.9939	P	K	93	110
PSM	KATVLNLHQHL	1859	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8224	21.396	3	1272.7303	1272.7303	L	K	4061	4072
PSM	KAYTDELVELHR	1860	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9066	22.438	3	1472.7623	1472.7623	D	R	493	505
PSM	KCDWLDGKHVVFG	1861	sp|O43447-2|PPIH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4	ms_run[2]:scan=10829	24.716	3	1559.7555	1559.7555	S	K	87	100
PSM	KCVDWHPTKGLVVSGS	1862	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4	ms_run[2]:scan=8895	22.214	3	1768.893	1768.8930	V	K	248	264
PSM	KDHYEATAMH	1863	sp|O75832-2|PSD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=3448	14.643	3	1217.5135	1217.5135	A	R	135	145
PSM	KDIIHDPGRGAPLA	1864	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7620	20.659	2	1458.7943	1458.7943	V	K	46	60
PSM	KEEVKLEAHI	1865	sp|O00425|IF2B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7532	20.551	3	1194.6608	1194.6608	P	R	483	493
PSM	KEKEQQLLHD	1866	sp|Q8TF01|PNISR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4963	17.052	2	1266.6568	1266.6568	R	K	429	439
PSM	KENGFTQHVYH	1867	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5749	18.12	3	1358.6367	1358.6367	L	K	804	815
PSM	KERELQNTVANLHV	1868	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9356	22.788	3	1649.8849	1649.8849	R	R	102	116
PSM	KEVQQHALIHQES	1869	sp|P17010-2|ZFX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4585	16.5	3	1545.79	1545.7900	T	K	389	402
PSM	KFICNDDFKH	1870	sp|Q13620-3|CUL4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:4	ms_run[2]:scan=6863	19.634	3	1322.6078	1322.6078	D	K	611	621
PSM	KFYEEVHDLER	1871	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8542	21.77	3	1463.7045	1463.7045	A	K	53	64
PSM	KGAVDGGLSIPHSTK	1872	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6982	19.821	3	1465.7889	1465.7889	L	R	164	179
PSM	KGIVKDIIHDPG	1873	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7837	20.946	3	1290.7296	1290.7296	I	R	42	54
PSM	KGSSWHETCFICH	1874	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8523	21.748	3	1647.6922	1647.6922	Y	R	118	131
PSM	KICLVNDPRPQH	1875	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=6782	19.508	3	1475.7667	1475.7667	D	K	267	279
PSM	KILHSYVPEEIRDGNQV	1876	sp|Q96CB9-4|NSUN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9124	22.507	3	1996.0378	1996.0378	Q	R	166	183
PSM	KILNEPLKHSDFFNV	1877	sp|Q9Y399|RT02_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11081	25.127	3	1799.957	1799.9570	D	K	61	76
PSM	KIPEEHDLESQIR	1878	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8250	21.424	3	1592.8158	1592.8158	M	K	815	828
PSM	KIRGIVEESVTGVH	1879	sp|O43865-2|SAHH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8219	21.39	3	1522.8467	1522.8467	K	R	200	214
PSM	KIYPSREEYEAHQD	1880	sp|Q06587-2|RING1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5548	17.836	3	1763.8115	1763.8115	S	R	80	94
PSM	KKDALLSALSIQNYHLECNET	1881	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	18-UNIMOD:4	ms_run[2]:scan=11853	26.722	4	2446.2162	2446.2162	R	K	934	955
PSM	KKDDALELQSHA	1882	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5981	18.429	3	1353.6888	1353.6888	C	K	1210	1222
PSM	KKITDGLHALQEASN	1883	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8764	22.042	3	1623.858	1623.8580	V	K	353	368
PSM	KKLPQVEHVLPLL	1884	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11346	25.596	3	1512.9392	1512.9392	D	K	436	449
PSM	KKLYVSNLGIGHT	1885	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8440	21.65	3	1428.8089	1428.8089	L	R	80	93
PSM	KKNAINTEMYHEIM	1886	sp|O75521-2|ECI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=6396	18.972	3	1752.8175	1752.8175	K	R	125	139
PSM	KKQDPPVTHDL	1887	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5192	17.36	3	1276.6776	1276.6776	R	R	58	69
PSM	KLAPTHWPPEK	1888	sp|Q9H488|OFUT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7776	20.849	2	1302.7085	1302.7085	E	R	111	122
PSM	KLHAVVETLVNH	1889	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8619	21.858	3	1358.767	1358.7670	R	R	260	272
PSM	KLLGPKNSEGLHSA	1890	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5685	18.045	2	1449.794	1449.7940	K	R	171	185
PSM	KMLTNHTFIK	1891	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=5879	18.292	3	1247.6696	1247.6696	L	R	361	371
PSM	KNGSLTNHFSFEK	1892	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8269	21.446	3	1507.7419	1507.7419	L	K	793	806
PSM	KNIFPYHEVTVK	1893	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8876	22.189	3	1473.798	1473.7980	K	R	1286	1298
PSM	KNMMAACDPRHG	1894	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=3570	14.776	3	1402.5904	1402.5904	A	R	297	309
PSM	KPHLGHVPDYLVPPAL	1895	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11477	25.875	3	1751.9723	1751.9723	V	R	446	462
PSM	KPKIDQLEGDHQLIQEALIFDN	1896	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12239	28.082	4	2563.3282	2563.3282	Y	K	682	704
PSM	KQDTHGVGHDPA	1897	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3485	14.684	3	1260.5847	1260.5847	L	K	46	58
PSM	KQLEIAHEKL	1898	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7455	20.454	3	1207.6925	1207.6925	Q	R	296	306
PSM	KQLQGHVVDGH	1899	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3793	15.043	3	1216.6313	1216.6313	L	K	792	803
PSM	KQPMFYHLGHFS	1900	sp|P04062-4|GLCM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=9445	22.897	3	1506.7078	1506.7078	Y	K	365	377
PSM	KTKEGVVHGVATVAE	1901	sp|P37840-2|SYUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5758	18.129	3	1523.8308	1523.8308	S	K	43	58
PSM	KTKSQYHDLQAPDNQQT	1902	sp|Q9H788-2|SH24A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5161	17.325	3	2000.9552	2000.9552	L	K	81	98
PSM	KVCEALEHGHVEWSS	1903	sp|Q8N543|OGFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=8451	21.66	3	1766.8046	1766.8046	T	R	306	321
PSM	KVIDHTPVEKL	1904	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7157	20.075	3	1277.7343	1277.7343	G	K	889	900
PSM	KVKDLVLSVHN	1905	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7846	20.955	3	1250.7347	1250.7347	L	R	359	370
PSM	KVSVHVIEGDH	1906	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5826	18.22	3	1218.6357	1218.6357	G	R	2471	2482
PSM	KYKETDLLILF	1907	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12595	29.718	2	1381.7857	1381.7857	Q	K	174	185
PSM	KYWDLMNLSEKHD	1908	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=9979	23.499	3	1693.777	1693.7770	Q	K	299	312
PSM	RAGEEHYNCISALH	1909	sp|Q96S55-4|WRIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=7148	20.064	3	1655.7474	1655.7474	D	K	110	124
PSM	RALELDHKNAQAQQEF	1910	sp|Q99615-2|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8017	21.155	3	1896.9442	1896.9442	Q	K	65	81
PSM	RASGNYATVISHNPETK	1911	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6433	19.019	3	1843.9177	1843.9177	A	K	128	145
PSM	RASHTAPQVLFSH	1912	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7821	20.928	3	1449.7477	1449.7477	R	R	190	203
PSM	RCTVDGSPHELESR	1913	sp|Q9NRL3|STRN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4	ms_run[2]:scan=5156	17.319	3	1641.7529	1641.7529	R	R	336	350
PSM	RDGWPAMGIHGDKSQQE	1914	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=6445	19.034	4	1926.8643	1926.8643	R	R	284	301
PSM	RDHPLPEVAHV	1915	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7502	20.513	2	1268.6626	1268.6626	R	K	42	53
PSM	REELDVKHALSYNQ	1916	sp|Q96SB8|SMC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8688	21.946	3	1700.8482	1700.8482	K	R	450	464
PSM	REHPWEVMPDLYFY	1917	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=12348	28.575	3	1896.8505	1896.8505	S	R	191	205
PSM	RERFCENTQAGEG	1918	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4	ms_run[2]:scan=4787	16.784	2	1552.6689	1552.6689	D	R	320	333
PSM	RFKDIFQEIYD	1919	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12168	27.775	2	1472.73	1472.7300	G	K	222	233
PSM	RFLWSLPACDHLH	1920	sp|Q15475|SIX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=11671	26.282	3	1650.8089	1650.8089	G	K	32	45
PSM	RFRDAAEELNASS	1921	sp|Q96D09|GASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7643	20.687	2	1464.6957	1464.6957	D	R	474	487
PSM	RFYTLIPHDFGMK	1922	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:35	ms_run[2]:scan=10806	24.684	3	1639.8181	1639.8181	N	K	735	748
PSM	RGHLLYVALSPGQH	1923	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9515	22.972	3	1546.8368	1546.8368	G	R	848	862
PSM	RHLVEENCEAVPH	1924	sp|Q9NVM4-4|ANM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=5897	18.318	3	1588.7416	1588.7416	H	R	164	177
PSM	RIDDLIKLHPES	1925	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10177	23.75	3	1434.7831	1434.7831	L	K	526	538
PSM	RIHNQNNEQAW	1926	sp|P53701|CCHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6104	18.586	2	1408.6596	1408.6596	I	K	152	163
PSM	RIRVDVADQAQD	1927	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6874	19.65	2	1384.7059	1384.7059	R	K	126	138
PSM	RKFFYSDQNVDS	1928	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8395	21.597	2	1504.6947	1504.6947	R	R	195	207
PSM	RKGFNEGLWEIENNPGV	1929	sp|Q9Y3E1|HDGR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11676	26.291	3	1957.9646	1957.9646	K	K	78	95
PSM	RLIILDEIHLLHDD	1930	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12482	29.226	3	1713.9414	1713.9414	V	R	610	624
PSM	RLLLETHLPSK	1931	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8926	22.261	3	1305.7769	1305.7769	L	K	77	88
PSM	RMEELHNQEVQK	1932	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=3667	14.891	3	1555.7413	1555.7413	R	R	325	337
PSM	RMPLHTIIPLLQELTK	1933	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=12488	29.258	3	1918.1074	1918.1074	L	R	496	512
PSM	RNKEVTWEVLEGEVE	1934	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11706	26.362	3	1815.9003	1815.9003	L	K	297	312
PSM	RNRGPPPSWG	1935	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6046	18.514	2	1122.5683	1122.5683	S	R	88	98
PSM	RPEDELEHLTK	1936	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8140	21.297	3	1365.6888	1365.6888	F	K	388	399
PSM	RPRNEEDAAELVALAQAVNA	1937	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12333	28.504	3	2136.0923	2136.0923	P	R	308	328
PSM	RPVVFTHLLTADHGPP	1938	sp|Q6P1X6-2|CH082_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10582	24.322	3	1755.942	1755.9420	D	R	102	118
PSM	RQELMQVHGEK	1939	sp|Q08378-2|GOGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=3746	14.982	3	1369.6772	1369.6772	L	R	884	895
PSM	RQLYVLGHEAMK	1940	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8369	21.566	4	1443.7657	1443.7657	S	R	17	29
PSM	RQQELTHQEH	1941	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3450	14.645	3	1304.6222	1304.6222	E	R	178	188
PSM	RRAADALEEQQ	1942	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4814	16.829	2	1285.6375	1285.6375	K	R	723	734
PSM	RRDPVALEDVYPIHMILEN	1943	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:35	ms_run[2]:scan=11999	27.17	3	2295.1682	2295.1682	S	K	88	107
PSM	RRILVATNLFG	1944	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11321	25.55	2	1258.751	1258.7510	Q	R	338	349
PSM	RRLVSDGNINSD	1945	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5532	17.815	2	1344.6746	1344.6746	G	R	1220	1232
PSM	RRPDQQLQGEG	1946	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4307	16.134	2	1282.6378	1282.6378	G	K	111	122
PSM	RRQVDQLTND	1947	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4890	16.933	2	1243.6269	1243.6269	L	K	158	168
PSM	RRSAVPPGAD	1948	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3711	14.942	2	1024.5414	1024.5414	Y	K	128	138
PSM	RSFVPEEEKHEE	1949	sp|O94880-2|PHF14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5620	17.952	3	1514.7001	1514.7001	K	R	549	561
PSM	RVAPEEHPVLLTEAPLNPKAN	1950	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9795	23.296	4	2294.2383	2294.2383	L	R	95	116
PSM	RVGTPHFMAPEVVK	1951	sp|O14936-3|CSKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=8467	21.679	3	1582.829	1582.8290	G	R	179	193
PSM	RWKALDEME	1952	sp|Q8WXF1-2|PSPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=7596	20.631	2	1192.5547	1192.5547	S	K	278	287
PSM	RWKSLDEME	1953	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=6955	19.78	2	1208.5496	1208.5496	Q	K	493	502
PSM	RYLGQPSPFTHPHLL	1954	sp|Q9NQH7-3|XPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10426	24.102	4	1761.9315	1761.9315	N	R	44	59
PSM	RVAPEEHPVLLTEAPLNPKAN	1955	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=13305	32.37005095013333	3	2296.261495	2294.238280	L	R	95	116
PSM	KEKVWAHYEEQPVEEVMPVLEE	1956	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	17-UNIMOD:35	ms_run[1]:scan=10691	24.49855082186667	3	2714.323133	2713.294535	K	K	654	676
PSM	KLFIIRGSPQQIDHA	1957	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9451	22.90279879466667	3	1722.975951	1721.957689	F	K	473	488
PSM	RGKITDLANLSAANHDAAIFPGGFGAA	1958	sp|P0DPI2|GAL3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=12104	27.53365201946667	4	2654.356982	2654.356498	A	K	114	141
PSM	KILEVHIDKGM	1959	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:35	ms_run[1]:scan=7429	20.425765226933333	3	1297.705696	1297.706408	K	K	206	217
PSM	KAYHPGCFTCVVCH	1960	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8129	21.282986502933333	3	1734.739765	1734.742887	G	R	356	370
PSM	KHNNCMASHLTPAVYA	1961	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4,6-UNIMOD:35	ms_run[1]:scan=7024	19.886208202133332	3	1829.840388	1828.834873	R	R	58	74
PSM	RIPEKVFQASPEDHE	1962	sp|Q8TCC3|RM30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7704	20.7654524848	3	1780.869286	1780.874413	S	K	40	55
PSM	KYLANIEQQHGNSGRNSESESN	1963	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5782	18.1596655584	4	2462.124653	2461.121807	E	K	192	214
PSM	KAHQLEEDIVSVTH	1964	sp|Q86VP1|TAXB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9046	22.417156234133333	3	1606.798096	1604.815835	S	K	230	244
PSM	KGHASAPYFGKEEPSVAPSSTG	1965	sp|Q8N183|NDUF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7784	20.8589330496	3	2204.053143	2203.054562	I	K	130	152
PSM	KVMALELGPHKI	1966	sp|Q7Z4W1|DCXR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:35	ms_run[1]:scan=8666	21.916721961066667	3	1351.773897	1350.769343	T	R	161	173
PSM	KKLYVSNLGIGHT	1967	sp|Q06203|PUR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8431	21.639188337866663	3	1428.808677	1428.808899	L	R	80	93
PSM	RLEAVSHTSDMH	1968	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4685	16.631996246666667	3	1381.640287	1381.640847	G	R	17	29
PSM	RTFSEPGDHPGMLTSGK	1969	sp|Q9HA47|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:35	ms_run[1]:scan=6211	18.731440764800002	3	1831.853901	1831.852297	K	R	250	267
PSM	KMAVSWHHDENLVD	1970	sp|Q9C0B1|FTO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:35	ms_run[1]:scan=7851	20.959288762666667	3	1695.766764	1695.767505	G	R	225	239
PSM	RKGPELPLVPVK	1971	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8994	22.354208980800003	3	1331.828957	1331.828906	K	R	7	19
PSM	KKAVAFSPVTELK	1972	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8544	21.771881327466666	3	1416.834855	1416.834051	K	K	714	727
PSM	KKLVSIVADQLEKN	1973	sp|O15294|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9852	23.360135527733334	3	1583.929637	1583.924657	M	R	487	501
PSM	KKATDAEADVASLNR	1974	sp|P09493|TPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6652	19.3184889576	3	1587.826568	1587.821649	E	R	76	91
PSM	KKQIEELKGQEVSP	1975	sp|P09936|UCHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6005	18.4566261128	3	1611.884165	1611.883186	R	K	64	78
PSM	KKELEEEVNNFQK	1976	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7355	20.334413506666667	3	1633.831547	1633.831151	K	K	385	398
PSM	KKPIYINVIRDPIE	1977	sp|Q7LGA3|HS2ST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10368	24.023447657866665	3	1696.987548	1696.987592	K	R	155	169
PSM	KKSLDQDPVVRAQEI	1978	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8002	21.139706188533335	3	1724.943987	1724.942098	A	K	771	786
PSM	KKLDGTPVIKGDEEEDN	1979	sp|Q4LDG9|DNAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5778	18.1533445816	3	1885.927523	1885.926902	L	-	174	191
PSM	KKETLEQLSEFNDSLK	1980	sp|Q8WZA0|LZIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10207	23.79613270933333	3	1907.986844	1907.984023	T	K	46	62
PSM	KKFMGTELNGKTLGILGLG	1981	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:35	ms_run[1]:scan=11839	26.691188763466666	3	1993.091788	1992.107784	R	R	136	155
PSM	KKLQEEIVNSVKGCGNCSC	1982	sp|O75027|ABCB7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=8502	21.7236356928	3	2209.029285	2209.028958	R	-	734	753
PSM	KEKFEAGQFEPSETTAKS	1983	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7469	20.47206475413333	3	2014.973277	2012.969101	F	-	108	126
PSM	KAGHPPAVKAGGM	1984	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=3481	14.68	3	1235.6445	1235.6445	T	R	12	25
PSM	KALSDHHVYLEGTLL	1985	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10709	24.528	3	1694.8992	1694.8992	Y	K	215	230
PSM	KALWEALLNTKH	1986	sp|Q8WU76|SCFD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11834	26.678	3	1422.7983	1422.7983	A	K	341	353
PSM	KATPEKSLHD	1987	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3543	14.748	3	1124.5826	1124.5826	S	K	1424	1434
PSM	KDGVVEITGKHEE	1988	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5337	17.546	3	1439.7256	1439.7256	T	R	114	127
PSM	KDIHEELPK	1989	sp|Q9BVP2-2|GNL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5201	17.371	2	1107.5924	1107.5924	E	R	455	464
PSM	KDVKHMNSAGVLATL	1990	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=8976	22.333	2	1598.845	1598.8450	H	R	219	234
PSM	KEDLQLWCHK	1991	sp|Q6UWP7-3|LCLT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:4	ms_run[2]:scan=8602	21.837	3	1355.6656	1355.6656	S	R	259	269
PSM	KEKNDIHLDADDPNSAD	1992	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6015	18.475	3	1895.8497	1895.8497	R	K	683	700
PSM	KELHINLIPNKQD	1993	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9101	22.48	3	1560.8624	1560.8624	G	R	74	87
PSM	KELSVIRDHAGSACL	1994	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=8474	21.688	3	1654.8461	1654.8461	L	R	754	769
PSM	KENHTESTVNSLPH	1995	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5519	17.8	3	1591.759	1591.7590	D	-	326	340
PSM	KERGLGGEVPGSHQGPDPY	1996	sp|Q6UW68|TM205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7617	20.657	3	1978.9497	1978.9497	E	R	122	141
PSM	KFQDTDGKHLLP	1997	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8303	21.485	3	1397.7303	1397.7303	L	K	228	240
PSM	KGNTFVHDPKVAQETDV	1998	sp|Q92878|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7611	20.649	3	1883.9377	1883.9377	T	R	62	79
PSM	KGNTLLLQHLK	1999	sp|Q7Z7E8|UB2Q1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8452	21.661	3	1263.7663	1263.7663	K	R	140	151
PSM	KGTINFLHADCDKF	2000	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=10260	23.871	4	1664.7981	1664.7981	E	R	291	305
PSM	KHADIVTTTTH	2001	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3990	15.425	3	1222.6306	1222.6306	F	K	248	259
PSM	KHLNEIDLFHCIDPNDS	2002	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=11836	26.684	3	2065.9527	2065.9527	F	K	48	65
PSM	KHTEMITTLK	2003	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=4703	16.659	3	1216.6486	1216.6486	Q	K	392	402
PSM	KIDEHHFVAVAL	2004	sp|Q9NRN7|ADPPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10244	23.856	3	1377.7405	1377.7405	S	R	234	246
PSM	KIDPEKLSVNSHFM	2005	sp|O14561|ACPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10171	23.743	4	1643.8341	1643.8341	D	K	92	106
PSM	KIHLQQQQQQLLQEETLPRGS	2006	sp|Q9UGP4|LIMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9683	23.155	4	2501.335	2501.3350	A	R	54	75
PSM	KIKSPEDHIGAVLE	2007	sp|Q13823|NOG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8574	21.807	3	1534.8355	1534.8355	E	R	386	400
PSM	KILEVHVDKGM	2008	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=6383	18.958	3	1283.6908	1283.6908	V	K	215	226
PSM	KKASQTLPQATMNH	2009	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=4082	15.611	3	1569.7933	1569.7933	A	R	191	205
PSM	KKLPEEEAECYFHS	2010	sp|Q9NVS9-3|PNPO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=9174	22.569	3	1765.7981	1765.7981	V	R	129	143
PSM	KKPMVLGHEASGTVE	2011	sp|Q00796|DHSO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=5252	17.436	3	1597.8134	1597.8134	V	K	63	78
PSM	KKQGEGVPDLVHVM	2012	sp|P35813|PPM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:35	ms_run[2]:scan=8422	21.63	3	1551.8079	1551.8079	I	R	321	335
PSM	KKTCAYTNHTVLPEALE	2013	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=9128	22.511	3	1973.9881	1973.9881	T	R	370	387
PSM	KKVDLVVHPSMDQNDPLV	2014	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10212	23.808	3	2033.0616	2033.0616	K	R	686	704
PSM	KKVTHAVVTVPAYFNDAQ	2015	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9664	23.136	3	1987.0527	1987.0527	G	R	163	181
PSM	KLHTDDELNWLDHG	2016	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10785	24.649	3	1691.7903	1691.7903	Q	R	164	178
PSM	KLKEDLEIEH	2017	sp|Q99996-5|AKAP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6891	19.678	3	1252.6663	1252.6663	S	R	651	661
PSM	KLKGEMMDLQHGSLFLQTP	2018	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11754	26.475	3	2172.1071	2172.1071	D	K	58	77
PSM	KLQHFQELGEEKDN	2019	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7081	19.967	3	1713.8322	1713.8322	Q	R	1565	1579
PSM	KLSAKEDSIHILNEEYET	2020	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9987	23.509	3	2118.0481	2118.0481	Q	K	930	948
PSM	KLTQVLNTHYVAPR	2021	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8503	21.725	3	1638.9206	1638.9206	C	R	862	876
PSM	KMIASDSHRPEV	2022	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=4454	16.321	3	1384.6769	1384.6769	I	K	534	546
PSM	KNCPHIVVGTPGRILALA	2023	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=11231	25.393	3	1915.0826	1915.0826	K	R	163	181
PSM	KNGDECAYHHPISPC	2024	sp|Q6PJT7-8|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5397	17.633	3	1783.7406	1783.7406	C	K	154	169
PSM	KNPSDPKLAHL	2025	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6280	18.823	3	1218.6721	1218.6721	R	K	513	524
PSM	KPEVVKTHL	2026	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5180	17.346	2	1049.6233	1049.6233	E	R	72	81
PSM	KQLLHLAEEKQT	2027	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6895	19.683	2	1436.7987	1436.7987	K	K	681	693
PSM	KSEDCFILDHGKDG	2028	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=8023	21.163	3	1619.725	1619.7250	L	K	276	290
PSM	KSIEAVHEDIRVLSEDAI	2029	sp|P23919-2|KTHY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11329	25.562	4	2023.0586	2023.0586	S	R	158	176
PSM	KSLEEKNESLTEHP	2030	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5504	17.781	3	1639.8053	1639.8053	E	R	364	378
PSM	KTDPSVRPMHE	2031	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=3502	14.701	3	1311.6241	1311.6241	Q	R	217	228
PSM	KTFVHVVPAKPEGTF	2032	sp|Q9P0M9|RM27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8939	22.28	2	1655.9035	1655.9035	Y	K	128	143
PSM	KTKSMQEVHI	2033	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=4796	16.796	2	1215.6282	1215.6282	G	K	462	472
PSM	KTLHPAVHAGILA	2034	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7692	20.753	3	1326.7772	1326.7772	V	R	65	78
PSM	KTMAQHEELMK	2035	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3515	14.718	3	1376.6428	1376.6428	A	K	1254	1265
PSM	KTYHALSNLPKA	2036	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7330	20.309	3	1341.7405	1341.7405	S	R	175	187
PSM	KVMELLVHLNK	2037	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=8712	21.977	3	1338.7693	1338.7693	K	R	57	68
PSM	KYEEGINIHLAK	2038	sp|Q12996|CSTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8385	21.587	3	1413.7616	1413.7616	N	K	192	204
PSM	RADHGLIPDVKLE	2039	sp|Q8N371|KDM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10336	23.97	3	1461.794	1461.7940	A	K	169	182
PSM	RADHPPAEVTSHAASGA	2040	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4574	16.482	3	1672.7917	1672.7917	H	K	100	117
PSM	RAGKEESGVSVSNSQPTNESHSI	2041	sp|Q99808|S29A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5841	18.236	3	2399.1313	2399.1313	P	K	260	283
PSM	RAHSSMVGVNLPQKAGGFLM	2042	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11248	25.433	4	2099.0768	2099.0768	H	K	143	163
PSM	RARFEELNADLF	2043	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11728	26.42	3	1479.747	1479.7470	T	R	299	311
PSM	RAVSTHQITQLEGDR	2044	sp|Q9UNK0|STX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7300	20.274	3	1709.8809	1709.8809	L	R	64	79
PSM	RDGFIDKEDLHDMLASLG	2045	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12518	29.403	4	2030.9731	2030.9731	N	K	44	62
PSM	RDIKAANVLLSEHGEV	2046	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9536	22.996	3	1749.9373	1749.9373	H	K	143	159
PSM	RDKGNFYEASDWF	2047	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12158	27.737	3	1633.7161	1633.7161	A	K	542	555
PSM	RDLPEFGTQGGVHVH	2048	sp|O75191|XYLB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8775	22.056	3	1647.8118	1647.8118	D	K	41	56
PSM	REKNWEAMEALASTE	2049	sp|Q86UP2-3|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10928	24.856	3	1763.8148	1763.8148	L	K	1010	1025
PSM	RERICSEEE	2050	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=3888	15.241	2	1206.5299	1206.5299	L	R	108	117
PSM	RETNLDSLPLVDTHSK	2051	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9509	22.967	3	1823.9377	1823.9377	L	R	424	440
PSM	RFHDNFGFDDLV	2052	sp|O00165-5|HAX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12198	27.897	3	1480.6735	1480.6735	I	R	26	38
PSM	RFHMDSETHDPIDLQT	2053	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=8492	21.713	3	1956.8636	1956.8636	V	K	638	654
PSM	RFIIDEELFGQTHQHEL	2054	sp|P46934-3|NEDD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11965	27.055	3	2111.0436	2111.0436	L	K	1046	1063
PSM	RGGKNSTWSGES	2055	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4284	16.112	2	1264.5796	1264.5796	Y	K	474	486
PSM	RGHPQQDYLIIDDHA	2056	sp|Q5VYS8-5|TUT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9271	22.69	3	1776.8543	1776.8543	R	K	26	41
PSM	RHEEQPAPGYDTHG	2057	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4061	15.574	3	1592.6968	1592.6968	L	R	1076	1090
PSM	RHGESAWNLEN	2058	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8098	21.249	2	1311.5956	1311.5956	I	R	10	21
PSM	RHQGVMVGMGQ	2059	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3871	15.196	2	1230.5598	1230.5598	P	K	39	50
PSM	RHQGVMVGMGQKDSYVGDEAQS	2060	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7882	20.993	4	2378.0743	2378.0743	P	K	39	61
PSM	RHYGGLTGLN	2061	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7581	20.612	2	1086.557	1086.5570	E	K	90	100
PSM	RILTMDGLIEDIKH	2062	sp|P82921|RT21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11979	27.108	3	1652.892	1652.8920	N	R	28	42
PSM	RIMRPDDANVAGNVHGGTIL	2063	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=9006	22.367	3	2121.0749	2121.0749	C	K	16	36
PSM	RIPYKDTFW	2064	sp|Q13418-3|ILK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10983	24.955	2	1224.6291	1224.6291	N	K	27	36
PSM	RIRDPNQGG	2065	sp|O43432-4|IF4G3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3528	14.732	2	1011.521	1011.5210	I	K	143	152
PSM	RISHLVLPVQPENALK	2066	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10296	23.922	3	1813.0574	1813.0574	S	R	359	375
PSM	RISLVTKDPPH	2067	sp|Q04206-2|TF65_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6406	18.982	3	1261.7143	1261.7143	V	R	60	71
PSM	RISSLTASLHAHS	2068	sp|Q9UGY1|NOL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7642	20.686	2	1378.7317	1378.7317	Q	R	160	173
PSM	RITHQIVDRPGQQTSVIG	2069	sp|O00541-2|PESC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7518	20.532	3	2004.0865	2004.0865	S	R	367	385
PSM	RKGFNEGLWEIDNNP	2070	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11211	25.348	3	1787.8591	1787.8591	K	K	74	89
PSM	RKLEELIQGAQCVHSP	2071	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4	ms_run[2]:scan=9657	23.129	3	1863.9625	1863.9625	A	R	1003	1019
PSM	RKSNFSNSADDI	2072	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6468	19.063	2	1352.6321	1352.6321	K	K	90	102
PSM	RKYYFNNPEDGFF	2073	sp|Q9P0I2-2|EMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11777	26.533	3	1695.7682	1695.7682	T	K	76	89
PSM	RLEAVSHTSDMH	2074	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=3763	14.999	3	1397.6358	1397.6358	G	R	17	29
PSM	RLEHSSFPEGPGPGSGDEANGPRGE	2075	sp|O15020-2|SPTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7502	20.513	4	2535.1375	2535.1375	Q	R	2157	2182
PSM	RLFTVQIPHK	2076	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9518	22.976	3	1237.7295	1237.7295	L	R	263	273
PSM	RLGAMDIDTHK	2077	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=4845	16.87	3	1271.6292	1271.6292	E	K	441	452
PSM	RLPPASVDHVLQEH	2078	sp|Q6ZRI6-2|CO039_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8356	21.55	3	1596.8372	1596.8372	P	R	856	870
PSM	RLQAHEAAHAAAGPGEVLA	2079	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7225	20.171	3	1867.9653	1867.9653	A	K	681	700
PSM	RLTGKPGQVLPHPELCTV	2080	sp|Q6GMV2|SMYD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:4	ms_run[2]:scan=9600	23.07	3	2001.083	2001.0830	Q	R	86	104
PSM	RNIVEKHTDTDVLEACS	2081	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:4	ms_run[2]:scan=7550	20.574	3	1985.9477	1985.9477	I	K	617	634
PSM	RNKGQDLLALIVAQH	2082	sp|Q86WJ1-5|CHD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12133	27.646	3	1674.9529	1674.9529	S	R	510	525
PSM	RPGAPETTALHGGFQR	2083	sp|Q7Z3C6-2|ATG9A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7149	20.065	3	1693.8649	1693.8649	P	R	707	723
PSM	RQLFHPEQLITGKEDAANNYA	2084	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10533	24.246	4	2414.1979	2414.1979	Y	R	49	70
PSM	RQLIIRDILQDVHD	2085	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11937	26.966	3	1732.9584	1732.9584	D	K	1307	1321
PSM	RQLLYDAIKHQ	2086	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8462	21.674	3	1383.7623	1383.7623	G	K	751	762
PSM	RQPGHAEHLEFPSCSFQP	2087	sp|P17482|HXB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=10150	23.719	4	2122.9643	2122.9643	S	K	37	55
PSM	RRDDGLSAAA	2088	sp|P84101-4|SERF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4614	16.548	2	1030.5156	1030.5156	K	R	12	22
PSM	RRFELYFQGPSSN	2089	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10886	24.8	3	1599.7794	1599.7794	M	K	132	145
PSM	RRLPLNFLSGE	2090	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11491	25.909	2	1300.7252	1300.7252	P	K	294	305
PSM	RRLTLEDLEDSWD	2091	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12247	28.114	2	1646.79	1646.7900	N	R	1401	1414
PSM	RRVLQALEGL	2092	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10883	24.798	2	1153.6931	1153.6931	A	K	101	111
PSM	RSAGLPSHSSVISQHS	2093	sp|P82909|RT36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5722	18.086	3	1648.8281	1648.8281	L	K	41	57
PSM	RVDPDSQNHEKQESQDL	2094	sp|Q9BXS6-4|NUSAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4850	16.877	3	2023.9195	2023.9195	V	R	96	113
PSM	RVTAIHIDPATH	2095	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7055	19.929	3	1329.7153	1329.7153	T	R	1051	1063
PSM	RYTIYSPKDGQPCMDHD	2096	sp|Q9P2J5-2|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=7007	19.856	3	2097.8884	2097.8884	K	R	182	199
PSM	KHLEINPDHPIVETL	2097	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10728	24.562221361333332	3	1755.940432	1753.936285	K	R	624	639
PSM	RDTSFEQHVLWHTGG	2098	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9870	23.3795272968	3	1768.838827	1768.828131	S	K	1724	1739
PSM	RGRGGPPGQFHDNANGGQNGTVQEIMIPAG	2099	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	26-UNIMOD:35	ms_run[1]:scan=9517	22.974117067199998	4	3047.416938	3047.438013	S	K	214	244
PSM	KHLNEIDLFHCIDPNDS	2100	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:4	ms_run[1]:scan=12008	27.20267678453333	3	2066.938532	2065.952740	F	K	48	65
PSM	KHMPPNLQKVDLF	2101	sp|Q9BRT9|SLD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:35	ms_run[1]:scan=9852	23.360135527733334	3	1581.846776	1581.833734	L	R	147	160
PSM	KQIYYSDKYFDEHYEY	2102	sp|P33552|CKS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10281	23.902838260800003	3	2189.959388	2189.958202	H	R	4	20
PSM	KVQQLLHICSEHFDS	2103	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=9779	23.2750255432	3	1839.893279	1839.893768	L	K	608	623
PSM	RVNEVDVRDVTHS	2104	sp|Q12959|DLG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6725	19.426982158133335	3	1524.763417	1524.764468	L	K	278	291
PSM	KHLTEEKPDGLINEAT	2105	sp|Q9BRT8|CBWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7769	20.84122324533333	3	1794.916843	1793.915943	L	R	176	192
PSM	RSTHEFLHEVPAASEEIF	2106	sp|Q9H269|VPS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11208	25.342805872	3	2099.004568	2098.011969	S	K	321	339
PSM	KPHTVPCKVTG	2107	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=3804	15.059450351733334	2	1222.651730	1222.649228	G	R	176	187
PSM	RQNHEEIMDAKPELLAFQ	2108	sp|Q9Y4K3|TRAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35	ms_run[1]:scan=10412	24.083899349333333	4	2184.061533	2184.063353	V	R	443	461
PSM	RGMPNHIHMGAGPPPQFN	2109	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6129	18.621391371199998	3	1988.912982	1988.909770	L	R	490	508
PSM	RHQPGLLLQQKPPDDPVV	2110	sp|Q5VWN6|TASO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9739	23.2168843392	3	2038.106521	2036.116709	F	K	699	717
PSM	KAKVPLQTLHMTSENQE	2111	sp|Q6P158|DHX57_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:35	ms_run[1]:scan=6268	18.8053048736	3	1968.997122	1968.993876	P	K	93	110
PSM	KNVNAGGHKLGLGLEFQA	2112	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10215	23.81125323306667	3	1852.994964	1851.995531	G	-	266	284
PSM	RDVACGANHTLVLDSQK	2113	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	5-UNIMOD:4	ms_run[1]:scan=7037	19.903239345866666	3	1883.9332	1882.9312	V	R	333	350
PSM	KAVTKYTSAK	2114	sp|P06899|H2B1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3469	14.665952927466666	3	1095.628635	1095.628809	T	-	117	127
PSM	KAVTKYTSSK	2115	sp|Q96A08|H2B1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3416	14.599653452533333	3	1111.623770	1111.623724	T	-	118	128
PSM	KKQPALDVLYDVMKS	2116	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11996	27.160539623200002	3	1733.939055	1733.938593	G	K	23	38
PSM	KKIEQELTAAK	2117	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5265	17.453967886933334	3	1257.729146	1257.729252	E	K	45	56
PSM	KSITHSTVGSKGE	2118	sp|Q9H9B1|EHMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3470	14.668244852533332	3	1329.678738	1329.688844	F	K	317	330
PSM	KKEVPAVPETLK	2119	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6692	19.379630323733334	3	1337.790587	1337.791852	K	K	8	20
PSM	KAKGEIPEVAFMK	2120	sp|Q9UBU9|NXF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:35	ms_run[1]:scan=8110	21.263809820800002	3	1462.784434	1462.785387	L	-	607	620
PSM	RYSQPLHEEIALH	2121	sp|Q6ZN16|M3K15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8250	21.424044380533335	3	1592.815358	1591.810690	S	K	689	702
PSM	RKIPGYDPEPVEKL	2122	sp|Q5C9Z4|NOM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8815	22.114466699466668	3	1639.896477	1639.893357	M	R	561	575
PSM	KKALAAAGYDVEKNNS	2123	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5736	18.104109413333333	3	1678.852648	1677.868599	L	R	66	82
PSM	KKMVDPEKPQLGMID	2124	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:35	ms_run[1]:scan=8289	21.467812307466666	3	1743.889854	1743.889928	S	R	141	156
PSM	KKGLDPYNVLAPKGASGT	2125	sp|P10606|COX5B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9165	22.558228117333332	3	1814.989954	1814.989048	A	R	56	74
PSM	KITSVAWSPHHDG	2126	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7094	19.982813759733332	3	1435.712657	1433.705162	A	R	641	654
PSM	RKPYPDDENLVEVKFA	2127	sp|A6NEC2|PSAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10475	24.166538583466668	3	1918.980255	1918.978878	D	R	221	237
PSM	RKLETNPDIKPSNVEPME	2128	sp|Q9BVP2|GNL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	17-UNIMOD:35	ms_run[1]:scan=6984	19.8223047464	3	2112.052318	2112.052119	K	K	90	108
PSM	KKYVSVCEGPLKEQEWNTTNA	2129	sp|A6NDU8|CE051_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=9233	22.6427444904	3	2480.164895	2480.200575	L	K	262	283
PSM	KKQAQILASEAEKAEQINQAAGEASAVLA	2130	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11721	26.4026800144	4	2966.570062	2966.567279	G	K	221	250
PSM	KACLSCHQQIH	2131	sp|Q9NQZ6-3|ZC4H2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4078	15.6	3	1380.6391	1380.6391	M	R	164	175
PSM	KAGEVFIHKD	2132	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5191	17.359	2	1142.6084	1142.6084	G	K	99	109
PSM	KASIHEAWTDGKEAML	2133	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9677	23.148	3	1785.872	1785.8720	Q	K	202	218
PSM	KDKMMNGGHYTYSEN	2134	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=3961	15.362	3	1805.7349	1805.7349	A	R	130	145
PSM	KDQMSHLFNVAHTL	2135	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=9806	23.307	3	1655.809	1655.8090	T	R	1934	1948
PSM	KEDAEHHPDEDVDESES	2136	sp|Q9BZJ0-2|CRNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3874	15.206	3	1966.7664	1966.7664	E	-	671	688
PSM	KEDTEEHHL	2137	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3720	14.95	3	1136.5098	1136.5098	I	R	108	117
PSM	KEHPYDAAKDSIL	2138	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8145	21.303	3	1485.7464	1485.7464	S	R	94	107
PSM	KEMGGHHIVALCVL	2139	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9936	23.445	3	1578.8011	1578.8011	M	K	55	69
PSM	KFLPSELRDEH	2140	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8046	21.189	3	1369.699	1369.6990	Y	-	2531	2542
PSM	KGHTDSVQDISFDHSG	2141	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7739	20.806	3	1728.7703	1728.7703	L	K	147	163
PSM	KGIKSEPHSPGIPEIF	2142	sp|Q8ND82|Z280C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10617	24.373	3	1734.9305	1734.9305	S	R	72	88
PSM	KGISPVVSEHR	2143	sp|Q99700-2|ATX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4945	17.015	3	1207.6673	1207.6673	N	K	781	792
PSM	KGPSHSGNPSHGTLGLSGTLG	2144	sp|Q86XN7-2|PRSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8045	21.189	3	1959.9763	1959.9763	F	R	598	619
PSM	KHAAYAWPFY	2145	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11857	26.732	2	1252.6029	1252.6029	K	K	368	378
PSM	KHFVGMLPEKDC	2146	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:4	ms_run[2]:scan=7885	20.997	3	1459.6952	1459.6952	F	R	52	64
PSM	KHGTCAAQVDALNSQK	2147	sp|O00584|RNT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=5056	17.184	3	1726.8421	1726.8421	E	K	117	133
PSM	KHLAPFLPNHPVISL	2148	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11632	26.195	3	1681.9668	1681.9668	K	K	774	789
PSM	KIAHLAGVKDQLT	2149	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7464	20.465	3	1392.8089	1392.8089	S	K	1563	1576
PSM	KIHIPGGLSPESK	2150	sp|P57772-2|SELB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8409	21.614	3	1361.7667	1361.7667	F	K	502	515
PSM	KIKDEPDNAQEYSHGQQQ	2151	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4776	16.771	3	2113.9665	2113.9665	D	K	271	289
PSM	KIKSGCEGHLPWPNGICT	2152	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=10065	23.621	3	2052.9874	2052.9874	C	K	189	207
PSM	KILEVHVDKGM	2153	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7947	21.075	3	1267.6958	1267.6958	V	K	215	226
PSM	KIVKEAHEPLAVADA	2154	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7273	20.243	3	1589.8777	1589.8777	K	K	78	93
PSM	KKPIPDEHLIL	2155	sp|O94979-6|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9390	22.828	3	1301.7707	1301.7707	T	K	956	967
PSM	KKSAVTYLNSTMHPGT	2156	sp|Q96BD5-2|PF21A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:35	ms_run[2]:scan=6552	19.182	3	1749.872	1749.8720	R	R	411	427
PSM	KKTADMDVGQIGFH	2157	sp|Q86WR0-2|CCD25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=7319	20.296	3	1561.7559	1561.7559	L	R	31	45
PSM	KLGETYKDHENIVIA	2158	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8473	21.687	3	1728.9046	1728.9046	D	K	409	424
PSM	KLPHPAAPVTVK	2159	sp|Q07864|DPOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6565	19.203	3	1256.7605	1256.7605	V	R	1219	1231
PSM	KLPPKLAGPLH	2160	sp|Q8IV38|ANKY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7209	20.147	3	1169.7285	1169.7285	P	K	155	166
PSM	KLSEKHSQNGFIVPPPPE	2161	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8841	22.146	3	2003.0476	2003.0476	E	K	131	149
PSM	KLVIKNQQFH	2162	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6199	18.71	3	1253.7244	1253.7244	E	K	239	249
PSM	KPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTT	2163	sp|Q15029-2|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	20-UNIMOD:35,23-UNIMOD:4,30-UNIMOD:35,31-UNIMOD:4	ms_run[2]:scan=9084	22.461	4	3765.5903	3765.5903	A	K	411	445
PSM	KPPHVILVHGEQNEMA	2164	sp|Q9UKF6|CPSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:35	ms_run[2]:scan=6775	19.498	3	1813.9145	1813.9145	L	R	410	426
PSM	KQLMVHAFIK	2165	sp|Q02750-2|MP2K1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=7949	21.077	3	1229.6954	1229.6954	L	R	327	337
PSM	KRDPEDSDVFEEDTHL	2166	sp|Q9NZ53-2|PDXL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9805	23.306	3	1930.8545	1930.8545	G	-	514	530
PSM	KRGAPPSSNIEDFHGLLP	2167	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11349	25.601	3	1934.001	1934.0010	K	K	269	287
PSM	KSTNVVYQAHHVS	2168	sp|O95340|PAPS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4676	16.623	3	1468.7423	1468.7423	Q	R	14	27
PSM	KTFSGQTHGFVH	2169	sp|Q96DG6|CMBL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6090	18.57	3	1344.6575	1344.6575	I	R	205	217
PSM	KTHLSLSHNPEQ	2170	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5100	17.24	3	1389.7001	1389.7001	A	K	866	878
PSM	KTIHLSSIRPP	2171	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8319	21.505	3	1247.735	1247.7350	Y	R	366	377
PSM	KTIKLLPSSHVA	2172	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7645	20.693	2	1292.7816	1292.7816	E	R	1026	1038
PSM	KTKAIILNTPHNPLG	2173	sp|Q6YP21-3|KAT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9073	22.446	3	1615.941	1615.9410	S	K	173	188
PSM	KTKSSSIIGSSSASHTSQATSGANS	2174	sp|P54132|BLM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4576	16.485	3	2380.1466	2380.1466	S	K	1370	1395
PSM	KTKVQNIHPVESA	2175	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4834	16.856	3	1449.794	1449.7940	D	K	31	44
PSM	KTKVVVTMEHSA	2176	sp|P55809-2|SCOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=3687	14.914	3	1344.7071	1344.7071	A	K	37	49
PSM	KTNNVSEHEDTDKY	2177	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4021	15.492	3	1678.7435	1678.7435	I	R	366	380
PSM	KTSSVHRPPAMTV	2178	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=4135	15.732	3	1425.7398	1425.7398	M	K	314	327
PSM	KVKALDEEVH	2179	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4943	17.012	3	1166.6295	1166.6295	G	K	65	75
PSM	KVKVLPTHDAS	2180	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4365	16.205	3	1193.6768	1193.6768	F	K	1536	1547
PSM	KVLPGMHHPIQM	2181	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=6729	19.433	2	1402.7213	1402.7213	M	K	66	78
PSM	KVLVPGIPGHHAAI	2182	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9224	22.631	3	1407.8351	1407.8351	A	K	402	416
PSM	KVTTHPLAKD	2183	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3722	14.952	3	1108.6241	1108.6241	S	K	122	132
PSM	KYFESDHLGSGSHFSN	2184	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7974	21.105	3	1810.7911	1810.7911	F	R	361	377
PSM	RDAMHEMEEMIETKG	2185	sp|P78316-2|NOP14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11819	26.643	3	1805.7746	1805.7746	L	R	522	537
PSM	RDEHIYPYMYLAGYHC	2186	sp|O00255-3|MEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:4	ms_run[2]:scan=11825	26.658	3	2086.903	2086.9030	Y	R	279	295
PSM	RDGVYFLYEALHGPPK	2187	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12493	29.282	3	1860.9523	1860.9523	V	K	232	248
PSM	RDLDELDKDHLQL	2188	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10446	24.13	3	1608.8107	1608.8107	K	R	354	367
PSM	RDTGIFLDLMHLK	2189	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=11631	26.193	3	1573.8286	1573.8286	L	K	153	166
PSM	RDVIVKVDQICH	2190	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=7912	21.03	3	1480.782	1480.7820	S	K	136	148
PSM	RDYLHLPPEIVPATLR	2191	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12128	27.621	3	1889.0523	1889.0523	L	R	80	96
PSM	RDYVIDLEKGSQHLI	2192	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11475	25.871	3	1784.9421	1784.9421	Q	R	192	207
PSM	REAETEPHEGK	2193	sp|P41223|BUD31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3326	14.469	3	1281.5949	1281.5949	M	R	30	41
PSM	REAMEHPYFYTVVKDQA	2194	sp|P68400-2|CSK21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=9651	23.124	4	2098.9782	2098.9782	A	R	180	197
PSM	RERDQGGFGD	2195	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4316	16.143	2	1135.5006	1135.5006	L	R	304	314
PSM	RFSHLAADTIINGGATSHLAPTDPAD	2196	sp|O75146|HIP1R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10624	24.386	4	2647.299	2647.2990	T	R	694	720
PSM	RGPEGHPLHEVLLEQA	2197	sp|Q9Y375|CIA30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9113	22.495	3	1780.922	1780.9220	W	K	106	122
PSM	RHPWDDISYVLPEHMSM	2198	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:35	ms_run[2]:scan=12283	28.277	3	2127.9506	2127.9506	Y	-	814	831
PSM	RIAESNHIKLSGSNPYTTVTPQIINS	2199	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10438	24.12	4	2839.4828	2839.4828	Q	K	377	403
PSM	RIGYPKPALLHSTFFPALQGAQT	2200	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12078	27.447	4	2512.3591	2512.3591	P	K	285	308
PSM	RIQEFCNLHQSKEENLISS	2201	sp|P53384-2|NUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=9229	22.636	3	2331.1277	2331.1277	Q	-	291	310
PSM	RIRDLNDEIN	2202	sp|Q9ULR0|ISY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7363	20.344	2	1256.6473	1256.6473	F	K	69	79
PSM	RIRDVQCTG	2203	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=3988	15.422	2	1103.5506	1103.5506	G	R	330	339
PSM	RKGLYMANDL	2204	sp|Q9Y2Q3-3|GSTK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=7666	20.719	2	1195.6019	1195.6019	P	K	61	71
PSM	RLASALAPSIYEHEDIK	2205	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9656	23.128	3	1912.0054	1912.0054	E	K	461	478
PSM	RLGEESPSLHK	2206	sp|Q9NX74|DUS2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4926	16.991	3	1251.6571	1251.6571	G	R	440	451
PSM	RLRDENPDF	2207	sp|Q8WVX9|FACR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7087	19.974	2	1160.5574	1160.5574	D	R	67	76
PSM	RLRQIFNGTFV	2208	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11236	25.402	3	1349.7568	1349.7568	L	K	113	124
PSM	RLSMYGVDLHHA	2209	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=7916	21.033	3	1413.6823	1413.6823	K	K	400	412
PSM	RLSSVVTQHDSK	2210	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4658	16.604	3	1355.7157	1355.7157	Y	K	135	147
PSM	RNQGHWADWLQAY	2211	sp|Q9BVL4|SELO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12132	27.641	3	1643.7593	1643.7593	S	R	550	563
PSM	RPFCSLIQIHGHN	2212	sp|Q5VZE5|NAA35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=9521	22.979	3	1577.7885	1577.7885	V	R	430	443
PSM	RPHLSVILVGENPASHSYVLN	2213	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11294	25.509	4	2301.223	2301.2230	K	K	67	88
PSM	RPHYPLMPTRPVPSYIQ	2214	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=9339	22.769	3	2067.0724	2067.0724	L	R	88	105
PSM	RPLAYSTLADLVHHV	2215	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12153	27.719	3	1690.9155	1690.9155	L	R	372	387
PSM	RPLSSSHEASEGQAKDATSSGGTA	2216	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3829	15.104	3	2330.0735	2330.0735	K	R	157	181
PSM	RPPSAFFLFCSEHRP	2217	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=11514	25.949	3	1846.8937	1846.8937	K	K	97	112
PSM	RQAAVGQGDFHLLDH	2218	sp|O43819|SCO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9673	23.145	4	1662.8227	1662.8227	L	R	95	110
PSM	RQHLNPPGGKTSDIFGSPVTATS	2219	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9364	22.796	4	2366.1979	2366.1979	T	R	65	88
PSM	RQQLELEEVHR	2220	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7257	20.224	3	1435.7532	1435.7532	A	R	989	1000
PSM	RQQMQDFFLAHKDEEWF	2221	sp|Q9BXP5-4|SRRT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=11950	27.008	4	2270.0215	2270.0215	R	R	181	198
PSM	RQREQQLLEFLD	2222	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11984	27.121	3	1573.8213	1573.8213	P	R	261	273
PSM	RQRPDLGSAQ	2223	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4196	15.864	2	1126.5843	1126.5843	V	K	113	123
PSM	RQSLGHPPPEPGPDRVADA	2224	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6577	19.218	3	1994.9922	1994.9922	P	K	56	75
PSM	RQVVELAVKEH	2225	sp|O14578-3|CTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6648	19.315	3	1306.7357	1306.7357	S	K	619	630
PSM	RRANENSNIQVLSE	2226	sp|Q6UN15-4|FIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7633	20.674	2	1628.823	1628.8230	R	R	315	329
PSM	RRCEEEAQEIV	2227	sp|Q5TKA1-3|LIN9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4	ms_run[2]:scan=6797	19.528	2	1417.662	1417.6620	R	R	398	409
PSM	RRFSEGTSAD	2228	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4001	15.443	2	1124.521	1124.5210	G	R	241	251
PSM	RRNPDTQWIT	2229	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8275	21.454	2	1285.6527	1285.6527	I	K	143	153
PSM	RRQELEQVLGI	2230	sp|Q92925-3|SMRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11390	25.686	2	1339.7572	1339.7572	Q	R	470	481
PSM	RRSENEEFVEVG	2231	sp|P10644|KAP0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8083	21.233	2	1449.6848	1449.6848	Q	R	305	317
PSM	RSLENYHFVDEHG	2232	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8234	21.408	3	1601.7223	1601.7223	L	K	91	104
PSM	RTSHGEVISVPH	2233	sp|Q13505-3|MTX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6232	18.762	3	1317.6789	1317.6789	L	K	57	69
PSM	RTTSNTLHYIHIEQLD	2234	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10137	23.702	4	1939.9752	1939.9752	K	K	215	231
PSM	RVRGVNASAQ	2235	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3605	14.819	2	1056.5788	1056.5788	E	K	570	580
PSM	RVRVELSNGE	2236	sp|P84103-2|SRSF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6044	18.511	2	1157.6153	1157.6153	C	K	75	85
PSM	RVSFELFADKVP	2237	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12062	27.393	3	1406.7558	1406.7558	G	K	19	31
PSM	RVWGVPIPVFHH	2238	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11641	26.214	3	1442.7935	1442.7935	Q	K	526	538
PSM	RVWLPTAGFDHHVV	2239	sp|Q9UBF8-3|PI4KB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11090	25.142	3	1632.8525	1632.8525	A	R	34	48
PSM	RYGDGGSTFQSTTGHCVHM	2240	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=7654	20.704	3	2112.8742	2112.8742	H	R	275	294
PSM	RHESGASIKIDEPLEGSED	2241	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6951	19.767748522399998	3	2067.933804	2067.970892	I	R	414	433
PSM	KGMWSEGNGSHTIRDL	2242	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35	ms_run[1]:scan=9014	22.376900185866667	3	1803.819450	1802.836982	K	K	161	177
PSM	KWTSQHSNTQTLGK	2243	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4584	16.499103381066668	3	1614.811909	1614.811418	A	-	1083	1097
PSM	KGELTTLIHQLQEKD	2244	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11772	26.523089597333335	3	1753.949412	1751.941764	S	K	324	339
PSM	KMAVTFIGNSTAIQELFK	2245	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35	ms_run[1]:scan=12468	29.158682720266665	3	2013.061102	2013.060499	L	R	362	380
PSM	KHPPAPAEPSSDLASKL	2246	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8443	21.652248719466666	3	1744.916840	1743.915549	L	R	1098	1115
PSM	RSLHDALCVLAQTVKDS	2247	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=12560	29.5806132848	3	1912.968952	1911.983646	E	R	388	405
PSM	KHNGPNDASDGTVRL	2248	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6720	19.41662821546667	2	1580.755388	1579.770282	M	R	6	21
PSM	RKPTDGASSSNCVTDISHLV	2249	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4	ms_run[1]:scan=10590	24.332033350400003	3	2144.018055	2143.032781	S	R	697	717
PSM	KGIPVVEHKVE	2250	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5846	18.24239607173333	3	1234.710773	1233.708122	G	K	123	134
PSM	RIEELQEQLEQKH	2251	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8447	21.6554882056	3	1679.898937	1678.863848	E	R	488	501
PSM	KHNLMTVEQNNGSSQK	2252	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:35	ms_run[1]:scan=3752	14.987584179466667	3	1829.866362	1829.869010	A	K	610	626
PSM	RISINQALQHAFIQEKI	2253	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11992	27.1459334192	3	2009.125805	2008.121794	K	-	991	1008
PSM	KENGVTHPIDYHTTDYVDEIK	2254	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=9468	22.921623660799998	4	2474.1612	2473.1752	L	K	230	251
PSM	RSAGIKVIMVTGDHPITA	2255	sp|P54707|AT12A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9875	23.383835187200003	3	1865.028843	1865.019303	C	K	622	640
PSM	KLITQTFSHHNQLAQ	2256	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8035	21.176789247466665	3	1765.911183	1764.927117	E	K	53	68
PSM	KFHDPDSAVVAQHLTNTVFVD	2257	sp|Q05519|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11291	25.5051277288	4	2339.157413	2339.154610	V	R	82	103
PSM	KKWESPAQNTAHLDQFE	2258	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8995	22.3548961216	3	2028.977288	2027.970104	L	R	29	46
PSM	KNNISSGHVPHGPLT	2259	sp|O95793|STAU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6643	19.3055577832	2	1556.805420	1556.805939	L	R	473	488
PSM	KGPSHSGNPSHGTLGLSGTLG	2260	sp|Q86XN7|PRSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8018	21.156256056533334	3	1959.979033	1959.976252	F	R	620	641
PSM	REVQAVSNLSGQGKHG	2261	sp|Q8N9N5|BANP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5092	17.228269510133334	3	1665.831106	1665.854680	H	K	262	278
PSM	KKLCENLLQTVHAEYS	2262	sp|Q7Z7F0|KHDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=10415	24.086976400533334	3	1933.002075	1931.977498	A	R	309	325
PSM	REGEKMQLPAGEYH	2263	sp|P38435|VKGC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:35	ms_run[1]:scan=5201	17.3707809096	3	1659.767943	1659.767505	L	K	574	588
PSM	RMDYYDSEHHEDFEFISGT	2264	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35	ms_run[1]:scan=10862	24.763782362933334	4	2392.957983	2392.954256	K	R	571	590
PSM	RDLTQEMEVHAEKL	2265	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:35	ms_run[1]:scan=7344	20.323015733066665	3	1713.841262	1713.835585	L	K	2123	2137
PSM	RMFADDLHNLNK	2266	sp|Q4U2R6|RM51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35	ms_run[1]:scan=7887	20.9995925688	3	1488.713494	1488.714347	S	R	101	113
PSM	KVFEEKTQHLQELFS	2267	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10337	23.971277413333333	3	1862.963299	1861.957414	H	R	291	306
PSM	RKEEDQATLVEQVK	2268	sp|Q96IZ7|RSRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6776	19.4991857744	3	1671.878078	1671.879164	R	R	214	228
PSM	KQTQSKIDVH	2269	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3646	14.8718121584	3	1182.635914	1182.635686	T	R	223	233
PSM	KEKYGINTDPPK	2270	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5486	17.7555618736	3	1388.729791	1388.729980	L	-	114	126
PSM	KKPIEDVLLSSVR	2271	sp|Q9H2J4|PDCL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10411	24.08291601013333	3	1482.876823	1482.876979	P	R	213	226
PSM	RTATEKPLGELWK	2272	sp|P23919|KTHY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9393	22.830661953333333	4	1527.841907	1527.840928	I	-	200	213
PSM	RKGAAPAPPGKTGPAVA	2273	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4439	16.298911297866667	3	1544.878410	1544.878710	P	K	383	400
PSM	KKIGEEEIQKPEE	2274	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5285	17.477720142666666	3	1555.809609	1555.809353	G	K	486	499
PSM	KFASHCLMNHPDLA	2275	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=7148	20.064432141066668	3	1655.750193	1655.754832	V	K	345	359
PSM	KEELAALISELKQEQ	2276	sp|Q86XT4|TRI50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10474	24.164242752533333	3	1727.943803	1727.930531	M	K	133	148
PSM	RKTIPVILDGKDVVAMA	2277	sp|Q8TDD1|DDX54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:35	ms_run[1]:scan=10130	23.694191484533334	3	1841.044924	1841.044455	Q	R	124	141
PSM	KKDEKTDTLEDLFPTT	2278	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11494	25.915435265600003	4	1879.941702	1879.941489	A	K	465	481
PSM	KKETKPEPMEEDLPEN	2279	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6872	19.646568274933333	3	1912.909953	1912.908809	P	K	206	222
PSM	RKPEILPLFQEAEDKN	2280	sp|Q8NCM8|DYHC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11271	25.471421522933333	3	1926.023576	1926.021077	E	R	979	995
PSM	KKEEKEDEISLEDLIE	2281	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11835	26.682173977599998	3	1945.972639	1945.973183	K	R	222	238
PSM	KKTPPEDCEGPFRPAEIL	2282	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=10549	24.268664788533332	3	2083.039627	2083.040826	C	K	586	604
PSM	RRPEPAGGGNVSAKPGAPPQPAVSA	2283	sp|Q6ZSJ8|CA122_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6157	18.655672515200003	3	2367.239551	2367.240740	R	R	71	96
PSM	KAASHLLSIH	2284	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6709	19.4	3	1075.6138	1075.6138	V	K	980	990
PSM	KAKDPFAHLP	2285	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8628	21.868	3	1122.6186	1122.6186	P	K	275	285
PSM	KAVILVHDIK	2286	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7243	20.196	2	1134.7125	1134.7125	G	K	1700	1710
PSM	KCGQEEHDVLLSNEEDR	2287	sp|Q9UGI8-2|TES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=7085	19.971	3	2056.912	2056.9120	C	K	36	53
PSM	KDIHEELPK	2288	sp|Q9BVP2-2|GNL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5211	17.383	3	1107.5924	1107.5924	E	R	455	464
PSM	KEAAVEDLHHY	2289	sp|Q9UG56-2|PISD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6238	18.768	3	1310.6255	1310.6255	M	R	118	129
PSM	KEENTIFLSLGGNANCE	2290	sp|Q14207|NPAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:4	ms_run[2]:scan=8618	21.858	3	1894.8731	1894.8731	V	K	667	684
PSM	KEKQPPPPAH	2291	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3306	14.427	3	1127.6087	1127.6087	A	R	257	267
PSM	KELDEYMHGGK	2292	sp|Q9H814|PHAX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=4235	15.981	3	1321.5973	1321.5973	D	K	173	184
PSM	KEPNSLHGGVRGFD	2293	sp|Q96C23|GALM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6864	19.635	3	1511.7481	1511.7481	N	K	101	115
PSM	KGSSHSPDHPGCLMEN	2294	sp|O95149|SPN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=4112	15.682	3	1767.7305	1767.7305	L	-	345	361
PSM	KGVHIHQAGGSPPASSTSSSSLTNDVA	2295	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7249	20.213	3	2591.2576	2591.2576	N	K	709	736
PSM	KHETEFAELEVKT	2296	sp|O95619|YETS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8987	22.346	3	1559.7831	1559.7831	Y	R	167	180
PSM	KHGVDVEVQGPHEA	2297	sp|Q9HCE1-2|MOV10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5632	17.967	3	1500.7321	1500.7321	G	R	121	135
PSM	KHIYYITGETKDQVANSAFVE	2298	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13482	33.016	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHLPSTEPDPHVV	2299	sp|Q9BUJ2-2|HNRL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6388	18.963	3	1454.7518	1454.7518	V	R	270	283
PSM	KHPSAEQSSHIDVV	2300	sp|Q69YN4-4|VIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5950	18.386	3	1532.7583	1532.7583	F	R	16	30
PSM	KILEVHVDKGM	2301	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7938	21.058	3	1267.6958	1267.6958	V	K	215	226
PSM	KILQLLHPHV	2302	sp|Q8WYQ5-3|DGCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9741	23.219	3	1196.7394	1196.7394	Q	K	646	656
PSM	KIRSGYFDE	2303	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7634	20.676	2	1113.5455	1113.5455	S	R	148	157
PSM	KKDLAHTPSQLEGLDPATEA	2304	sp|O75909-2|CCNK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9402	22.842	3	2120.075	2120.0750	D	R	28	48
PSM	KKFGTINIVHP	2305	sp|Q9Y617-2|SERC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8866	22.176	3	1252.7292	1252.7292	A	K	116	127
PSM	KKGDECELLGHS	2306	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4	ms_run[2]:scan=5968	18.412	3	1371.6453	1371.6453	L	K	285	297
PSM	KKLDIGLELVH	2307	sp|Q9Y2W6-3|TDRKH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10295	23.921	3	1263.7551	1263.7551	G	K	433	444
PSM	KKTTIENIQLPHTLLS	2308	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11142	25.229	4	1835.0516	1835.0516	P	R	627	643
PSM	KLGLSVFTHH	2309	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9528	22.987	3	1137.6295	1137.6295	A	R	142	152
PSM	KLHIVQVVCK	2310	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:4	ms_run[2]:scan=7608	20.645	3	1222.722	1222.7220	P	K	183	193
PSM	KLKGIPVLVGLLDHP	2311	sp|O60716-13|CTND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12429	28.974	3	1597.9919	1597.9919	R	K	352	367
PSM	KLLGPKNSEGLHSA	2312	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5701	18.063	3	1449.794	1449.7940	K	R	171	185
PSM	KLMDHGQSHPEDIDMYST	2313	sp|Q6UXV4|MIC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=6722	19.42	3	2134.8936	2134.8936	P	R	249	267
PSM	KLMTHVDKAEGTTY	2314	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35	ms_run[2]:scan=5278	17.47	3	1608.7818	1608.7818	K	R	210	224
PSM	KLNNPKFNDPHV	2315	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7099	19.99	3	1421.7415	1421.7415	H	K	1878	1890
PSM	KLNQVCATHQHFES	2316	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4	ms_run[2]:scan=5805	18.188	3	1697.7944	1697.7944	E	R	478	492
PSM	KLVNNGEKLEFLH	2317	sp|Q15393-3|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9460	22.912	4	1539.8409	1539.8409	Y	K	111	124
PSM	KMAEEKLTH	2318	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=3480	14.678	3	1101.5488	1101.5488	S	K	95	104
PSM	KNGVNDIKNH	2319	sp|P17612-2|KAPCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3495	14.695	3	1137.5891	1137.5891	L	K	278	288
PSM	KNMMAACDPRHG	2320	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=3698	14.927	3	1402.5904	1402.5904	A	R	297	309
PSM	KNPSLMPKEPHI	2321	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35	ms_run[2]:scan=7111	20.007	3	1405.7388	1405.7388	Y	R	513	525
PSM	KNVTGHYISPFHDIPL	2322	sp|Q9H2U2-6|IPYR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11380	25.662	2	1836.9523	1836.9523	F	K	53	69
PSM	KNYSHQVGNYHMGFLVSEDES	2323	sp|P20585|MSH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:35	ms_run[2]:scan=8920	22.252	3	2456.0703	2456.0703	E	K	1019	1040
PSM	KQEGHNLGLLHGDMDQSE	2324	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:35	ms_run[2]:scan=7202	20.138	4	2022.9065	2022.9065	L	R	400	418
PSM	KQTQSKIDVH	2325	sp|O00425|IF2B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3656	14.88	3	1182.6357	1182.6357	T	R	223	233
PSM	KRGGGGGFGYQ	2326	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5439	17.692	3	1082.5257	1082.5257	K	K	634	645
PSM	KSKEDQGLSGHDE	2327	sp|Q9ULR5|PAI2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3564	14.769	3	1428.6481	1428.6481	V	K	14	27
PSM	KSKSFEDPPNHA	2328	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4317	16.146	3	1355.647	1355.6470	A	R	1092	1104
PSM	KSSHGSSKPQEVPQSVTATAAS	2329	sp|Q8NFP9|NBEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5446	17.701	3	2183.0818	2183.0818	N	K	1496	1518
PSM	KTHPTIKINGYTGPGTV	2330	sp|Q04206-2|TF65_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8772	22.053	3	1782.9628	1782.9628	T	R	43	60
PSM	KTLIPHTDGEKLS	2331	sp|Q01664|TFAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7212	20.15	3	1437.7827	1437.7827	L	K	72	85
PSM	KTSQVPVKHVY	2332	sp|Q9NXV2|KCTD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4897	16.942	2	1284.719	1284.7190	S	R	148	159
PSM	KTYELLNCDKH	2333	sp|Q92979|NEP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=6898	19.687	3	1419.6816	1419.6816	G	K	59	70
PSM	KVIEPLKDFH	2334	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8435	21.643	3	1224.6867	1224.6867	G	K	307	317
PSM	KVKGLVLGPIH	2335	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8783	22.07	3	1159.7441	1159.7441	L	K	154	165
PSM	KVPPNHVGKPLL	2336	sp|Q8NCA5|FA98A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6886	19.669	3	1297.787	1297.7870	A	K	181	193
PSM	RARFEELCSDLF	2337	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=11830	26.668	3	1541.7297	1541.7297	T	R	299	311
PSM	REIVEHMVQHF	2338	sp|Q9UKV8-2|AGO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=6628	19.279	3	1439.698	1439.6980	N	K	72	83
PSM	RERAAANEQLT	2339	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4199	15.878	2	1257.6426	1257.6426	D	R	93	104
PSM	RERLQDLEE	2340	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7126	20.033	2	1186.5942	1186.5942	E	R	169	178
PSM	RETEELHHD	2341	sp|O60869-2|EDF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3486	14.685	3	1164.516	1164.5160	D	R	63	72
PSM	RFALPTAHHTLGLPVG	2342	sp|Q9UHQ9|NB5R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10976	24.944	3	1685.9366	1685.9366	F	K	65	81
PSM	RFIPPWLK	2343	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11564	26.046	2	1055.628	1055.6280	S	K	76	84
PSM	RGELQSSDLFHHS	2344	sp|Q02809|PLOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8331	21.519	3	1511.7117	1511.7117	L	K	463	476
PSM	RGFGFVTFDDHDPVD	2345	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12004	27.187	3	1722.7638	1722.7638	K	K	141	156
PSM	RIDDIVSGHK	2346	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5917	18.345	3	1138.6095	1138.6095	L	K	480	490
PSM	RIDQVNQLLELDHQK	2347	sp|P61201|CSN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10782	24.644	4	1847.9854	1847.9854	G	R	401	416
PSM	RIRELEEAMAGE	2348	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9583	23.053	2	1402.6875	1402.6875	D	R	334	346
PSM	RIRGYNFEDLTD	2349	sp|Q9H7D7-2|WDR26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10563	24.292	2	1497.7212	1497.7212	Q	R	492	504
PSM	RKFGYVDFESAEDLE	2350	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11645	26.222	3	1803.8315	1803.8315	T	K	347	362
PSM	RKFNALFAQGNYSEAA	2351	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10250	23.86	3	1785.8798	1785.8798	A	K	366	382
PSM	RKFTYLGSQD	2352	sp|Q7Z2W4-2|ZCCHV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7906	21.023	2	1213.6091	1213.6091	T	R	295	305
PSM	RKQSLGELIGTLNAA	2353	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11710	26.371	3	1569.8839	1569.8839	G	K	18	33
PSM	RKTSDANETEDHLESLIC	2354	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:4	ms_run[2]:scan=10343	23.98	3	2116.9695	2116.9695	R	K	19	37
PSM	RLAGDKANYWWL	2355	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12203	27.917	3	1491.7623	1491.7623	T	R	455	467
PSM	RLGAMDIDTHK	2356	sp|Q15061|WDR43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6716	19.41	3	1255.6343	1255.6343	E	K	441	452
PSM	RLKPPTLIHGQAPSAGLPSQ	2357	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9086	22.463	3	2067.1589	2067.1589	F	K	75	95
PSM	RLLFPPKDDHTL	2358	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9482	22.936	3	1450.7932	1450.7932	A	K	815	827
PSM	RLRPESALAQAQ	2359	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6985	19.824	2	1338.7368	1338.7368	I	K	429	441
PSM	RMEELHNQEMQK	2360	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=3879	15.218	3	1587.7134	1587.7134	R	R	548	560
PSM	RNMSVIAHVDHG	2361	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35	ms_run[2]:scan=4752	16.744	3	1350.6463	1350.6463	I	K	20	32
PSM	RPLPSASQKAGENQEH	2362	sp|Q8ND56-3|LS14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3883	15.225	3	1747.8602	1747.8602	T	R	180	196
PSM	RPRSAYNVYVAE	2363	sp|Q00059|TFAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7964	21.095	2	1423.7208	1423.7208	K	R	157	169
PSM	RQRLAELQA	2364	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6889	19.674	2	1083.6149	1083.6149	R	K	11	20
PSM	RRAEENALQQ	2365	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4176	15.824	2	1213.6163	1213.6163	R	K	1268	1278
PSM	RRALEYTIYNQELNET	2366	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10323	23.954	3	2011.9963	2011.9963	M	R	220	236
PSM	RRDYDDMSP	2367	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=3944	15.337	2	1169.4771	1169.4771	S	R	253	262
PSM	RRGPPPPP	2368	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4030	15.527	2	872.49807	872.4981	G	R	80	88
PSM	RRLEVLDST	2369	sp|P47985|UCRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7725	20.792	2	1087.5986	1087.5986	Y	K	92	101
PSM	RRNEPPPP	2370	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3654	14.878	2	961.50936	961.5094	S	R	827	835
PSM	RRQQSEISAAVE	2371	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5775	18.149	2	1372.7059	1372.7059	R	R	449	461
PSM	RRVNQAIWLLCTGA	2372	sp|P46782|RS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:4	ms_run[2]:scan=11905	26.869	3	1656.8882	1656.8882	L	R	145	159
PSM	RSGKYDLDF	2373	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9649	23.121	2	1099.5298	1099.5298	F	K	253	262
PSM	RSRLSEQELEALEL	2374	sp|P52756|RBM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11366	25.633	3	1671.8792	1671.8792	R	R	681	695
PSM	RTSVIQGIHTDHNTL	2375	sp|Q5U5X0|LYRM7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8074	21.222	2	1690.8751	1690.8751	L	K	67	82
PSM	RTVEGVLIVHEH	2376	sp|O43809|CPSF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8054	21.197	3	1387.7572	1387.7572	R	R	78	90
PSM	RVTLILELLQHK	2377	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12291	28.311	3	1461.9031	1461.9031	Q	K	1206	1218
PSM	RVVDLMAHMASKE	2378	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=7202	20.138	3	1517.733	1517.7330	N	-	281	294
PSM	RYEVPLETPHVHS	2379	sp|P10253|LYAG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8468	21.68	3	1562.7841	1562.7841	R	R	190	203
PSM	RYRPDEQPSL	2380	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7142	20.058	2	1259.6258	1259.6258	V	R	655	665
PSM	RHQGVMVGMGQKDSYVGDEAQS	2381	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=6101	18.5820001304	3	2411.052267	2410.064158	P	K	41	63
PSM	KQEYDESGPSIVHR	2382	sp|Q9BYX7|ACTBM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6418	18.997549464533332	3	1644.775254	1643.790349	S	K	359	373
PSM	KHIYYITGETKDQVANSAFVE	2383	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=13515	33.1542249072	3	2413.198021	2412.196141	Q	R	489	510
PSM	KHIYYITGETKDQVANSAFVE	2384	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=13392	32.67043858106667	3	2413.196810	2412.196141	Q	R	489	510
PSM	RVDPPMGEEGNHK	2385	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35	ms_run[1]:scan=3539	14.744212802933333	3	1480.673145	1480.672876	F	R	1025	1038
PSM	RRWTDENIDTVAL	2386	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10925	24.8521715312	3	1588.802697	1587.800519	E	K	2843	2856
PSM	RDVHNIYGLYVHMATADGL	2387	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:35	ms_run[1]:scan=11451	25.817765020533333	3	2161.047487	2160.042223	H	R	569	588
PSM	KRGFGFVTFDDHDPVD	2388	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=11174	25.284728914933332	3	1850.859933	1850.858763	K	K	152	168
PSM	RKASPPSGLWSPAYASH	2389	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=9090	22.46873088506667	3	1812.9252	1810.9112	A	-	1871	1888
PSM	KSQIVTNVRNTIHGF	2390	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9884	23.3933621776	3	1712.943927	1712.932202	A	K	53	68
PSM	KENGVTHPIDYHTTDYVDEIK	2391	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=9457	22.910300786666667	4	2474.1612	2473.1752	L	K	230	251
PSM	KNGVNDIKNH	2392	sp|P17612|KAPCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3488	14.687098886933335	3	1137.588922	1137.589070	L	K	286	296
PSM	RKPIDYTILDDIGHGV	2393	sp|Q9NYB9|ABI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=12000	27.174499878133336	3	1811.960817	1810.957748	I	K	138	154
PSM	KFLQEHLAPKAQEID	2394	sp|P26440|IVD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8451	21.66026326613333	3	1765.937020	1765.936285	A	R	58	73
PSM	RETIVHQHEYGPEENLEDDMY	2395	sp|P23025|XPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	20-UNIMOD:35	ms_run[1]:scan=8953	22.298650693866666	4	2619.120754	2619.118361	K	R	237	258
PSM	KLPNLTHLNLSGNKL	2396	sp|Q92688|AN32B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10859	24.758115861333334	3	1660.961970	1660.962440	E	K	86	101
PSM	KKGDECELLGHS	2397	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4	ms_run[1]:scan=5956	18.392594987733332	3	1371.645208	1371.645264	L	K	285	297
PSM	KEAMNHPGHL	2398	sp|P00374|DYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:35	ms_run[1]:scan=3697	14.925499188266667	3	1148.538793	1148.539677	Y	K	123	133
PSM	RSGTPMKEAVGHTGYLTFAT	2399	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9933	23.44048689946667	3	2124.063014	2123.046974	F	K	266	286
PSM	KATTHEIMGPK	2400	sp|Q13492|PICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35	ms_run[1]:scan=3619	14.842685057866667	3	1227.628806	1227.628158	C	K	28	39
PSM	RIMLLNHPDKGGSPYIAA	2401	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:35	ms_run[1]:scan=9477	22.93166740346667	3	1970.030727	1968.025117	R	K	84	102
PSM	RQEAVSMIPPLLLNVRPHH	2402	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	7-UNIMOD:35	ms_run[1]:scan=11150	25.2429189704	4	2222.2134	2222.2101	S	K	160	179
PSM	KIGEHMEEHGI	2403	sp|Q16881|TRXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35	ms_run[1]:scan=4642	16.580717354666668	2	1294.599475	1294.597586	N	K	385	396
PSM	MKHYEVEILDAKT	2404	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=8847	22.153826937066665	3	1591.792369	1591.791595	-	R	1	14
PSM	RKDPSLPAASSSSSSSK	2405	sp|Q01831|XPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4196	15.86427236	3	1690.850919	1690.848592	H	R	492	509
PSM	KKIEQELTAAK	2406	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5276	17.467861563733333	3	1257.729146	1257.729252	E	K	45	56
PSM	KKEPAVLELEGK	2407	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7843	20.950982375466666	2	1339.770654	1339.771117	T	K	316	328
PSM	KKLPPVLAIQLK	2408	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10060	23.6098482664	3	1347.899368	1346.901343	I	R	1787	1799
PSM	KKIEISVSEAEK	2409	sp|O95219|SNX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6534	19.157900488	3	1360.764235	1359.760946	L	R	56	68
PSM	KKTSATVGPKAPSGG	2410	sp|P16104|H2AX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3532	14.735850335466667	3	1384.767077	1384.767428	P	K	119	134
PSM	RKNPLPPSVGVVDK	2411	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8617	21.8570476192	3	1504.871946	1504.872562	D	K	78	92
PSM	RKNPLPPSVGVVDK	2412	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7386	20.371884297333335	3	1504.894663	1504.872562	D	K	78	92
PSM	KSGNLTEDDKHNNA	2413	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3496	14.6957007928	3	1542.689713	1541.707013	V	K	573	587
PSM	KKNYQSQADIPIRSPFGIV	2414	sp|Q14966|ZN638_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=11524	25.966366135999998	4	2160.167484	2160.169138	S	K	370	389
PSM	KKSADTLWDIQKDL	2415	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=11490	25.907614530133333	3	1659.883890	1659.883186	L	K	318	332
PSM	RKEEDQATLVEQVK	2416	sp|Q96IZ7|RSRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6742	19.458196350133335	3	1671.878078	1671.879164	R	R	214	228
PSM	RKDMVDPVTGDKLTD	2417	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:35	ms_run[1]:scan=6523	19.142085948533335	3	1704.835399	1704.835250	I	R	256	271
PSM	KKLGTVITPDTWKDGA	2418	sp|Q9P021|CRIPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9225	22.632229952266666	3	1728.940006	1728.941036	E	R	8	24
PSM	RVLEVASGSGQHAAHFA	2419	sp|Q96S19|MTL26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7528	20.54758530666667	3	1735.876852	1735.875416	V	R	30	47
PSM	KHVVQSISTQQEKETIA	2420	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6174	18.679059985866665	3	1925.021420	1925.021805	E	K	221	238
PSM	KKFMGTELNGKTLGILGLG	2421	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=12185	27.843330871466666	3	1977.097153	1976.112869	R	R	136	155
PSM	KGYPHLCSICDLPVHSN	2422	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=9811	23.310733901066666	3	1995.939338	1995.929502	P	K	287	304
PSM	KKTPPEDCEGPFRPAEIL	2423	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:4	ms_run[1]:scan=10511	24.214742264533335	3	2083.039627	2083.040826	C	K	586	604
PSM	KKLPEELGRDQNTVETLQ	2424	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8293	21.4713602768	3	2097.106970	2097.106597	H	R	1826	1844
PSM	KKFYPLEIDYGQDEEAVK	2425	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=13311	32.3922823528	3	2171.074950	2171.078651	P	K	636	654
PSM	KKEVPAVPETLK	2426	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6673	19.3509533048	2	1337.791474	1337.791852	K	K	8	20
PSM	KAKAPIQDIWYHED	2427	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9884	23.393	3	1712.8522	1712.8522	G	R	55	69
PSM	KALSQRDPPHNNFFFFDGM	2428	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	19-UNIMOD:35	ms_run[2]:scan=11767	26.51	4	2283.0531	2283.0531	V	K	316	335
PSM	KAMHTPKPAVSGE	2429	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35	ms_run[2]:scan=3621	14.845	3	1367.6867	1367.6867	G	K	1176	1189
PSM	KAVILVHDIK	2430	sp|Q8N3C0|ASCC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7230	20.178	3	1134.7125	1134.7125	G	K	1700	1710
PSM	KCMIDQAHQEERPI	2431	sp|Q9UBQ5-2|EIF3K_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,3-UNIMOD:35	ms_run[2]:scan=5479	17.748	3	1769.8189	1769.8189	C	R	86	100
PSM	KDGIPVSSEAERHELG	2432	sp|Q9Y282-2|ERGI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7340	20.319	3	1722.8537	1722.8537	D	K	110	126
PSM	KDNIKHVPGGGNVQIQN	2433	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5926	18.358	3	1816.9544	1816.9544	S	K	838	855
PSM	KEKPYFPIPEEYTFIQNVPLED	2434	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12648	29.954	3	2695.3421	2695.3421	Q	R	443	465
PSM	KESQEHTKDLD	2435	sp|Q9H814|PHAX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3433	14.626	2	1328.6208	1328.6208	R	K	162	173
PSM	KETGEHLVHV	2436	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5706	18.069	3	1147.5986	1147.5986	P	K	2006	2016
PSM	KFDLHSSSHIDTLLE	2437	sp|Q5H9R7-6|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10881	24.794	3	1740.8683	1740.8683	W	R	4	19
PSM	KGDVREPFHSILSVL	2438	sp|Q8NCW5-2|NNRE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12324	28.462	3	1695.9308	1695.9308	F	K	90	105
PSM	KHDGITVAVH	2439	sp|O43504|LTOR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5207	17.378	3	1075.5774	1075.5774	Q	K	78	88
PSM	KIIQEPPHK	2440	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4152	15.793	3	1088.6342	1088.6342	D	K	549	558
PSM	KIPMFIVHK	2441	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=8413	21.619	3	1127.6525	1127.6525	T	K	449	458
PSM	KKLPIQEFHLS	2442	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9839	23.343	3	1338.766	1338.7660	A	R	136	147
PSM	KKPEEITPENHVEGTA	2443	sp|Q9Y6X8|ZHX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5292	17.485	3	1777.8846	1777.8846	P	R	201	217
PSM	KKPLPDHVSIVEP	2444	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8410	21.615	3	1457.8242	1457.8242	P	K	201	214
PSM	KLRDMGIVDILH	2445	sp|Q8IUR7-8|ARMC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=10128	23.692	3	1424.781	1424.7810	D	K	572	584
PSM	KLSPKHPESNTAGMDIFA	2446	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9607	23.078	3	1941.9618	1941.9618	L	K	106	124
PSM	KMATLHCQESEGHP	2447	sp|Q9BX67|JAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=3838	15.124	3	1639.7083	1639.7083	G	R	154	168
PSM	KMSPHSLTCVTSSHWD	2448	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=8182	21.345	3	1887.8244	1887.8244	L	R	946	962
PSM	KNIIYHAVKDAVGTL	2449	sp|Q7LBC6-3|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11116	25.184	3	1640.925	1640.9250	V	K	735	750
PSM	KNISHVHTMDFSP	2450	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:35	ms_run[2]:scan=6323	18.875	3	1527.714	1527.7140	N	R	519	532
PSM	KPHNGLLFPQHGDYQYG	2451	sp|Q96K37-2|S35E1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9573	23.043	3	1969.9435	1969.9435	E	R	67	84
PSM	KPHPWFFG	2452	sp|P62993|GRB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11563	26.044	2	1014.5076	1014.5076	M	K	56	64
PSM	KPQEPGHFYSEH	2453	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5446	17.701	2	1454.6579	1454.6579	C	R	255	267
PSM	KPVKHTAMVSWGGVSIPNSPF	2454	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:35	ms_run[2]:scan=11803	26.603	3	2254.1569	2254.1569	R	R	739	760
PSM	KQFLDYFKTEH	2455	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10856	24.754	3	1454.7194	1454.7194	L	K	933	944
PSM	KQILNFFHH	2456	sp|A6NDU8|CE051_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10069	23.627	3	1182.6298	1182.6298	A	R	283	292
PSM	KQKLGGVNAVGHS	2457	sp|Q2M1P5|KIF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4319	16.148	3	1293.7153	1293.7153	L	R	1208	1221
PSM	KQLEDWLHSKS	2458	sp|Q92878|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9168	22.563	3	1369.699	1369.6990	K	K	574	585
PSM	KSEHPGLSIGDTAK	2459	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5902	18.329	3	1438.7416	1438.7416	I	K	114	128
PSM	KSGEVLVNVKEHS	2460	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5982	18.429	3	1424.7623	1424.7623	A	R	176	189
PSM	KSVIGHLQTKGS	2461	sp|O43837-3|IDH3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4959	17.04	3	1253.7092	1253.7092	I	-	222	234
PSM	KTHAVLVALK	2462	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6825	19.578	3	1078.6863	1078.6863	S	R	41	51
PSM	KTKDGLEVAVLPHNI	2463	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10265	23.879	3	1632.9199	1632.9199	E	R	646	661
PSM	KTKEELTEHI	2464	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5961	18.4	3	1226.6507	1226.6507	D	K	307	317
PSM	KTKPSDEEMLFIYGHY	2465	sp|P07108|ACBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11527	25.972	4	1956.9291	1956.9292	L	K	17	33
PSM	KTLKDYNTALSLH	2466	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8698	21.96	3	1502.8093	1502.8093	F	K	332	345
PSM	KVLELKEH	2467	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5126	17.274	2	994.58113	994.5811	D	K	85	93
PSM	KVLPGMHHPIQM	2468	sp|Q92879-5|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:35	ms_run[2]:scan=6042	18.509	3	1402.7213	1402.7213	M	K	66	78
PSM	KVYMHLPQTDNK	2469	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=4786	16.783	3	1488.7395	1488.7395	S	K	1306	1318
PSM	KWWTCFVK	2470	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4	ms_run[2]:scan=11572	26.071	2	1153.5743	1153.5743	S	R	158	166
PSM	RAGEVPKPFPTHY	2471	sp|Q86W56-3|PARG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8194	21.359	3	1497.7728	1497.7728	L	K	382	395
PSM	RALVDHENVISCPHLGAST	2472	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:4	ms_run[2]:scan=8907	22.231	4	2075.0218	2075.0218	D	K	270	289
PSM	RAPLPLGHIK	2473	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7235	20.183	3	1100.6818	1100.6818	Q	R	486	496
PSM	RAREAAIWELEE	2474	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10960	24.925	3	1471.7419	1471.7419	M	R	971	983
PSM	RASGTNDKPGGPHYIL	2475	sp|P30038-2|AL4A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7952	21.08	3	1681.8536	1681.8536	A	R	464	480
PSM	RCRLQEAC	2476	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=4049	15.556	2	1091.4964	1091.4964	Q	K	127	135
PSM	RDMGITLHLLLHSD	2477	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35	ms_run[2]:scan=11462	25.841	3	1635.8403	1635.8403	L	R	66	80
PSM	RDRDGYSYGS	2478	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4691	16.639	2	1174.5003	1174.5003	R	R	75	85
PSM	RDRNLQEGNLE	2479	sp|Q13445|TMED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5613	17.943	2	1342.6589	1342.6589	A	R	181	192
PSM	RELLKPNASVALH	2480	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7787	20.863	3	1446.8307	1446.8307	D	K	121	134
PSM	REQHPTKIPVIIE	2481	sp|Q9GZQ8|MLP3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9047	22.418	3	1558.8831	1558.8831	I	R	24	37
PSM	RERQEQLE	2482	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3854	15.154	2	1086.5418	1086.5418	E	R	245	253
PSM	RFKVLANQY	2483	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8817	22.116	2	1137.6295	1137.6295	E	K	194	203
PSM	RFNCPTKSTNMMGH	2484	sp|Q99442|SEC62_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=3799	15.051	3	1711.7229	1711.7229	L	R	29	43
PSM	RFRPLNESEVN	2485	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7457	20.456	2	1359.6895	1359.6895	C	R	14	25
PSM	RFVHGEGL	2486	sp|P30536|TSPO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6815	19.562	2	913.477	913.4770	S	R	24	32
PSM	RGIWHNDN	2487	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5714	18.076	2	1010.4682	1010.4682	A	K	215	223
PSM	RGKGIYLWDVEG	2488	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11663	26.258	3	1391.7197	1391.7197	E	R	64	76
PSM	RGKGYYDAYL	2489	sp|P49914-2|MTHFS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9564	23.034	2	1204.5877	1204.5877	G	K	124	134
PSM	RGLQKEEVVLLTHGDSVD	2490	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9810	23.31	4	1994.0433	1994.0433	F	K	42	60
PSM	RGREEYEGPN	2491	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4126	15.713	2	1205.5425	1205.5425	G	K	693	703
PSM	RGYSDRDGYG	2492	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4571	16.478	2	1144.4897	1144.4897	S	R	245	255
PSM	RHDSATDTIDIAPNH	2493	sp|P36897-3|TGFR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7071	19.949	3	1661.7758	1661.7758	V	R	280	295
PSM	RIRDQAWDDVV	2494	sp|O00566|MPP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10147	23.716	2	1371.6895	1371.6895	Q	R	432	443
PSM	RIRDVQCTG	2495	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4	ms_run[2]:scan=3971	15.384	2	1103.5506	1103.5506	G	R	330	339
PSM	RIRQNEINNP	2496	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4653	16.595	2	1252.6636	1252.6636	A	K	70	80
PSM	RKFGVFNYSPF	2497	sp|Q9ULU4-3|PKCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12174	27.802	2	1360.6928	1360.6928	R	R	210	221
PSM	RKNLVELAELEL	2498	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12361	28.64	2	1425.8191	1425.8191	F	K	258	270
PSM	RLAISEDHVASVK	2499	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7038	19.904	2	1423.7783	1423.7783	R	K	51	64
PSM	RLGIKPESVQPH	2500	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6173	18.678	3	1359.7623	1359.7623	E	R	87	99
PSM	RLKPPAGW	2501	sp|Q15269|PWP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8957	22.304	2	923.53412	923.5341	L	K	225	233
PSM	RLLFPPKDDHTL	2502	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9300	22.723	3	1450.7932	1450.7932	A	K	815	827
PSM	RLLSQEDHDKDTVQ	2503	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5148	17.304	3	1682.8224	1682.8224	E	K	415	429
PSM	RLREALLDES	2504	sp|Q9BU89|DOHH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8445	21.654	2	1200.6463	1200.6463	G	R	160	170
PSM	RLRQDLQD	2505	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4674	16.621	2	1042.552	1042.5520	S	R	1527	1535
PSM	RLSQTPHSQPPRPGTC	2506	sp|Q9UER7-3|DAXX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:4	ms_run[2]:scan=4540	16.445	3	1817.8955	1817.8955	A	K	630	646
PSM	RNFWSHET	2507	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8012	21.151	2	1075.4835	1075.4835	I	R	2522	2530
PSM	RPRWQALPAL	2508	sp|Q5TAQ9-2|DCAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11139	25.224	3	1206.6986	1206.6986	P	R	149	159
PSM	RQATKDAGTIAGLNVL	2509	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10997	24.975	3	1626.9053	1626.9053	Q	R	155	171
PSM	RQGTHITVVSHS	2510	sp|P11177-3|ODPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4452	16.318	3	1320.6898	1320.6898	E	R	214	226
PSM	RQLSILVHPDKNQDDAD	2511	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8111	21.265	4	1962.9759	1962.9759	F	R	78	95
PSM	RQQELTHQEH	2512	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3443	14.638	3	1304.6222	1304.6222	E	R	178	188
PSM	RQTPSRQPPLPH	2513	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4883	16.923	3	1412.7637	1412.7637	V	R	31	43
PSM	RRDLENFL	2514	sp|P46939-4|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10697	24.508	2	1061.5618	1061.5618	S	K	363	371
PSM	RRDVDFELI	2515	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11279	25.484	2	1161.6142	1161.6142	E	K	201	210
PSM	RRGGGVGVGGGGTGVGGGD	2516	sp|Q96G74-3|OTUD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4891	16.934	3	1527.7502	1527.7502	P	R	31	50
PSM	RRQGQELSAA	2517	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4047	15.553	2	1114.5843	1114.5843	R	R	125	135
PSM	RRSAVPPGAD	2518	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3702	14.932	2	1024.5414	1024.5414	Y	K	128	138
PSM	RRTAQEVETY	2519	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5147	17.302	2	1251.6208	1251.6208	A	R	67	77
PSM	RRYDDPEVQ	2520	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4998	17.099	2	1176.5523	1176.5523	G	K	126	135
PSM	RRYLESLGEEQ	2521	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8190	21.354	2	1378.6841	1378.6841	R	R	188	199
PSM	RTGVELGKPTHFTVNA	2522	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8594	21.828	3	1725.9162	1725.9162	S	K	884	900
PSM	RTIDDRIVHELNTTVPTASFAG	2523	sp|Q4VC31|CCD58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11688	26.32	3	2412.2397	2412.2397	M	K	24	46
PSM	RTRLAADVG	2524	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5165	17.332	2	957.53558	957.5356	A	K	138	147
PSM	RVADPDHDHTGFLTEYVAT	2525	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10750	24.596	4	2142.997	2142.9970	A	R	172	191
PSM	RVGDLILAHLH	2526	sp|Q53GS7-2|GLE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11062	25.085	3	1242.7197	1242.7197	P	K	515	526
PSM	RVRGGVPLV	2527	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7818	20.923	2	951.59778	951.5978	E	K	293	302
PSM	RVRIEAENE	2528	sp|Q06787-11|FMR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4824	16.845	2	1114.5731	1114.5731	V	K	315	324
PSM	RWANFHLENSGWQ	2529	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11356	25.613	3	1643.7593	1643.7593	L	K	230	243
PSM	RWRNGETVPIDEQFD	2530	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10166	23.736	3	1860.8755	1860.8755	N	K	367	382
PSM	RYPMAVGLNKGH	2531	sp|Q9Y3U8|RL36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=5580	17.882	3	1357.6925	1357.6925	L	K	4	16
PSM	KTHEAEIVEGENHTYCI	2532	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	16-UNIMOD:4	ms_run[1]:scan=8699	21.960738565066666	3	2028.921211	2028.921105	G	R	2184	2201
PSM	KVSVHVIEGDH	2533	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5972	18.415632437333333	3	1218.635858	1218.635686	G	R	2471	2482
PSM	KHWPFMVVNDAGRP	2534	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:35	ms_run[1]:scan=9800	23.300140135466666	3	1669.817886	1668.819481	M	K	88	102
PSM	RGCHLLVATPGRLVDMME	2535	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	3-UNIMOD:4,17-UNIMOD:35	ms_run[1]:scan=10505	24.206096619733334	3	2070.0205	2070.0167	E	R	315	333
PSM	KHPVSALMEICNK	2536	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=7170	20.092213005066665	3	1543.776507	1541.769420	G	R	2370	2383
PSM	KFICNDDFKH	2537	sp|Q13620|CUL4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=6840	19.605943473066667	3	1322.607508	1322.607757	D	K	807	817
PSM	KEHMDEVCSSQLLTSVR	2538	sp|Q15154|PCM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=8765	22.043156601866666	4	2033.949838	2033.951025	L	R	1609	1626
PSM	KIGLPHSIKLS	2539	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9126	22.508928469866664	3	1191.733867	1191.733943	G	R	111	122
PSM	KPKIDQLEGDHQLIQEALIFDN	2540	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=12262	28.179035057866667	3	2564.335837	2563.328218	Y	K	682	704
PSM	KQEGHNLGLLHGDMDQSE	2541	sp|Q86XP3|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8498	21.719835702933334	3	2007.952222	2006.911603	L	R	519	537
PSM	KKALGGDVSDQSLESHSQ	2542	sp|Q9UKJ3|GPTC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5860	18.262266892	3	1884.919127	1884.917734	A	K	483	501
PSM	KSMTEKEQQQLIDDHFLFD	2543	sp|P06732|KCRM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=11696	26.336249415733334	3	2351.076647	2351.110362	L	K	177	196
PSM	RLPPHGYPLEHPFN	2544	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9218	22.624331836800003	3	1672.846070	1672.847410	Q	K	324	338
PSM	KEITEKYPEWLQSH	2545	sp|P40855|PEX19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=9677	23.148228384266666	3	1786.8861	1786.8885	L	R	193	207
PSM	KVNLQNNPGAMEHFHM	2546	sp|P51572|BAP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=6805	19.545387715733334	3	1897.857211	1897.856337	E	K	79	95
PSM	RALELDHKNAQAQQEF	2547	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8006	21.1434956832	3	1896.945856	1896.944223	Q	K	121	137
PSM	RRLEASDGGLDSAELAAELGMEHQAVVGAV	2548	sp|Q9Y285|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	21-UNIMOD:35	ms_run[1]:scan=11977	27.101233704533335	4	3066.506310	3066.504027	L	K	12	42
PSM	KFEYLLYGHH	2549	sp|O43829|ZBT14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9905	23.41492041813333	3	1306.655592	1305.650607	M	R	264	274
PSM	KKLAAGHELQPLAIVDQ	2550	sp|P17302|CXA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10092	23.653260657066667	3	1830.037021	1830.036333	S	R	345	362
PSM	RYFQHLLG	2551	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9848	23.356702416	2	1032.555881	1032.550499	L	K	98	106
PSM	KIGLPHSIKLS	2552	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9221	22.628336232	3	1191.733867	1191.733943	G	R	111	122
PSM	RKGPELPLVPVK	2553	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9124	22.507391048	2	1331.829135	1331.828906	K	R	7	19
PSM	KRIEPAEELNSNDMKTN	2554	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:35	ms_run[1]:scan=5573	17.872902673333332	3	2003.958578	2003.958219	A	K	3057	3074
PSM	KEVMTHINEDK	2555	sp|Q9H8V3|ECT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=3566	14.770727869866667	3	1358.647957	1358.650016	L	R	632	643
PSM	KKAVLFCLSEDK	2556	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=9005	22.365975270933333	3	1436.768150	1436.769737	R	K	33	45
PSM	KTFNLEKQNHTP	2557	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5938	18.372424459999998	3	1455.746785	1455.747027	N	R	5	17
PSM	KPQEPGHFYSEH	2558	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5449	17.709128940533333	3	1454.657716	1454.657878	C	R	255	267
PSM	RVVDLMAHMASKE	2559	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7315	20.290368014133332	3	1486.717290	1485.743204	N	-	323	336
PSM	KKVEQPVIEEPALK	2560	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7761	20.8312812488	3	1606.928278	1606.929408	K	R	274	288
PSM	KFKILDAVVAQEPLH	2561	sp|Q15029|U5S1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=11673	26.284999511733336	3	1706.967139	1706.971942	V	R	788	803
PSM	RMQEHIVCLTDEIR	2562	sp|Q8IW35|CEP97_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=9165	22.558228117333332	3	1814.880271	1814.876738	R	R	592	606
PSM	RKNQDEESQEAPELLK	2563	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7094	19.982813759733332	4	1912.948614	1912.949034	R	R	588	604
PSM	RYQDIIHSIHLA	2564	sp|Q9UIG0|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=11256	25.446275961333335	3	1465.785190	1464.783747	K	R	1024	1036
PSM	KKISSIQSIVPALEIANAH	2565	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=11690	26.324405513333332	3	2018.151840	2018.152425	E	R	249	268
PSM	RYGDGGSTFQSTTGHCVHM	2566	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	16-UNIMOD:4	ms_run[1]:scan=8293	21.4713602768	3	2097.865560	2096.879257	H	R	275	294
PSM	KKTTDTASVQNEAKLDEIL	2567	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10095	23.65558342106667	3	2103.103233	2103.105929	P	K	427	446
PSM	RHQQEAATTQLEQLHQEA	2568	sp|Q9BV73|CP250_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7975	21.106131364533333	3	2117.044875	2117.024993	S	K	700	718
PSM	KAAHIFNEALVCHQI	2569	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=10008	23.53	3	1749.8985	1749.8985	K	R	602	617
PSM	KAHQNLSHIPLAQQQLM	2570	sp|Q9HCJ3-2|RAVR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:35	ms_run[2]:scan=8404	21.608	4	1972.0313	1972.0313	N	K	394	411
PSM	KAHQNLSHIPLAQQQLM	2571	sp|Q9HCJ3-2|RAVR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:35	ms_run[2]:scan=8425	21.632	4	1972.0313	1972.0313	N	K	394	411
PSM	KAHVVPCFDASKV	2572	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4	ms_run[2]:scan=8410	21.615	3	1456.7497	1456.7497	F	K	1151	1164
PSM	KANHPMDAEVTKA	2573	sp|O95782-2|AP2A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4512	16.406	3	1410.6925	1410.6925	F	K	872	885
PSM	KANNIDYTVHSVR	2574	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6386	18.962	3	1515.7794	1515.7794	L	R	467	480
PSM	KCGHLCPAPCHDQALI	2575	sp|Q6ZNB6-2|NFXL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7935	21.055	3	1875.8542	1875.8542	E	K	588	604
PSM	KEIYHFTLEKIQP	2576	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10571	24.303	4	1644.8875	1644.8875	A	R	82	95
PSM	KEKLFNEHIEALT	2577	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9629	23.102	3	1570.8355	1570.8355	E	K	921	934
PSM	KGKISIVEALTLLNNH	2578	sp|Q9P032|NDUF4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12325	28.465	4	1749.0149	1749.0149	P	K	111	127
PSM	KHQEYLNSILQHA	2579	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10082	23.644	3	1579.8107	1579.8107	Q	K	447	460
PSM	KINHSNNAIVKPPEMTPQAAA	2580	sp|Q8WXA9|SREK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:35	ms_run[2]:scan=6507	19.123	4	2246.1478	2246.1478	L	K	136	157
PSM	KIRIFDLG	2581	sp|Q96L21|RL10L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11266	25.461	2	960.57565	960.5757	A	R	30	38
PSM	KKANVVALVAVAEHSGEFE	2582	sp|Q17R31-5|TATD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11577	26.08	3	1997.0582	1997.0582	A	K	32	51
PSM	KKLDESIYDVAFHSS	2583	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10894	24.81	3	1737.8574	1737.8574	R	K	682	697
PSM	KLHPDVPTDKNL	2584	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7278	20.249	3	1375.746	1375.7460	T	K	774	786
PSM	KLITQTFSHHNQLAQ	2585	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7802	20.889	4	1764.9271	1764.9271	E	K	53	68
PSM	KLNGPQDHSHLLYSTIP	2586	sp|O60716-13|CTND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9991	23.514	3	1918.9901	1918.9901	L	R	30	47
PSM	KLQLEAENYEGHTPLHVAVIH	2587	sp|Q15653-2|IKBB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10221	23.826	4	2397.2441	2397.2441	W	K	197	218
PSM	KLREVVETPLLHPE	2588	sp|P35998-2|PRS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9603	23.073	4	1658.9356	1658.9356	E	R	49	63
PSM	KMLLENKNHETVAAEY	2589	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35	ms_run[2]:scan=7104	19.995	3	1904.9302	1904.9302	E	K	1224	1240
PSM	KQHSSTSPFPTSTPLR	2590	sp|Q13111-2|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7939	21.059	3	1769.906	1769.9060	P	R	304	320
PSM	KQLPHFTSEHI	2591	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8187	21.352	3	1335.6935	1335.6935	L	K	1961	1972
PSM	KQTQPERYIHLENLLA	2592	sp|Q2TAY7|SMU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11256	25.446	4	1952.048	1952.0480	L	R	107	123
PSM	KTTIHQLTMQKEEDTSGY	2593	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=7039	19.905	3	2124.9997	2124.9997	T	R	1374	1392
PSM	KVGQGYPHDPPKV	2594	sp|P61081|UBC12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6097	18.576	4	1420.7463	1420.7463	F	K	81	94
PSM	KVGQGYPHDPPKV	2595	sp|P61081|UBC12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6035	18.502	3	1420.7463	1420.7463	F	K	81	94
PSM	KVIQWCTHH	2596	sp|P63208-2|SKP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4	ms_run[2]:scan=6539	19.164	3	1207.592	1207.5920	K	K	57	66
PSM	KVPDNKNTHTLLLAGVF	2597	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11792	26.577	3	1866.0363	1866.0363	D	R	818	835
PSM	KVPHLIDHQISSGENT	2598	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7627	20.669	3	1773.901	1773.9010	E	R	769	785
PSM	KYLDNIHLHPEEE	2599	sp|Q9BZV1-2|UBXN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8932	22.27	3	1635.7893	1635.7893	A	K	127	140
PSM	RAEHTPMAPGGSTH	2600	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:35	ms_run[2]:scan=3588	14.793	3	1463.6576	1463.6576	E	R	487	501
PSM	RAQFEGIVTDLIR	2601	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12205	27.926	3	1516.8362	1516.8362	T	R	348	361
PSM	RARYLENYDAI	2602	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9484	22.938	3	1382.6943	1382.6943	E	R	134	145
PSM	RCREMDEQI	2603	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4,5-UNIMOD:35	ms_run[2]:scan=4550	16.456	2	1251.5336	1251.5336	S	R	153	162
PSM	RDSEPFSNPLAPDGHDVDDPHSFHQS	2604	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9910	23.419	4	2902.2543	2902.2543	E	K	4	30
PSM	REMPIRFADFGVLH	2605	sp|A2RTX5|SYTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35	ms_run[2]:scan=11472	25.863	4	1702.8613	1702.8613	W	R	507	521
PSM	RERLEQEQLE	2606	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6138	18.633	2	1328.6684	1328.6684	E	R	183	193
PSM	REVLEHPWITANSSKPSNCQN	2607	sp|O14965|AURKA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	19-UNIMOD:4	ms_run[2]:scan=8743	22.015	4	2466.171	2466.1710	L	K	375	396
PSM	RFATDRNDF	2608	sp|Q96B49|TOM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7475	20.48	3	1140.5312	1140.5312	Y	R	33	42
PSM	RFHINWDNNMD	2609	sp|Q9NVP2|ASF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=10104	23.665	3	1476.6204	1476.6204	T	R	148	159
PSM	RFTLRDGN	2610	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6493	19.1	2	977.50428	977.5043	Q	R	421	429
PSM	RGPQPDRTHPSAAVPVCP	2611	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:4	ms_run[2]:scan=6881	19.662	3	1940.9639	1940.9639	A	R	308	326
PSM	RHLWSPFGL	2612	sp|Q13724-2|MOGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12213	27.961	2	1111.5927	1111.5927	S	R	614	623
PSM	RHSFFSTIDWN	2613	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11907	26.873	3	1408.6524	1408.6524	K	K	323	334
PSM	RHVQLAFFPPGTVHPLE	2614	sp|P07199|CENPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11566	26.051	3	1944.037	1944.0370	L	R	310	327
PSM	RHYLSEEL	2615	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8495	21.717	2	1045.5193	1045.5193	I	R	488	496
PSM	RIKWDEYGEII	2616	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11765	26.503	3	1420.7351	1420.7351	E	K	470	481
PSM	RIRELEEAMAGE	2617	sp|Q03252|LMNB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=7092	19.98	2	1418.6824	1418.6824	D	R	334	346
PSM	RIRQLEEE	2618	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5404	17.647	2	1071.5673	1071.5673	S	K	1337	1345
PSM	RIRSIEALLEAGQA	2619	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11871	26.771	3	1525.8576	1525.8576	E	R	523	537
PSM	RIVRDYDVYA	2620	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8343	21.534	2	1268.6513	1268.6513	T	R	208	218
PSM	RKAFLDNGP	2621	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7234	20.181	2	1016.5403	1016.5403	P	K	312	321
PSM	RKFLPLFD	2622	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11860	26.74	2	1034.5913	1034.5913	F	R	7	15
PSM	RKIDYSWIAAL	2623	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12367	28.665	2	1334.7347	1334.7347	F	-	820	831
PSM	RKLDELYGTW	2624	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11029	25.035	2	1279.6561	1279.6561	F	R	258	268
PSM	RKWISDWNLTTE	2625	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11456	25.826	3	1547.7732	1547.7732	V	K	148	160
PSM	RKYGLNMC	2626	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=5079	17.216	2	1056.4845	1056.4845	I	R	32	40
PSM	RLAHEVGW	2627	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8309	21.494	2	966.50355	966.5035	G	K	140	148
PSM	RLRDVAALNGLY	2628	sp|Q5UCC4-2|EMC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10827	24.713	3	1359.7623	1359.7623	G	R	97	109
PSM	RLREAAALGDI	2629	sp|Q6AI12|ANR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9465	22.919	3	1183.6673	1183.6673	E	R	13	24
PSM	RLRSQGCNDEY	2630	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4	ms_run[2]:scan=4578	16.489	2	1396.6154	1396.6154	R	K	333	344
PSM	RLSSVVTQHDSK	2631	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4608	16.539	2	1355.7157	1355.7157	Y	K	135	147
PSM	RLYQTDPSGTYHAWKANAIG	2632	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9601	23.071	4	2248.1025	2248.1025	P	R	73	93
PSM	RMEELNSEKH	2633	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35	ms_run[2]:scan=3471	14.67	3	1287.5877	1287.5877	K	R	360	370
PSM	RNKFEEAE	2634	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4549	16.455	2	1021.4829	1021.4829	A	R	371	379
PSM	RNRTPSDV	2635	sp|O95626|AN32D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3693	14.921	2	943.48354	943.4835	L	K	12	20
PSM	RPKVQVEY	2636	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6658	19.325	2	1017.5607	1017.5607	G	K	100	108
PSM	RQEITDKDHTVS	2637	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3800	15.053	3	1427.7005	1427.7005	N	R	928	940
PSM	RQKFGYSVN	2638	sp|Q9Y3C1|NOP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6568	19.207	2	1097.5618	1097.5618	R	R	10	19
PSM	RRAFSEADME	2639	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=4767	16.76	2	1226.535	1226.5350	P	R	266	276
PSM	RRCPGESLINPGF	2640	sp|Q9BUH6|PAXX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4	ms_run[2]:scan=10305	23.931	3	1501.746	1501.7460	R	K	178	191
PSM	RRDDAYWPEA	2641	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9321	22.746	2	1277.5789	1277.5789	D	K	649	659
PSM	RRDLAQALIN	2642	sp|P46087-3|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9319	22.742	2	1168.6677	1168.6677	R	R	317	327
PSM	RRDLPLLLF	2643	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12508	29.354	2	1141.6972	1141.6972	L	R	460	469
PSM	RRDSIVAELD	2644	sp|O14579-3|COPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9023	22.388	2	1172.6149	1172.6149	S	R	96	106
PSM	RREQQLAEIEA	2645	sp|Q5JPE7-3|NOMO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7632	20.673	2	1341.7001	1341.7001	L	R	539	550
PSM	RRFDDAVVQSDM	2646	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8751	22.025	3	1437.6671	1437.6671	G	K	76	88
PSM	RRFEEELAA	2647	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7676	20.732	2	1119.5673	1119.5673	L	R	348	357
PSM	RRFLLDTN	2648	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9003	22.364	2	1033.5669	1033.5669	R	K	189	197
PSM	RRFPPYYM	2649	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35	ms_run[2]:scan=7973	21.104	2	1144.5488	1144.5488	R	R	191	199
PSM	RRFYEQMNGPVAGAS	2650	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:35	ms_run[2]:scan=6983	19.822	3	1697.7944	1697.7944	E	R	23	38
PSM	RRGDVLAAWSGI	2651	sp|P43304-2|GPDM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11899	26.85	3	1299.7048	1299.7048	V	R	264	276
PSM	RRGPAEESSSW	2652	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6309	18.858	2	1260.5847	1260.5847	W	R	1215	1226
PSM	RRGPCIIYNEDNGII	2653	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:4	ms_run[2]:scan=10754	24.601	2	1788.8941	1788.8941	Q	K	204	219
PSM	RRIPLAEWES	2654	sp|P31930|QCR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9894	23.404	2	1255.6673	1255.6673	G	R	422	432
PSM	RRIVLVDD	2655	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7658	20.709	2	984.57163	984.5716	D	R	596	604
PSM	RRLEAAYLDLQ	2656	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10135	23.701	3	1346.7306	1346.7306	Q	R	69	80
PSM	RRLPEESGG	2657	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3936	15.325	2	999.50976	999.5098	K	R	598	607
PSM	RRLSYNTASN	2658	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4485	16.362	2	1180.5949	1180.5949	R	K	9	19
PSM	RRLVGTTNQGDQ	2659	sp|Q6ZRS2-3|SRCAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4092	15.631	2	1343.6906	1343.6906	P	R	3036	3048
PSM	RRPVQAWVESL	2660	sp|Q9BYD3-2|RM04_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11318	25.546	2	1339.7361	1339.7361	H	R	59	70
PSM	RRQQQLEEM	2661	sp|P55196-3|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=3738	14.97	2	1232.5932	1232.5932	R	R	1594	1603
PSM	RRVVYPLE	2662	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7978	21.111	2	1030.5924	1030.5924	L	K	283	291
PSM	RRWEVADLQPQL	2663	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11478	25.876	3	1509.8052	1509.8052	F	K	147	159
PSM	RSGESNTHQDIEEKD	2664	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3533	14.737	3	1743.766	1743.7660	N	R	462	477
PSM	RSKNNWNDVDDFNWLA	2665	sp|Q15814|TBCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12338	28.529	3	1992.9078	1992.9078	D	R	310	326
PSM	RSRNTDEMVEL	2666	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35	ms_run[2]:scan=6887	19.671	2	1364.6354	1364.6354	K	R	35	46
PSM	RSWSSRDDYS	2667	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5909	18.336	3	1257.5374	1257.5374	D	R	269	279
PSM	RTTEEALHASHGFMWYT	2668	sp|Q9P0J0|NDUAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11018	25.017	3	2035.921	2035.9210	L	-	128	145
PSM	RVTDKLTPIHD	2669	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6670	19.347	3	1293.7041	1293.7041	N	R	63	74
PSM	RYELPTDDDTYEEHR	2670	sp|Q9P0P0|RN181_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8142	21.298	4	1937.8391	1937.8391	C	R	117	132
PSM	RYLFPVPKDDSH	2671	sp|Q96G21|IMP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9205	22.607	3	1472.7412	1472.7412	L	R	204	216
PSM	RYLTEHPDPNNENIVGYNNK	2672	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8137	21.294	4	2386.1302	2386.1302	Q	K	1112	1132
PSM	KALEHAFQLEHIMDLT	2673	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=12059	27.38297573173333	3	1894.960989	1894.961119	T	R	2435	2451
PSM	KPLWHVFKPPPALEC	2674	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	15-UNIMOD:4	ms_run[1]:scan=11184	25.305647773066667	3	1818.947978	1817.965083	A	R	1247	1262
PSM	RLLFPPKDDHTL	2675	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9280	22.70119202	3	1450.788345	1450.793249	A	K	815	827
PSM	RGHLLYVALSPGQH	2676	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=9464	22.918319682666667	3	1546.8344	1546.8363	G	R	848	862
PSM	RLGIKPESVQPH	2677	sp|Q16527|CSRP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6152	18.649337185866667	3	1359.761797	1359.762283	E	R	87	99
PSM	RLVLTQEQLHQLHS	2678	sp|Q14203|DCTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9051	22.4205812336	3	1700.931410	1700.932202	H	R	1261	1275
PSM	RDAMHEMEEMIETKG	2679	sp|P78316|NOP14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35,7-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=4500	16.389560293866666	3	1853.760466	1853.759385	L	R	522	537
PSM	KNPSDPKLAHL	2680	sp|Q14739|LBR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6270	18.8116715072	3	1218.672013	1218.672071	R	K	513	524
PSM	KMNMNILHQEELIAQK	2681	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	2-UNIMOD:35	ms_run[1]:scan=9546	23.008887670666663	3	1957.0432	1954.9962	G	K	27	43
PSM	RAPLPLGHIK	2682	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7276	20.2471015888	3	1100.681365	1100.681848	Q	R	510	520
PSM	RKVQSGNINAA	2683	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3775	15.020159029866667	2	1156.639890	1156.631269	G	K	20	31
PSM	RLPPASVDHVLQEH	2684	sp|Q6ZRI6|CO039_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8346	21.537080816	3	1598.847085	1596.837239	P	R	856	870
PSM	KPQHYPSIHITAYENDE	2685	sp|Q4J6C6|PPCEL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9232	22.641714952533334	3	2040.957146	2040.954120	I	R	630	647
PSM	RWLHNEDQMAVE	2686	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:35	ms_run[1]:scan=7170	20.092213005066665	3	1542.689414	1542.688526	F	K	295	307
PSM	KPHTVPCKVTG	2687	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=3795	15.0451110024	2	1222.651730	1222.649228	G	R	176	187
PSM	RYPMAVGLNKGH	2688	sp|Q9Y3U8|RL36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35	ms_run[1]:scan=5749	18.120471989866665	3	1357.692473	1357.692489	L	K	4	16
PSM	RVASLLEHHALQLCQQTG	2689	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4	ms_run[1]:scan=9876	23.384535256533333	3	2060.071945	2060.058542	G	R	202	220
PSM	RLLSQEDHDKDTVQ	2690	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5115	17.262286023733335	3	1682.823858	1682.822377	E	K	415	429
PSM	RRGGGVGVGGGGTGVGGGD	2691	sp|Q96G74|OTUD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4859	16.893542379733333	3	1527.748348	1527.750215	P	R	31	50
PSM	RHQPGLLLQQKPPDDPVV	2692	sp|Q5VWN6|TASO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9734	23.2099217888	3	2038.106521	2036.116709	F	K	699	717
PSM	KLKQQIAEDPELTHSSSN	2693	sp|Q9ULC3|RAB23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6538	19.16323611973333	3	2025.021543	2024.017448	Q	K	172	190
PSM	RRQQEELLAEENQ	2694	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=7089	19.9777910864	3	1641.8392	1641.8062	Q	R	2717	2730
PSM	RGAIVHYTILNNHVY	2695	sp|Q7Z4H8|PLGT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9870	23.3795272968	3	1768.932140	1768.937288	E	R	190	205
PSM	KMKGTLIDNQFK	2696	sp|Q9H5V9|CX056_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=6912	19.7053137168	3	1437.760583	1437.764986	A	-	211	223
PSM	KKVVVEQLNLLVK	2697	sp|P34949|MPI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10129	23.693060280533334	3	1508.965841	1508.965400	E	R	206	219
PSM	KKMSADNQLQVIFITNDR	2698	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=10783	24.64670418533333	4	2136.100630	2136.099738	L	R	161	179
PSM	KKVAPAPAVVK	2699	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4045	15.550863833333333	3	1106.717511	1106.717565	G	K	10	21
PSM	KTSKAGVQEFVDGLHE	2700	sp|Q9UK61|TASOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9924	23.431032863466665	3	1744.886487	1743.879164	S	K	1068	1084
PSM	RYDHLDPTEMEKVE	2701	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9023	22.38757315173333	3	1760.802803	1760.803950	E	K	725	739
PSM	KAERELSEQIQ	2702	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5510	17.7892448376	2	1329.714445	1329.688844	K	R	360	371
PSM	KAHEQALAELTK	2703	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6692	19.379630323733334	3	1339.736682	1337.730314	S	R	780	792
PSM	KTLLHLGSSAPGKE	2704	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7212	20.149700172266666	3	1437.786420	1436.798728	N	K	717	731
PSM	KEEEEKQVVEAE	2705	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3361	14.522472764000002	3	1446.719574	1445.688569	I	K	910	922
PSM	KKANGPNYIQPQK	2706	sp|Q76FK4|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4509	16.4021331512	3	1484.810604	1484.809962	A	R	634	647
PSM	KKKGPEPVPLEFIPAQGLLG	2707	sp|Q9BVI4|NOC4L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=12316	28.425031207466667	4	2117.226184	2117.224862	L	R	484	504
PSM	KKFESLFPGKLEVV	2708	sp|Q13045|FLII_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=11524	25.966366135999998	3	1619.930184	1619.928680	Q	R	1006	1020
PSM	KKLDPGWNPQIPEK	2709	sp|Q9BR61|ACBD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8578	21.8116267704	3	1649.881890	1648.893691	V	K	119	133
PSM	RVVEVVEETIKGHSV	2710	sp|Q5VV42|CDKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10659	24.44571366746667	3	1679.910821	1679.920634	D	R	162	177
PSM	KKPESEGYLQEEKQ	2711	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5055	17.1828406008	3	1691.835469	1691.836630	T	K	221	235
PSM	KKAEAVVNTVDISERE	2712	sp|Q8IY81|SPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7494	20.5043064032	3	1786.943494	1786.942492	R	K	762	778
PSM	KKGTVEGFEPADNKCLL	2713	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	15-UNIMOD:4	ms_run[1]:scan=9625	23.09696844773333	3	1904.967064	1904.966599	P	R	42	59
PSM	KKLENCNYAVELGKNQA	2714	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=7617	20.656590650133335	3	1977.991201	1977.994210	M	K	455	472
PSM	KKNSSQDDLFPTSDTPRA	2715	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8144	21.302176313333334	3	2005.970702	2005.970498	S	K	477	495
PSM	RSGTPMKEAVGHTGYLTFAT	2716	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35	ms_run[1]:scan=9292	22.714025109866668	3	2139.039165	2139.041889	F	K	266	286
PSM	RLGCHPQTGFADIQGHPFF	2717	sp|P41743|KPCI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:4	ms_run[1]:scan=11611	26.146942096533333	3	2184.035537	2184.032327	E	R	504	523
PSM	KRDAEDAMDAMDGAVLDGREL	2718	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=9081	22.456335022666668	3	2309.029030	2309.026375	D	R	65	86
PSM	RHLVLLDTAQAAAAGH	2719	sp|O00754|MA2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9844	23.347104241066667	2	1642.903127	1642.890337	G	R	841	857
PSM	RSTPAEDDSPGDSQVKSEVQQPVHP	2720	sp|Q9UHB6-4|LIMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6381	18.95580177733333	4	2690.284707	2689.257966	V	K	335	360
PSM	KAGDLRDTGIFLDLMHL	2721	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	15-UNIMOD:35	ms_run[2]:scan=12487	29.253	3	1929.9982	1929.9982	T	K	148	165
PSM	KAGKLDPHLVLDQL	2722	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11415	25.739	3	1545.8879	1545.8879	K	R	679	693
PSM	KAKWDAWNEL	2723	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11321	25.55	2	1259.6299	1259.6299	G	K	53	63
PSM	KAPQHAQQSIRE	2724	sp|P20248|CCNA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3615	14.838	3	1391.727	1391.7270	L	K	400	412
PSM	KEAEKELHE	2725	sp|Q14141-2|SEPT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3548	14.754	3	1111.551	1111.5510	L	K	358	367
PSM	KEHVNVVFIGHVDAG	2726	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9635	23.106	3	1619.842	1619.8420	K	K	72	87
PSM	KEINNAHAILTDATK	2727	sp|Q9H3Z4-2|DNJC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7750	20.818	3	1637.8737	1637.8737	F	R	58	73
PSM	KEKGPQNATDSYVH	2728	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4508	16.401	3	1572.7532	1572.7532	L	K	66	80
PSM	KGWLSLHTGNLDGEDHAAE	2729	sp|Q96EL2|RT24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10102	23.664	4	2048.9552	2048.9552	R	R	66	85
PSM	KHLEEIVEKL	2730	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9457	22.91	2	1236.7078	1236.7078	V	K	742	752
PSM	KHLNEIDLFHCIDPNDS	2731	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:4	ms_run[2]:scan=11493	25.913	3	2065.9527	2065.9527	F	K	48	65
PSM	KHNGPNDASDGTVRL	2732	sp|P31942-2|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5859	18.262	3	1579.7703	1579.7703	M	R	6	21
PSM	KHPAKPDPSGECNPDL	2733	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	12-UNIMOD:4	ms_run[2]:scan=5196	17.364	3	1760.8152	1760.8152	T	R	155	171
PSM	KHTADENPDKSTLE	2734	sp|Q9H8V3-2|ECT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3938	15.328	3	1583.7427	1583.7427	K	K	580	594
PSM	KILTTASSHEFEHT	2735	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6953	19.776	2	1599.7893	1599.7893	E	K	27	41
PSM	KITSVAWSPHHDG	2736	sp|Q8TEQ6|GEMI5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7074	19.959	2	1433.7052	1433.7052	A	R	641	654
PSM	KKFEEIPIAHI	2737	sp|P82912-2|RT11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9913	23.421	3	1323.7551	1323.7551	G	K	77	88
PSM	KKLLELDSFL	2738	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12295	28.328	2	1204.7067	1204.7067	P	K	36	46
PSM	KKNGPLEVAGAAVSAGHGLPA	2739	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10019	23.542	4	1943.0589	1943.0589	R	K	247	268
PSM	KKWAEQYL	2740	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9363	22.793	2	1064.5655	1064.5655	Q	K	196	204
PSM	KLCLQHEDLAK	2741	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=6726	19.428	3	1353.7075	1353.7075	G	K	929	940
PSM	KLDKAQIHDLVLVGGST	2742	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10270	23.886	2	1793.0047	1793.0047	A	R	325	342
PSM	KLFSEVVHKES	2743	sp|Q02224-3|CENPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7167	20.088	3	1301.698	1301.6980	D	R	754	765
PSM	KLISSDGHEFIVK	2744	sp|Q15369-2|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8806	22.101	3	1471.8035	1471.8035	V	R	4	17
PSM	KNKWFFQ	2745	sp|P61353|RL27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10794	24.664	2	996.51814	996.5181	G	K	126	133
PSM	KNLSDSEKELYIQHA	2746	sp|Q00059|TFAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8500	21.722	2	1773.8897	1773.8897	W	K	190	205
PSM	KNRDVEETLFQVAHDPDCGDVV	2747	sp|Q96BW9-2|TAM41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	18-UNIMOD:4	ms_run[2]:scan=11824	26.656	4	2542.1758	2542.1758	G	R	268	290
PSM	KQLLHLAEEKQT	2748	sp|Q00341-2|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6912	19.705	3	1436.7987	1436.7987	K	K	681	693
PSM	KRDLEWVE	2749	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8981	22.34	2	1073.5506	1073.5506	F	R	61	69
PSM	KRFEELGV	2750	sp|Q04760-2|LGUL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8626	21.865	2	976.53418	976.5342	C	K	125	133
PSM	KRTYEEGL	2751	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5908	18.335	2	994.50836	994.5084	A	K	92	100
PSM	KSNSFFEGVDWEHIRE	2752	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11758	26.488	3	1978.9173	1978.9173	I	R	377	393
PSM	KSVNVKPLVTH	2753	sp|Q00796|DHSO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5526	17.809	3	1220.7241	1220.7241	S	R	314	325
PSM	KTKSCSGVEFSTSGHAYTDTG	2754	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4	ms_run[2]:scan=7091	19.98	4	2218.9801	2218.9801	L	K	32	53
PSM	KTSQVPVKHVY	2755	sp|Q9NXV2|KCTD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4924	16.989	3	1284.719	1284.7190	S	R	148	159
PSM	KVSVHVIEGDH	2756	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5952	18.388	2	1218.6357	1218.6357	G	R	2471	2482
PSM	KYTPPPHHIG	2757	sp|O43920|NDUS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4416	16.268	3	1145.5982	1145.5982	G	K	91	101
PSM	RASGNYATVISHNPETK	2758	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6561	19.198	4	1843.9177	1843.9177	A	K	128	145
PSM	RASPGHSPHYFAASSPTSPNALPPA	2759	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8831	22.134	4	2516.2197	2516.2197	P	R	1846	1871
PSM	RAVGWWK	2760	sp|Q15041-2|AR6P1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9286	22.707	2	901.49226	901.4923	R	R	89	96
PSM	RAVMLLHTHTITS	2761	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=7436	20.431	3	1494.7977	1494.7977	K	R	949	962
PSM	RDHPLPEVAHV	2762	sp|P13073|COX41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7485	20.494	3	1268.6626	1268.6626	R	K	42	53
PSM	REIVEHMVQHF	2763	sp|Q9UKV8-2|AGO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8850	22.158	3	1423.7031	1423.7031	N	K	72	83
PSM	RERDSASFNPELLTHILDGSPE	2764	sp|Q15067-2|ACOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12480	29.216	4	2482.2088	2482.2088	R	K	7	29
PSM	RERELEECQ	2765	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=4136	15.735	2	1247.5564	1247.5564	E	R	101	110
PSM	RERFQNLD	2766	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6274	18.818	2	1076.5363	1076.5363	A	K	299	307
PSM	RERLETAN	2767	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3647	14.873	2	987.50976	987.5098	L	K	512	520
PSM	REVSEEHNLLPQPPRS	2768	sp|P49005|DPOD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8182	21.345	3	1886.9599	1886.9599	L	K	109	125
PSM	RFDHYLNPYY	2769	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10788	24.655	2	1386.6357	1386.6357	L	K	244	254
PSM	RFHLGLFTD	2770	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12036	27.297	2	1104.5716	1104.5716	E	R	890	899
PSM	RFQDTVSQHVVKVDFLN	2771	sp|Q96QT6-2|PHF12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11187	25.31	3	2031.0538	2031.0538	D	R	340	357
PSM	RFRPAGAAP	2772	sp|Q5JNZ5|RS26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5166	17.332	2	941.51953	941.5195	P	R	100	109
PSM	RFYFWTK	2773	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11178	25.294	2	1046.5338	1046.5338	S	-	166	173
PSM	RGFFHGV	2774	sp|P53007|TXTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8872	22.185	2	818.41876	818.4188	Y	R	162	169
PSM	RGHLLYVALSPGQH	2775	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9481	22.935	2	1546.8368	1546.8368	G	R	848	862
PSM	RGSATTPRGVLHTFSPSP	2776	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9093	22.471	3	1866.97	1866.9700	S	K	507	525
PSM	RHLTGEFE	2777	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6318	18.87	2	987.47739	987.4774	K	K	29	37
PSM	RHMYVFGDF	2778	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11740	26.45	2	1170.528	1170.5280	F	K	327	336
PSM	RHPWDDISYVLPEHMSM	2779	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12435	29.006	3	2111.9557	2111.9557	Y	-	814	831
PSM	RIHNQNNEQAW	2780	sp|P53701|CCHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6099	18.578	3	1408.6596	1408.6596	I	K	152	163
PSM	RIKFSDD	2781	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5815	18.201	2	879.44503	879.4450	Q	R	24	31
PSM	RIRITLTS	2782	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8505	21.726	2	958.59236	958.5924	H	R	19	27
PSM	RITKADAAEFW	2783	sp|Q13191-3|CBLB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10514	24.218	3	1306.667	1306.6670	F	R	172	183
PSM	RITKADAAEFW	2784	sp|Q13191-3|CBLB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10545	24.264	3	1306.667	1306.6670	F	R	172	183
PSM	RKANYAVDAYF	2785	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10310	23.937	3	1316.6513	1316.6513	E	R	738	749
PSM	RKAWENSPNV	2786	sp|Q9Y520-3|PRC2C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6814	19.562	2	1199.6047	1199.6047	A	R	2254	2264
PSM	RKDAEAWFNE	2787	sp|Q7Z3Y7|K1C28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9751	23.239	2	1264.5836	1264.5836	N	K	274	284
PSM	RKESYSVYVY	2788	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8990	22.351	2	1292.6401	1292.6401	S	K	34	44
PSM	RKILFEDF	2789	sp|Q8N543|OGFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11445	25.803	2	1066.5811	1066.5811	L	R	116	124
PSM	RKITVPGNFQGHSGAQCITCSY	2790	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	17-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=9355	22.787	4	2480.1689	2480.1689	N	K	324	346
PSM	RKLLMQNQSSTNHPGASIALS	2791	sp|Q9NRY2|SOSSC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35	ms_run[2]:scan=7773	20.846	3	2268.1645	2268.1645	K	R	27	48
PSM	RKLSFDFQ	2792	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9968	23.485	2	1039.5451	1039.5451	P	-	423	431
PSM	RKQEVPHDGPMCDLLWSDPEDTTGWGVSP	2793	sp|P60510|PP4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=12076	27.438	4	3324.4816	3324.4816	D	R	182	211
PSM	RKTVTAMDVVYAL	2794	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12040	27.307	3	1465.7963	1465.7963	K	K	79	92
PSM	RKYVNGSTYQ	2795	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4493	16.376	3	1214.6044	1214.6044	S	R	217	227
PSM	RLHFFMPGFAPLTS	2796	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=12181	27.831	3	1635.8232	1635.8232	P	R	262	276
PSM	RLKSALLALGL	2797	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12102	27.529	2	1153.7547	1153.7547	D	K	262	273
PSM	RLREDGIQ	2798	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4712	16.672	2	985.53049	985.5305	A	K	7	15
PSM	RLRPIYDYLDNGNN	2799	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11435	25.784	3	1721.8485	1721.8485	R	K	14	28
PSM	RLRSEENE	2800	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3447	14.641	2	1031.4996	1031.4996	A	-	128	136
PSM	RNMSVIAHVDHG	2801	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6276	18.82	3	1334.6514	1334.6514	I	K	20	32
PSM	RNRAEASLE	2802	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4327	16.159	2	1044.5312	1044.5312	G	R	89	98
PSM	RNSDLLLLVDTHK	2803	sp|Q6P4E1-3|GOLM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10797	24.67	3	1522.8467	1522.8467	K	K	66	79
PSM	RPPQVHTEPPRPVHPAPLPEAPQPQ	2804	sp|Q6VMQ6-5|MCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7884	20.996	4	2771.462	2771.4620	H	R	1124	1149
PSM	RPRDEDDADY	2805	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4318	16.147	2	1250.5164	1250.5164	K	K	138	148
PSM	RPRDEGGW	2806	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5697	18.059	2	971.45733	971.4573	R	R	1207	1215
PSM	RPRGFAYVQFEDV	2807	sp|O75494-5|SRS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11483	25.889	3	1582.7892	1582.7892	R	R	49	62
PSM	RQKGFGTDF	2808	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8212	21.383	2	1054.5196	1054.5196	M	K	372	381
PSM	RQRFIDFF	2809	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12063	27.399	2	1127.5876	1127.5876	I	K	11	19
PSM	RRGDALIEMESEQDVQ	2810	sp|Q12849-5|GRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9683	23.155	3	1874.8792	1874.8792	K	K	30	46
PSM	RRGFSDSGGGPPA	2811	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4981	17.078	2	1259.6007	1259.6007	L	K	62	75
PSM	RRISAVSVAE	2812	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6077	18.555	2	1086.6146	1086.6146	P	R	446	456
PSM	RRLQQQEL	2813	sp|O00139-2|KIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5383	17.615	2	1069.5992	1069.5992	K	R	127	135
PSM	RRSGAELALDYLC	2814	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	13-UNIMOD:4	ms_run[2]:scan=11505	25.932	3	1522.7562	1522.7562	A	R	95	108
PSM	RRWDDDVVF	2815	sp|Q9P013|CWC15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11072	25.105	3	1206.5782	1206.5782	K	K	186	195
PSM	RRWEEVQSYI	2816	sp|Q86UP2-3|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10581	24.32	3	1364.6837	1364.6837	E	R	495	505
PSM	RSALLPVLHH	2817	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8754	22.027	3	1141.672	1141.6720	I	K	707	717
PSM	RSDGDFLHSTNGNKE	2818	sp|Q9Y5P4|CERT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5985	18.432	3	1675.755	1675.7550	T	K	211	226
PSM	RSGRGGNFGFGDS	2819	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7813	20.916	3	1312.5909	1312.5909	S	R	188	201
PSM	RSKGQESF	2820	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4228	15.97	2	937.46174	937.4617	P	K	221	229
PSM	RTGVEVGKPTHFTVLT	2821	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9139	22.525	3	1740.9523	1740.9523	N	K	879	895
PSM	RTHFDYQFGY	2822	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10442	24.126	2	1332.5887	1332.5887	T	R	279	289
PSM	RTRLLDSEI	2823	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9095	22.472	3	1101.6142	1101.6142	Q	K	44	53
PSM	RTYGLPCHCPFKEGTYSLP	2824	sp|P17900|SAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=10677	24.471	3	2282.0612	2282.0612	L	K	130	149
PSM	RVDPPMGEEGNHK	2825	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4395	16.243	3	1464.678	1464.6780	F	R	948	961
PSM	RVEEEEERCQHLQAE	2826	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4	ms_run[2]:scan=4985	17.083	3	1940.8647	1940.8647	A	K	923	938
PSM	RVHFTSNDL	2827	sp|P78310-4|CXAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8165	21.328	2	1087.5411	1087.5411	G	K	90	99
PSM	RVRALELEND	2828	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7782	20.857	2	1213.6415	1213.6415	D	R	63	73
PSM	RVRDALTAE	2829	sp|Q9HB71-2|CYBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5262	17.45	2	1029.5567	1029.5567	K	K	24	33
PSM	RVRDVFEA	2830	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7911	21.028	2	990.52468	990.5247	D	K	126	134
PSM	RVREEILA	2831	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6944	19.746	2	984.57163	984.5716	Q	K	58	66
PSM	RVRLAEAEETA	2832	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6085	18.564	2	1243.6521	1243.6521	L	R	865	876
PSM	RWCNEHL	2833	sp|O75369-6|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=7251	20.218	2	1013.4501	1013.4501	T	K	24	31
PSM	RWKAGLYGLP	2834	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11037	25.047	3	1159.6502	1159.6502	R	R	39	49
PSM	RYRNPVSQCM	2835	sp|Q13148|TADBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=5101	17.241	2	1325.5969	1325.5969	L	R	42	52
PSM	RYRPGTVAL	2836	sp|Q6NXT2|H3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7705	20.766	2	1031.5876	1031.5876	H	R	40	49
PSM	RYYSHVDY	2837	sp|Q8NEY8-9|PPHLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6755	19.475	2	1101.488	1101.4880	N	R	51	59
PSM	RDTSFEQHVLWHTGG	2838	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9882	23.392164589066667	3	1768.838827	1768.828131	S	K	1724	1739
PSM	KLKEADEMHTLLQLECE	2839	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	8-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=10117	23.6780583008	3	2102.0027	2102.0019	H	K	1121	1138
PSM	RGEEGHD	2840	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=3247	14.215537201866665	2	798.3247	798.3251	R	P	21	28
PSM	RVQIEHISSLIKLS	2841	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11163	25.266487413866667	4	1621.950986	1621.951541	S	K	344	358
PSM	RHEVLLISAEQDK	2842	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=8058	21.202770331466663	3	1537.8462	1536.8252	A	R	209	222
PSM	RPQFHQFTAVPHPNV	2843	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9575	23.044699965866666	3	1774.893425	1773.906322	L	K	470	485
PSM	KKVGSLYPEMSAHE	2844	sp|Q14203|DCTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7656	20.7070383328	3	1575.778244	1574.776278	Y	R	683	697
PSM	RDYLHLPPEIVPATLR	2845	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=12012	27.217947532266667	3	1889.0536	1889.0518	L	R	80	96
PSM	RDYLHLPPEIVPATLR	2846	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=12034	27.293369952533332	3	1889.0536	1889.0518	L	R	80	96
PSM	RSVFALTNGIYPHKLVF	2847	sp|Q02878|RL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=12311	28.403052300800002	4	1962.072622	1961.088703	L	-	272	289
PSM	KKFEEIPIAHI	2848	sp|P82912|RT11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9871	23.3802143584	3	1323.760856	1323.755073	G	K	78	89
PSM	KLKEDLEIEH	2849	sp|Q99996|AKAP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6873	19.6478578392	3	1252.665702	1252.666317	S	R	639	649
PSM	KHECTLSSQEYVHEL	2850	sp|O60879|DIAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:4	ms_run[1]:scan=8874	22.186984795733334	3	1859.844490	1858.851963	S	R	156	171
PSM	KFDLHTSSHLDTLLE	2851	sp|Q9UPN7|PP6R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11259	25.451034135733334	3	1756.888191	1754.883915	W	R	4	19
PSM	KQLVSSSVHSK	2852	sp|Q9H3Q1|BORG4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3664	14.888601466399999	3	1198.672411	1198.666986	L	R	5	16
PSM	KNDLNFEALINLE	2853	sp|Q008S8|ECT2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6571	19.2111006672	3	1531.772581	1531.788223	S	R	544	557
PSM	KKALGITLIKGIDEGPEGL	2854	sp|Q8N335|GPD1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11616	26.158312848533335	4	1951.134764	1951.135378	P	K	113	132
PSM	RSMGFIGHYLDQK	2855	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=9265	22.6842565736	3	1566.760204	1566.761297	G	R	1065	1078
PSM	RKALEFVTNPDIAAK	2856	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9218	22.624331836800003	3	1672.933385	1671.930805	K	K	2730	2745
PSM	KKTDEIVALK	2857	sp|Q9UQ88|CD11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6093	18.5722982344	3	1143.687102	1143.686324	D	R	446	456
PSM	KKAVTPAPPIK	2858	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4713	16.674283780266666	3	1148.727800	1148.728130	E	R	92	103
PSM	KENGFTQHVYH	2859	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6064	18.539129482133333	2	1359.621655	1358.636748	L	K	881	892
PSM	KLNGHQLENHAL	2860	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7546	20.568691128266668	2	1373.704859	1372.721147	M	K	138	150
PSM	RWIHPASG	2861	sp|Q9UIJ7|KAD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5753	18.1239072768	2	923.480724	922.477334	A	R	128	136
PSM	KPIGALNPK	2862	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7193	20.12610666	2	937.582121	936.575652	S	R	2271	2280
PSM	KKPENDDDVEIK	2863	sp|Q13433|S39A6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4350	16.188438965866666	3	1428.710511	1428.709639	Q	K	456	468
PSM	KNQKSAHSIAQLQ	2864	sp|Q9ULS5|TMCC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5350	17.5628088728	3	1454.781850	1451.784475	K	K	118	131
PSM	KTFNLEKQNHTP	2865	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6317	18.868085653866668	3	1456.731395	1455.747027	N	R	5	17
PSM	KGAVDGGLSIPHSTK	2866	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6958	19.785562917066667	3	1465.788835	1465.788892	L	R	164	179
PSM	RIPGSTEAFPHQH	2867	sp|Q96ST3|SIN3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6704	19.39505520506667	3	1475.727576	1475.726960	R	R	19	32
PSM	RVVDLMAHMASKE	2868	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7323	20.300226457066668	3	1486.717290	1485.743204	N	-	323	336
PSM	KHNGPNDASDGTVRL	2869	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6660	19.328801896799998	3	1580.753626	1579.770282	M	R	6	21
PSM	KPNLSKNLNSQDIK	2870	sp|Q5SZJ8|BEND6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11521	25.9625563328	3	1597.886959	1597.878770	K	-	266	280
PSM	RSQHDILQMICSK	2871	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=8554	21.782914489066666	3	1630.793473	1630.791946	S	R	633	646
PSM	KKSPNELVDDLFKGA	2872	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11689	26.321951371466664	3	1660.884848	1659.883186	R	K	112	127
PSM	KQSQQLELLESELR	2873	sp|O60486|PLXC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=12058	27.379181877866664	3	1702.935514	1699.910464	R	K	976	990
PSM	KSSSSSGVPYSPAIPNK	2874	sp|Q9UPT5|EXOC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5298	17.492740758666667	3	1704.838026	1704.868265	H	R	240	257
PSM	RKAWENSPNV	2875	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6802	19.541773187466667	2	1199.604470	1199.604720	A	R	2254	2264
PSM	RKAWENSPNV	2876	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6786	19.511514764266668	2	1199.604470	1199.604720	A	R	2254	2264
PSM	RKIPLMLNDSGSAHSMP	2877	sp|Q00613|HSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=7556	20.58345362	3	1886.915092	1884.918603	K	K	207	224
PSM	RIHPLETEQAGLESNLK	2878	sp|Q8NCM8|DYHC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8818	22.117168493866664	3	1935.008959	1934.022140	E	K	3105	3122
PSM	RGFGHIGIAVPDVYSACK	2879	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	17-UNIMOD:4	ms_run[1]:scan=10843	24.736170224	3	1945.982560	1945.983252	P	R	123	141
PSM	KKAMEGAGTDEKALIEILAT	2880	sp|P08133|ANXA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=12005	27.188914364000002	3	2088.116500	2088.113657	L	R	445	465
PSM	KDSDDDDDVAVTVD	2881	sp|Q16623|STX1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6281	18.82416930533333	2	1508.642301	1507.616192	A	R	12	26
PSM	KGIKSEPHSPGIPEIF	2882	sp|Q8ND82|Z280C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=10630	24.3989348864	2	1734.960482	1734.930471	S	R	72	88