MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F38.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F38.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	74.0	null		0.08	74.0	6	3	1
PRT	sp|Q96F45|ZN503_HUMAN	Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	73.0	null		0.04	73.0	1	1	1
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63.0	null		0.07	63.0	1	1	1
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	63.0	null	195-UNIMOD:35,212-UNIMOD:35	0.04	63.0	3	1	0
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null	776-UNIMOD:4	0.03	61.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	59.0	null	1092-UNIMOD:4	0.06	59.0	4	4	4
PRT	sp|Q8NI36|WDR36_HUMAN	WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null	305-UNIMOD:35,311-UNIMOD:4	0.06	58.0	5	3	1
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.11	57.0	1	1	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56.0	null	87-UNIMOD:4	0.21	56.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	165-UNIMOD:35	0.07	55.0	3	2	1
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null	157-UNIMOD:4	0.17	54.0	3	3	3
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.08	53.0	1	1	1
PRT	sp|Q9Y5Y5|PEX16_HUMAN	Peroxisomal membrane protein PEX16 OS=Homo sapiens OX=9606 GN=PEX16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.07	53.0	2	1	0
PRT	sp|Q14161|GIT2_HUMAN	ARF GTPase-activating protein GIT2 OS=Homo sapiens OX=9606 GN=GIT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52.0	null		0.04	52.0	1	1	1
PRT	sp|Q9NYP7|ELOV5_HUMAN	Elongation of very long chain fatty acids protein 5 OS=Homo sapiens OX=9606 GN=ELOVL5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	274-UNIMOD:35	0.09	51.0	2	1	0
PRT	sp|Q5JRX3-3|PREP_HUMAN	Isoform 3 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.02	51.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	15-UNIMOD:35	0.10	51.0	3	3	3
PRT	sp|Q9Y399|RT02_HUMAN	28S ribosomal protein S2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	292-UNIMOD:35	0.09	51.0	2	1	0
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	351-UNIMOD:4	0.03	50.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	112-UNIMOD:4	0.32	50.0	2	2	2
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.29	50.0	2	2	2
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null	49-UNIMOD:4	0.04	50.0	1	1	1
PRT	sp|Q8NI22-2|MCFD2_HUMAN	Isoform 2 of Multiple coagulation factor deficiency protein 2 OS=Homo sapiens OX=9606 GN=MCFD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	27-UNIMOD:35	0.27	49.0	1	1	1
PRT	sp|Q14155-6|ARHG7_HUMAN	Isoform 6 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.05	49.0	1	1	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49.0	null		0.02	49.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	443-UNIMOD:35,256-UNIMOD:4,24-UNIMOD:4	0.12	48.0	8	7	6
PRT	sp|Q9Y512|SAM50_HUMAN	Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	38-UNIMOD:4,96-UNIMOD:35	0.37	48.0	3	2	1
PRT	sp|Q71UI9|H2AV_HUMAN	Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null		0.20	48.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null		0.30	48.0	3	3	3
PRT	sp|P52756|RBM5_HUMAN	RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null		0.03	48.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	845-UNIMOD:4	0.03	48.0	2	1	0
PRT	sp|Q15126|PMVK_HUMAN	Phosphomevalonate kinase OS=Homo sapiens OX=9606 GN=PMVK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.10	47.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	309-UNIMOD:35,313-UNIMOD:4	0.11	47.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	1236-UNIMOD:35	0.01	47.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null		0.14	47.0	3	2	1
PRT	sp|Q5T280|CI114_HUMAN	Putative methyltransferase C9orf114 OS=Homo sapiens OX=9606 GN=SPOUT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	181-UNIMOD:35,239-UNIMOD:4	0.14	46.0	3	3	3
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	381-UNIMOD:35,391-UNIMOD:35	0.05	46.0	1	1	1
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	216-UNIMOD:35,223-UNIMOD:35	0.10	46.0	3	1	0
PRT	sp|Q8TCN5-2|ZN507_HUMAN	Isoform 2 of Zinc finger protein 507 OS=Homo sapiens OX=9606 GN=ZNF507	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.07	46.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null		0.08	46.0	5	3	2
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null	1208-UNIMOD:35	0.02	46.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9Y2D5-7|AKAP2_HUMAN	Isoform 5 of A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|P08237-2|PFKAM_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	3	2	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	437-UNIMOD:4,452-UNIMOD:35	0.07	45.0	2	2	2
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1288-UNIMOD:35	0.03	45.0	2	2	2
PRT	sp|Q6P3X3|TTC27_HUMAN	Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	774-UNIMOD:4	0.04	45.0	2	2	2
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	859-UNIMOD:4,862-UNIMOD:4	0.03	45.0	1	1	1
PRT	sp|P38606-2|VATA_HUMAN	Isoform 2 of V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	180-UNIMOD:35,141-UNIMOD:35	0.06	45.0	2	2	2
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	56-UNIMOD:35	0.08	44.0	2	1	0
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	521-UNIMOD:4,3308-UNIMOD:4	0.01	44.0	5	4	3
PRT	sp|Q9Y3Y2-4|CHTOP_HUMAN	Isoform 3 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	193-UNIMOD:35	0.12	44.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	44-UNIMOD:35,47-UNIMOD:35,217-UNIMOD:4,305-UNIMOD:35,153-UNIMOD:35	0.33	44.0	9	5	3
PRT	sp|Q8IUD2|RB6I2_HUMAN	ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	980-UNIMOD:35,983-UNIMOD:35	0.04	44.0	3	3	3
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	69-UNIMOD:4	0.39	44.0	2	2	2
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	638-UNIMOD:4,645-UNIMOD:4	0.04	43.0	2	2	2
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	904-UNIMOD:4	0.03	43.0	4	3	2
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.15	43.0	3	2	1
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q7Z6J9|SEN54_HUMAN	tRNA-splicing endonuclease subunit Sen54 OS=Homo sapiens OX=9606 GN=TSEN54 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	239-UNIMOD:35	0.04	43.0	2	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	12-UNIMOD:4,20-UNIMOD:4	0.08	43.0	3	3	3
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	156-UNIMOD:35,141-UNIMOD:35	0.05	43.0	2	1	0
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	363-UNIMOD:35	0.17	43.0	4	4	4
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	74-UNIMOD:4	0.02	43.0	3	3	3
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	2	2	2
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.07	43.0	1	1	1
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	558-UNIMOD:35	0.03	43.0	2	1	0
PRT	sp|O43318|M3K7_HUMAN	Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	24-UNIMOD:35	0.13	43.0	3	2	1
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	17-UNIMOD:35,24-UNIMOD:4,13-UNIMOD:35,56-UNIMOD:4	0.56	43.0	4	3	2
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	224-UNIMOD:4,236-UNIMOD:4	0.03	42.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	515-UNIMOD:35	0.05	42.0	3	2	1
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	112-UNIMOD:4	0.09	42.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null		0.21	42.0	15	7	4
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	30-UNIMOD:35,179-UNIMOD:35	0.15	42.0	4	4	4
PRT	sp|Q96EL2|RT24_HUMAN	28S ribosomal protein S24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	328-UNIMOD:4	0.13	42.0	7	3	2
PRT	sp|Q9BY67-2|CADM1_HUMAN	Isoform 2 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	220-UNIMOD:4	0.08	42.0	1	1	1
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	229-UNIMOD:35	0.05	42.0	1	1	1
PRT	sp|Q9BPU6|DPYL5_HUMAN	Dihydropyrimidinase-related protein 5 OS=Homo sapiens OX=9606 GN=DPYSL5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	5	5	5
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	412-UNIMOD:4,466-UNIMOD:35	0.11	42.0	8	5	3
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	579-UNIMOD:35,582-UNIMOD:35	0.09	42.0	4	3	2
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.11	42.0	1	1	1
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1109-UNIMOD:35	0.05	41.0	4	3	2
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	41-UNIMOD:35	0.03	41.0	2	2	2
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	24-UNIMOD:35	0.04	41.0	3	2	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	31-UNIMOD:4	0.07	41.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	453-UNIMOD:35	0.02	41.0	4	4	4
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	1	1	1
PRT	sp|Q9Y4K4|M4K5_HUMAN	Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP4K5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|P21912|SDHB_HUMAN	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	3	2	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	2202-UNIMOD:4,2444-UNIMOD:35	0.02	41.0	3	3	3
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	328-UNIMOD:35	0.04	41.0	3	2	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	3	3	3
PRT	sp|Q9HCE5|MET14_HUMAN	N6-adenosine-methyltransferase non-catalytic subunit OS=Homo sapiens OX=9606 GN=METTL14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	120-UNIMOD:4,77-UNIMOD:35	0.09	40.0	3	2	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	936-UNIMOD:35	0.03	40.0	5	5	5
PRT	sp|Q9Y6G3|RM42_HUMAN	39S ribosomal protein L42, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.15	40.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	2	2	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1636-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	635-UNIMOD:4	0.04	40.0	3	2	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	948-UNIMOD:35,576-UNIMOD:4,150-UNIMOD:35	0.08	40.0	12	9	6
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	823-UNIMOD:35,761-UNIMOD:35,777-UNIMOD:35	0.07	40.0	6	4	2
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q15643-2|TRIPB_HUMAN	Isoform 2 of Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	236-UNIMOD:35	0.01	40.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	886-UNIMOD:35,469-UNIMOD:35,475-UNIMOD:4	0.03	40.0	3	2	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.06	40.0	3	3	2
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q8IWS0-3|PHF6_HUMAN	Isoform 3 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.06	40.0	2	1	0
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	261-UNIMOD:35	0.13	40.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	126-UNIMOD:35	0.28	40.0	5	4	3
PRT	sp|Q8IWZ8-2|SUGP1_HUMAN	Isoform 2 of SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	78-UNIMOD:4	0.14	39.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	3	3	3
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	112-UNIMOD:4	0.10	39.0	4	4	4
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	40-UNIMOD:35	0.07	39.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	2	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1063-UNIMOD:35	0.01	39.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	453-UNIMOD:35	0.06	39.0	7	4	2
PRT	sp|P51610-3|HCFC1_HUMAN	Isoform 3 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	3	3	3
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1027-UNIMOD:4	0.03	39.0	2	2	2
PRT	sp|Q969H8|MYDGF_HUMAN	Myeloid-derived growth factor OS=Homo sapiens OX=9606 GN=MYDGF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	2	1	0
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|O15212|PFD6_HUMAN	Prefoldin subunit 6 OS=Homo sapiens OX=9606 GN=PFDN6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.21	39.0	2	2	2
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	495-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q6PJT7|ZC3HE_HUMAN	Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	488-UNIMOD:35	0.03	39.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	47-UNIMOD:4	0.15	39.0	5	5	5
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.05	38.0	4	4	4
PRT	sp|Q8WWK9-6|CKAP2_HUMAN	Isoform 4 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	51-UNIMOD:4,459-UNIMOD:35	0.06	38.0	2	2	2
PRT	sp|P49902-2|5NTC_HUMAN	Isoform 2 of Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	231-UNIMOD:35	0.04	38.0	1	1	0
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	4	3	1
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	2	2	2
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	390-UNIMOD:35,403-UNIMOD:35	0.05	38.0	2	1	0
PRT	sp|P51808|DYLT3_HUMAN	Dynein light chain Tctex-type 3 OS=Homo sapiens OX=9606 GN=DYNLT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	8-UNIMOD:4	0.16	38.0	1	1	1
PRT	sp|P15151-3|PVR_HUMAN	Isoform Gamma of Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	75-UNIMOD:35	0.06	38.0	1	1	1
PRT	sp|P17028|ZNF24_HUMAN	Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	337-UNIMOD:4,340-UNIMOD:4	0.08	38.0	2	2	2
PRT	sp|Q9H832-2|UBE2Z_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	189-UNIMOD:35	0.07	38.0	1	1	1
PRT	sp|Q9NT62-2|ATG3_HUMAN	Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|O00267-2|SPT5H_HUMAN	Isoform 2 of Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q96C01|F136A_HUMAN	Protein FAM136A OS=Homo sapiens OX=9606 GN=FAM136A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	114-UNIMOD:4,119-UNIMOD:35,125-UNIMOD:35,129-UNIMOD:35	0.20	38.0	4	2	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	3	1	0
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	277-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	18-UNIMOD:4,19-UNIMOD:4	0.06	38.0	2	2	2
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	655-UNIMOD:35,660-UNIMOD:4	0.07	38.0	9	6	3
PRT	sp|Q5ZPR3-2|CD276_HUMAN	Isoform 2 of CD276 antigen OS=Homo sapiens OX=9606 GN=CD276	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	2	2	2
PRT	sp|P30837|AL1B1_HUMAN	Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	260-UNIMOD:35,263-UNIMOD:35	0.07	37.0	2	2	2
PRT	sp|O43402|EMC8_HUMAN	ER membrane protein complex subunit 8 OS=Homo sapiens OX=9606 GN=EMC8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	134-UNIMOD:35,136-UNIMOD:4	0.10	37.0	2	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	193-UNIMOD:35,196-UNIMOD:4	0.03	37.0	2	1	0
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	2	2	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	363-UNIMOD:35,267-UNIMOD:35	0.12	37.0	4	4	4
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P18583-6|SON_HUMAN	Isoform E of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	2	1	0
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.09	37.0	4	2	1
PRT	sp|Q9UGR2|Z3H7B_HUMAN	Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	769-UNIMOD:4,775-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	729-UNIMOD:35,254-UNIMOD:4	0.05	37.0	6	4	2
PRT	sp|Q9NSV4-7|DIAP3_HUMAN	Isoform 7 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q08J23-2|NSUN2_HUMAN	Isoform 2 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	131-UNIMOD:35,186-UNIMOD:4	0.04	37.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	420-UNIMOD:4	0.13	37.0	11	7	4
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	27-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	303-UNIMOD:35,174-UNIMOD:35	0.07	37.0	4	3	2
PRT	sp|Q03164|KMT2A_HUMAN	Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P04150|GCR_HUMAN	Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	99-UNIMOD:35,102-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.09	36.0	4	2	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1367-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	181-UNIMOD:35,253-UNIMOD:4,389-UNIMOD:35	0.10	36.0	3	3	3
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	615-UNIMOD:35	0.04	36.0	3	2	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	175-UNIMOD:4	0.15	36.0	4	3	2
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.08	36.0	2	2	2
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2153-UNIMOD:4,1586-UNIMOD:35	0.05	36.0	8	8	7
PRT	sp|P36873-2|PP1G_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	2	2
PRT	sp|P35250|RFC2_HUMAN	Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	146-UNIMOD:35	0.06	36.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	870-UNIMOD:4,617-UNIMOD:4	0.04	36.0	4	4	4
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	44-UNIMOD:4,46-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q86WJ1-5|CHD1L_HUMAN	Isoform 5 of Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9NQH7-3|XPP3_HUMAN	Isoform 3 of Xaa-Pro aminopeptidase 3 OS=Homo sapiens OX=9606 GN=XPNPEP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	219-UNIMOD:35	0.07	36.0	2	1	0
PRT	sp|Q6Y288|B3GLT_HUMAN	Beta-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=B3GLCT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	197-UNIMOD:35	0.05	36.0	5	3	1
PRT	sp|P60891-2|PRPS1_HUMAN	Isoform 2 of Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	2	2	2
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	821-UNIMOD:4	0.08	36.0	4	4	4
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	375-UNIMOD:35	0.04	36.0	4	1	0
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.08	36.0	3	1	0
PRT	sp|Q969G3|SMCE1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|O60828|PQBP1_HUMAN	Polyglutamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PQBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	2412-UNIMOD:35,1507-UNIMOD:35,3199-UNIMOD:35	0.02	36.0	7	6	5
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	397-UNIMOD:4	0.10	35.0	5	4	3
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	2	2
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|O14745-2|NHRF1_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|P17612-2|KAPCA_HUMAN	Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P78312-3|F193A_HUMAN	Isoform 3 of Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O43852-9|CALU_HUMAN	Isoform 9 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q7Z7F7|RM55_HUMAN	39S ribosomal protein L55, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL55 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9UNQ2|DIM1_HUMAN	Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	3815-UNIMOD:35,3825-UNIMOD:35,3827-UNIMOD:35	0.01	35.0	5	4	2
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:4,74-UNIMOD:4	0.17	35.0	2	2	2
PRT	sp|P07197|NFM_HUMAN	Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P07919|QCR6_HUMAN	Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:4	0.21	35.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	51-UNIMOD:4	0.17	35.0	3	3	3
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	209-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.14	35.0	2	1	0
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null		0.28	35.0	2	2	2
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	3	3	3
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P51114|FXR1_HUMAN	Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	149-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q92990|GLMN_HUMAN	Glomulin OS=Homo sapiens OX=9606 GN=GLMN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	269-UNIMOD:35	0.05	34.0	3	3	3
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	118-UNIMOD:4,57-UNIMOD:35,63-UNIMOD:4	0.22	34.0	3	2	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	414-UNIMOD:4,416-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	3	3	3
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:4	0.14	34.0	1	1	1
PRT	sp|Q99496|RING2_HUMAN	E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q16836|HCDH_HUMAN	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	211-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1039-UNIMOD:4	0.04	34.0	3	3	3
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	317-UNIMOD:35,323-UNIMOD:35	0.08	34.0	4	2	1
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:4	0.06	34.0	3	3	3
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	504-UNIMOD:35	0.03	34.0	4	3	2
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	2	2
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	174-UNIMOD:4	0.08	34.0	3	2	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	781-UNIMOD:35,22-UNIMOD:35	0.04	34.0	6	2	0
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.10	34.0	4	3	2
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	85-UNIMOD:4	0.17	34.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	759-UNIMOD:35	0.05	34.0	4	4	4
PRT	sp|P00918|CAH2_HUMAN	Carbonic anhydrase 2 OS=Homo sapiens OX=9606 GN=CA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q13496-2|MTM1_HUMAN	Isoform 2 of Myotubularin OS=Homo sapiens OX=9606 GN=MTM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	40-UNIMOD:4,50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4,80-UNIMOD:4,81-UNIMOD:4,84-UNIMOD:4	0.25	34.0	2	2	2
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	560-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	49-UNIMOD:4,57-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	975-UNIMOD:4,989-UNIMOD:35,1295-UNIMOD:35	0.05	34.0	6	4	3
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	0
PRT	sp|P16989-3|YBOX3_HUMAN	Isoform 3 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q13098-5|CSN1_HUMAN	Isoform 4 of COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	171-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q7KZI7-10|MARK2_HUMAN	Isoform 10 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	129-UNIMOD:4	0.16	34.0	4	1	0
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	34-UNIMOD:35	0.24	34.0	1	1	1
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	2	2
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	31-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|Q9P0T7|TMEM9_HUMAN	Proton-transporting V-type ATPase complex assembly regulator TMEM9 OS=Homo sapiens OX=9606 GN=TMEM9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.11	34.0	1	1	1
PRT	sp|P28331-3|NDUS1_HUMAN	Isoform 3 of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	166-UNIMOD:35	0.03	34.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1492-UNIMOD:35,1832-UNIMOD:35,903-UNIMOD:35	0.05	34.0	8	7	6
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	697-UNIMOD:35	0.02	34.0	3	1	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	348-UNIMOD:4	0.07	34.0	2	2	2
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	923-UNIMOD:35	0.02	34.0	2	1	0
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	2	2	2
PRT	sp|Q00765|REEP5_HUMAN	Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	5	3	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	367-UNIMOD:4	0.05	34.0	3	2	1
PRT	sp|O00566|MPP10_HUMAN	U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens OX=9606 GN=MPHOSPH10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	4	2	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	425-UNIMOD:35	0.03	34.0	3	1	0
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	3	3	3
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	74-UNIMOD:35,85-UNIMOD:4,377-UNIMOD:35,422-UNIMOD:4	0.05	34.0	4	4	4
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	316-UNIMOD:35	0.08	34.0	4	2	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	2	2
PRT	sp|Q05655|KPCD_HUMAN	Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.15	34.0	1	1	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	73-UNIMOD:4,79-UNIMOD:35	0.13	34.0	3	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	179-UNIMOD:35,184-UNIMOD:4	0.02	34.0	2	1	0
PRT	sp|Q9BU23|LMF2_HUMAN	Lipase maturation factor 2 OS=Homo sapiens OX=9606 GN=LMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	696-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	132-UNIMOD:35,106-UNIMOD:4	0.22	34.0	7	3	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	2	2	2
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	2	2	2
PRT	sp|Q16864|VATF_HUMAN	V-type proton ATPase subunit F OS=Homo sapiens OX=9606 GN=ATP6V1F PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.28	33.0	2	2	2
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	70-UNIMOD:4	0.12	33.0	1	1	1
PRT	sp|Q99417|MYCBP_HUMAN	c-Myc-binding protein OS=Homo sapiens OX=9606 GN=MYCBP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.17	33.0	1	1	1
PRT	sp|Q9BV38|WDR18_HUMAN	WD repeat-containing protein 18 OS=Homo sapiens OX=9606 GN=WDR18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	73-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|P22090|RS4Y1_HUMAN	40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens OX=9606 GN=RPS4Y1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	19-UNIMOD:35	0.15	33.0	3	3	3
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	356-UNIMOD:35	0.06	33.0	3	2	1
PRT	sp|P54819-6|KAD2_HUMAN	Isoform 6 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	2	1	0
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9UHB7-3|AFF4_HUMAN	Isoform 3 of AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	284-UNIMOD:35	0.07	33.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1028-UNIMOD:35,146-UNIMOD:35,917-UNIMOD:4,671-UNIMOD:4	0.04	33.0	6	5	4
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	2	2	2
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	3	3	3
PRT	sp|Q8NHH9-3|ATLA2_HUMAN	Isoform 3 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	88-UNIMOD:4	0.16	33.0	2	2	2
PRT	sp|Q5SRI9|MANEA_HUMAN	Glycoprotein endo-alpha-1,2-mannosidase OS=Homo sapiens OX=9606 GN=MANEA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	62-UNIMOD:4	0.06	33.0	2	2	2
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	193-UNIMOD:4	0.04	33.0	2	1	0
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	49-UNIMOD:4,57-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q9Y5L0-3|TNPO3_HUMAN	Isoform 3 of Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	634-UNIMOD:4,534-UNIMOD:35	0.04	33.0	2	2	2
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	3	2	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	2	2	2
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	664-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9BV20|MTNA_HUMAN	Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	199-UNIMOD:4,285-UNIMOD:4	0.10	33.0	2	2	2
PRT	sp|Q9Y483-4|MTF2_HUMAN	Isoform 4 of Metal-response element-binding transcription factor 2 OS=Homo sapiens OX=9606 GN=MTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|P06280|AGAL_HUMAN	Alpha-galactosidase A OS=Homo sapiens OX=9606 GN=GLA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	2	1	0
PRT	sp|P28799-3|GRN_HUMAN	Isoform 3 of Progranulin OS=Homo sapiens OX=9606 GN=GRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	301-UNIMOD:4,302-UNIMOD:4,308-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1127-UNIMOD:4,1029-UNIMOD:35,727-UNIMOD:35	0.04	33.0	9	7	5
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	121-UNIMOD:4,126-UNIMOD:4,132-UNIMOD:35	0.13	33.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	4001-UNIMOD:35	0.01	33.0	3	3	3
PRT	sp|P98179|RBM3_HUMAN	RNA-binding protein 3 OS=Homo sapiens OX=9606 GN=RBM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	64-UNIMOD:35	0.13	33.0	2	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.16	33.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	347-UNIMOD:4,350-UNIMOD:4	0.09	33.0	4	2	1
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q14203|DCTN1_HUMAN	Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	420-UNIMOD:4	0.07	33.0	3	3	3
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	206-UNIMOD:35,154-UNIMOD:4	0.11	33.0	5	2	0
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.14	33.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	92-UNIMOD:4,106-UNIMOD:4,108-UNIMOD:4	0.23	33.0	2	2	2
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	785-UNIMOD:4	0.07	33.0	4	4	4
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	2	2	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.13	33.0	2	2	2
PRT	sp|Q9Y5A7|NUB1_HUMAN	NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	133-UNIMOD:35	0.06	33.0	3	2	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	286-UNIMOD:35	0.05	33.0	2	2	2
PRT	sp|P43003|EAA1_HUMAN	Excitatory amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC1A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	542-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	6	6	6
PRT	sp|Q9NZN8-3|CNOT2_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	60-UNIMOD:35,63-UNIMOD:35	0.32	32.0	3	3	3
PRT	sp|O15541|R113A_HUMAN	E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	987-UNIMOD:35,997-UNIMOD:4	0.04	32.0	4	3	2
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	446-UNIMOD:35,16-UNIMOD:4	0.05	32.0	3	2	1
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	377-UNIMOD:35	0.07	32.0	2	2	2
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	140-UNIMOD:35	0.14	32.0	2	2	2
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	119-UNIMOD:35	0.06	32.0	2	2	2
PRT	sp|Q5T8P6-5|RBM26_HUMAN	Isoform 5 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	85-UNIMOD:35	0.33	32.0	6	4	3
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	245-UNIMOD:35,251-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q8N9N7|LRC57_HUMAN	Leucine-rich repeat-containing protein 57 OS=Homo sapiens OX=9606 GN=LRRC57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q16222-2|UAP1_HUMAN	Isoform AGX1 of UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.15	32.0	2	2	2
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	3	2	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1921-UNIMOD:4	0.01	32.0	2	1	0
PRT	sp|Q71RC2-7|LARP4_HUMAN	Isoform 7 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	3	3	3
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	140-UNIMOD:35	0.07	32.0	2	2	2
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.12	32.0	3	3	3
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	179-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	4	4	4
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	5	5	5
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	972-UNIMOD:4	0.06	32.0	5	5	5
PRT	sp|Q9UPN7|PP6R1_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	216-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	58-UNIMOD:35,35-UNIMOD:4	0.21	32.0	5	3	1
PRT	sp|Q08378-2|GOGA3_HUMAN	Isoform 2 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	915-UNIMOD:35	0.02	32.0	2	2	2
PRT	sp|O15270|SPTC2_HUMAN	Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	250-UNIMOD:35	0.06	32.0	2	2	2
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	289-UNIMOD:35,286-UNIMOD:35	0.09	32.0	5	2	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	403-UNIMOD:35	0.06	32.0	5	4	3
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	3	2	1
PRT	sp|O75340|PDCD6_HUMAN	Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9Y2Q9|RT28_HUMAN	28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	92-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	261-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	2	2	1
PRT	sp|Q5M9Q1|NKAPL_HUMAN	NKAP-like protein OS=Homo sapiens OX=9606 GN=NKAPL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NZ01|TECR_HUMAN	Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:35	0.05	32.0	2	1	0
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9BRV8|SIKE1_HUMAN	Suppressor of IKBKE 1 OS=Homo sapiens OX=9606 GN=SIKE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	199-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	211-UNIMOD:35,110-UNIMOD:4	0.07	32.0	3	3	3
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.13	32.0	3	3	3
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	392-UNIMOD:35	0.07	32.0	2	2	2
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	140-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	78-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	232-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	302-UNIMOD:4,308-UNIMOD:35	0.08	31.0	3	2	1
PRT	sp|P04179-3|SODM_HUMAN	Isoform 3 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.20	31.0	2	2	2
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	2	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	93-UNIMOD:35,237-UNIMOD:35	0.05	31.0	5	2	0
PRT	sp|Q9Y680-3|FKBP7_HUMAN	Isoform 3 of Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Homo sapiens OX=9606 GN=FKBP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	2	2	2
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q9Y5X3|SNX5_HUMAN	Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	4	3	2
PRT	sp|P36551|HEM6_HUMAN	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=CPOX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	319-UNIMOD:4	0.06	31.0	3	2	1
PRT	sp|Q8NBF2-2|NHLC2_HUMAN	Isoform 2 of NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	4	2	0
PRT	sp|Q96EA4-2|SPDLY_HUMAN	Isoform 2 of Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q15050|RRS1_HUMAN	Ribosome biogenesis regulatory protein homolog OS=Homo sapiens OX=9606 GN=RRS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.10	31.0	2	2	2
PRT	sp|Q9Y2S7|PDIP2_HUMAN	Polymerase delta-interacting protein 2 OS=Homo sapiens OX=9606 GN=POLDIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	2	2	2
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	178-UNIMOD:4,181-UNIMOD:4	0.10	31.0	2	2	2
PRT	sp|Q9Y6D9|MD1L1_HUMAN	Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	452-UNIMOD:35	0.05	31.0	2	2	2
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|O75494-5|SRS10_HUMAN	Isoform 5 of Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q7L576-3|CYFP1_HUMAN	Isoform 3 of Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q6NVY1-2|HIBCH_HUMAN	Isoform 2 of 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	265-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|Q9Y4R8|TELO2_HUMAN	Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q15554-4|TERF2_HUMAN	Isoform 2 of Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	611-UNIMOD:35	0.02	31.0	3	1	0
PRT	sp|Q96HA1-2|P121A_HUMAN	Isoform 2 of Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	2	2	2
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	739-UNIMOD:4	0.04	31.0	3	3	2
PRT	sp|O00233-2|PSMD9_HUMAN	Isoform p27-S of 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	81-UNIMOD:4	0.06	31.0	2	1	0
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.17	31.0	4	4	4
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	25-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q96EY1-3|DNJA3_HUMAN	Isoform 3 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	3	2	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	19-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|P98175-5|RBM10_HUMAN	Isoform 5 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96PM5-3|ZN363_HUMAN	Isoform 3 of RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCHY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	43-UNIMOD:4,119-UNIMOD:4	0.15	31.0	3	2	1
PRT	sp|Q4U2R6|RM51_HUMAN	39S ribosomal protein L51, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL51 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	102-UNIMOD:35	0.10	31.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	112-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1.10 OS=Homo sapiens OX=9606 GN=H1-10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.15	31.0	2	2	2
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q66K89|E4F1_HUMAN	Transcription factor E4F1 OS=Homo sapiens OX=9606 GN=E4F1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	437-UNIMOD:4,440-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	2	2	2
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.13	31.0	2	2	2
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	110-UNIMOD:4	0.12	31.0	3	3	3
PRT	sp|Q9NPL8|TIDC1_HUMAN	Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P51572|BAP31_HUMAN	B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	151-UNIMOD:35	0.17	31.0	4	3	2
PRT	sp|Q9H5V9|CX056_HUMAN	UPF0428 protein CXorf56 OS=Homo sapiens OX=9606 GN=CXorf56 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	212-UNIMOD:35	0.06	31.0	2	1	0
PRT	sp|P22307|NLTP_HUMAN	Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	2	2	2
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	2	2	2
PRT	sp|Q9UJX2|CDC23_HUMAN	Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	424-UNIMOD:35,434-UNIMOD:35	0.03	31.0	4	1	0
PRT	sp|P42696|RBM34_HUMAN	RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q6RFH5|WDR74_HUMAN	WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	2	2
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	763-UNIMOD:35,769-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	692-UNIMOD:35	0.04	31.0	3	2	1
PRT	sp|Q96P16|RPR1A_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	139-UNIMOD:35	0.21	31.0	6	3	2
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	2	2	2
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	71-UNIMOD:4,84-UNIMOD:4,86-UNIMOD:35	0.15	31.0	2	1	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	350-UNIMOD:4,352-UNIMOD:35	0.02	30.0	2	2	2
PRT	sp|Q7Z333-3|SETX_HUMAN	Isoform 3 of Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	4	4	4
PRT	sp|Q96DV4-2|RM38_HUMAN	Isoform 2 of 39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	127-UNIMOD:35,137-UNIMOD:4	0.09	30.0	1	1	1
PRT	sp|Q96CS2|HAUS1_HUMAN	HAUS augmin-like complex subunit 1 OS=Homo sapiens OX=9606 GN=HAUS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	460-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|P82663|RT25_HUMAN	28S ribosomal protein S25, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	949-UNIMOD:35,954-UNIMOD:35,623-UNIMOD:35,411-UNIMOD:4,414-UNIMOD:4	0.03	30.0	7	4	3
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|A4UGR9-7|XIRP2_HUMAN	Isoform 7 of Xin actin-binding repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=XIRP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1516-UNIMOD:4,1517-UNIMOD:35	0.01	30.0	2	2	2
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	168-UNIMOD:4,169-UNIMOD:4	0.08	30.0	3	3	3
PRT	sp|Q9Y3Z3-4|SAMH1_HUMAN	Isoform 4 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	362-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|P51114-3|FXR1_HUMAN	Isoform 3 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	56-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q12933-4|TRAF2_HUMAN	Isoform 4 of TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O95905-2|ECD_HUMAN	Isoform 2 of Protein ecdysoneless homolog OS=Homo sapiens OX=9606 GN=ECD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q96K58|ZN668_HUMAN	Zinc finger protein 668 OS=Homo sapiens OX=9606 GN=ZNF668 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	49-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	3	2	1
PRT	sp|O75379-2|VAMP4_HUMAN	Isoform 2 of Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.11	30.0	1	1	0
PRT	sp|O15226|NKRF_HUMAN	NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	37-UNIMOD:4	0.04	30.0	2	2	2
PRT	sp|Q99717|SMAD5_HUMAN	Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q92879-5|CELF1_HUMAN	Isoform 5 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	65-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q9NVS2-3|RT18A_HUMAN	Isoform 3 of 39S ribosomal protein S18a, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	108-UNIMOD:4	0.09	30.0	2	1	0
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	141-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|Q06587-2|RING1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:4	0.08	30.0	2	2	2
PRT	sp|Q8IZ83-3|A16A1_HUMAN	Isoform 3 of Aldehyde dehydrogenase family 16 member A1 OS=Homo sapiens OX=9606 GN=ALDH16A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	2	1	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	192-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	362-UNIMOD:35	0.02	30.0	2	2	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	126-UNIMOD:35	0.06	30.0	2	2	2
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	425-UNIMOD:35,428-UNIMOD:35,434-UNIMOD:35,435-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1085-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q96P11-5|NSUN5_HUMAN	Isoform 5 of 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	270-UNIMOD:4,275-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	75-UNIMOD:35,86-UNIMOD:35	0.05	30.0	2	1	0
PRT	sp|P80303|NUCB2_HUMAN	Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	4	2	1
PRT	sp|Q6QNY0|BL1S3_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 3 OS=Homo sapiens OX=9606 GN=BLOC1S3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.16	30.0	2	2	2
PRT	sp|Q99442|SEC62_HUMAN	Translocation protein SEC62 OS=Homo sapiens OX=9606 GN=SEC62 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	3	3	3
PRT	sp|A6NHG4|DDTL_HUMAN	D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	24-UNIMOD:4	0.13	30.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	2015-UNIMOD:4,1275-UNIMOD:4,1276-UNIMOD:35	0.01	30.0	3	2	1
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	2	2	2
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	253-UNIMOD:35,254-UNIMOD:35,375-UNIMOD:4	0.01	30.0	2	2	2
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	153-UNIMOD:35,159-UNIMOD:35,162-UNIMOD:35,165-UNIMOD:35	0.05	30.0	2	1	0
PRT	sp|Q9NYL2|M3K20_HUMAN	Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	198-UNIMOD:35	0.04	29.0	4	2	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	3	2	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y3A4|RRP7A_HUMAN	Ribosomal RNA-processing protein 7 homolog A OS=Homo sapiens OX=9606 GN=RRP7A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	2	2	2
PRT	sp|O15392-5|BIRC5_HUMAN	Isoform 5 of Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	84-UNIMOD:4	0.11	29.0	1	1	0
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q86W92-5|LIPB1_HUMAN	Isoform 5 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	140-UNIMOD:4	0.08	29.0	1	1	1
PRT	sp|O43865-2|SAHH2_HUMAN	Isoform 2 of S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|P48444-2|COPD_HUMAN	Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	2	2
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	32-UNIMOD:35,202-UNIMOD:35	0.07	29.0	4	2	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	94-UNIMOD:35,39-UNIMOD:35	0.14	29.0	6	2	0
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	381-UNIMOD:4,396-UNIMOD:4,399-UNIMOD:4	0.08	29.0	2	2	2
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	115-UNIMOD:4	0.25	29.0	2	2	2
PRT	sp|O60573-2|IF4E2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	453-UNIMOD:4,456-UNIMOD:4,458-UNIMOD:35	0.01	29.0	2	1	0
PRT	sp|Q9Y6V7-2|DDX49_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9NR56-3|MBNL1_HUMAN	Isoform 3 of Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	43-UNIMOD:4	0.12	29.0	3	3	2
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	2	2
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	367-UNIMOD:35	0.03	29.0	3	3	3
PRT	sp|Q13564-3|ULA1_HUMAN	Isoform 3 of NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	115-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|O75521-2|ECI2_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	333-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	459-UNIMOD:4,500-UNIMOD:4	0.05	29.0	3	3	3
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	198-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	337-UNIMOD:4	0.04	29.0	2	2	2
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	338-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	154-UNIMOD:35	0.06	29.0	3	3	3
PRT	sp|Q9UP83-3|COG5_HUMAN	Isoform 3 of Conserved oligomeric Golgi complex subunit 5 OS=Homo sapiens OX=9606 GN=COG5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P25963|IKBA_HUMAN	NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	37-UNIMOD:35,45-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|Q13330-3|MTA1_HUMAN	Isoform 3 of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	495-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q8TEU7-6|RPGF6_HUMAN	Isoform 6 of Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:4,46-UNIMOD:4	0.06	29.0	2	2	2
PRT	sp|Q9H270|VPS11_HUMAN	Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=VPS11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|P21359-2|NF1_HUMAN	Isoform I of Neurofibromin OS=Homo sapiens OX=9606 GN=NF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|Q9P2W9|STX18_HUMAN	Syntaxin-18 OS=Homo sapiens OX=9606 GN=STX18 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	82-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8N335|GPD1L_HUMAN	Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	867-UNIMOD:4	0.03	29.0	3	3	3
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	371-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|Q13948-9|CASP_HUMAN	Isoform 9 of Protein CASP OS=Homo sapiens OX=9606 GN=CUX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	211-UNIMOD:35,214-UNIMOD:35	0.09	29.0	4	3	2
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	2	1	0
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	2	1
PRT	sp|Q96IK1|BOD1_HUMAN	Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.14	29.0	2	2	2
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	642-UNIMOD:35	0.04	29.0	3	3	3
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	533-UNIMOD:35	0.01	29.0	2	2	2
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null		0.06	29.0	4	4	4
PRT	sp|Q8N5K1|CISD2_HUMAN	CDGSH iron-sulfur domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CISD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	110-UNIMOD:4	0.10	29.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	585-UNIMOD:4	0.03	29.0	2	2	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	3	3	3
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	230-UNIMOD:4,16-UNIMOD:4	0.09	29.0	2	2	2
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	441-UNIMOD:35,339-UNIMOD:4	0.14	29.0	7	6	5
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P82930|RT34_HUMAN	28S ribosomal protein S34, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	135-UNIMOD:35	0.12	29.0	2	2	2
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	94-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|P16615|AT2A2_HUMAN	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	560-UNIMOD:4,494-UNIMOD:35,498-UNIMOD:4	0.03	29.0	2	2	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P11498|PYC_HUMAN	Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q8TED0|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	49-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|O95793|STAU1_HUMAN	Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	3	2	1
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	825-UNIMOD:35	0.03	29.0	2	2	2
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.15	29.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	2	2	2
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9NVI7|ATD3A_HUMAN	ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	217-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q02750|MP2K1_HUMAN	Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	2	2	2
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	261-UNIMOD:4	0.09	29.0	3	3	3
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	2	2	2
PRT	sp|P98175|RBM10_HUMAN	RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q86WX3|AROS_HUMAN	Active regulator of SIRT1 OS=Homo sapiens OX=9606 GN=RPS19BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q13188|STK3_HUMAN	Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	67-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|O95071|UBR5_HUMAN	E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9BSH5|HDHD3_HUMAN	Haloacid dehalogenase-like hydrolase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HDHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	265-UNIMOD:4	0.05	28.0	2	2	2
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	0
PRT	sp|Q14527-2|HLTF_HUMAN	Isoform 2 of Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q9P289-2|STK26_HUMAN	Isoform 2 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	2	2	2
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	132-UNIMOD:4	0.10	28.0	3	3	3
PRT	sp|Q9Y2J2-3|E41L3_HUMAN	Isoform 3 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O00411|RPOM_HUMAN	DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	251-UNIMOD:35,67-UNIMOD:35	0.03	28.0	4	2	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	263-UNIMOD:35	0.07	28.0	3	3	3
PRT	sp|O95249|GOSR1_HUMAN	Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	34-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q76FK4-4|NOL8_HUMAN	Isoform 4 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	3	3	3
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	3	2	1
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q07864|DPOE1_HUMAN	DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q7LGA3-3|HS2ST_HUMAN	Isoform 3 of Heparan sulfate 2-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS2ST1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	39-UNIMOD:4	0.07	28.0	3	2	1
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	91-UNIMOD:35,92-UNIMOD:35	0.11	28.0	3	3	3
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9Y2D8-2|ADIP_HUMAN	Isoform 2 of Afadin- and alpha-actinin-binding protein OS=Homo sapiens OX=9606 GN=SSX2IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	0
PRT	sp|Q8NEY8-5|PPHLN_HUMAN	Isoform 5 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	3	3	3
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q9UBF8-2|PI4KB_HUMAN	Isoform 2 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P60953-1|CDC42_HUMAN	Isoform 1 of Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	105-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	233-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q9BVT8|TMUB1_HUMAN	Transmembrane and ubiquitin-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.18	28.0	2	2	2
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	21-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:4	0.09	28.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	2	2
PRT	sp|Q8TCA0|LRC20_HUMAN	Leucine-rich repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=LRRC20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	2	1	0
PRT	sp|Q8WTS6|SETD7_HUMAN	Histone-lysine N-methyltransferase SETD7 OS=Homo sapiens OX=9606 GN=SETD7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	52-UNIMOD:35	0.05	28.0	3	2	1
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	3	1	0
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|Q9UKY1|ZHX1_HUMAN	Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	1	1	0
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	84-UNIMOD:4	0.03	28.0	3	3	3
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q5W111-2|SPRY7_HUMAN	Isoform 2 of SPRY domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SPRYD7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	2	2	2
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8IY37|DHX37_HUMAN	Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens OX=9606 GN=DHX37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	27-UNIMOD:35	0.01	28.0	1	1	0
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	5	3	2
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	796-UNIMOD:35	0.03	28.0	3	2	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P56211-2|ARP19_HUMAN	Isoform ARPP-16 of cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.17	28.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	3	3	3
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	2	2	2
PRT	sp|Q9BW66|CINP_HUMAN	Cyclin-dependent kinase 2-interacting protein OS=Homo sapiens OX=9606 GN=CINP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|O75431|MTX2_HUMAN	Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	2	2	2
PRT	sp|Q05639|EF1A2_HUMAN	Elongation factor 1-alpha 2 OS=Homo sapiens OX=9606 GN=EEF1A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q9NRW7|VPS45_HUMAN	Vacuolar protein sorting-associated protein 45 OS=Homo sapiens OX=9606 GN=VPS45 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	117-UNIMOD:35	0.04	28.0	2	2	2
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O14776|TCRG1_HUMAN	Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	4	2	0
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.16	28.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	1	1	1
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	372-UNIMOD:35,382-UNIMOD:4	0.09	28.0	2	2	2
PRT	sp|Q5VUJ6|LRCH2_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRCH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q8WVC6|DCAKD_HUMAN	Dephospho-CoA kinase domain-containing protein OS=Homo sapiens OX=9606 GN=DCAKD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.12	28.0	2	2	1
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	340-UNIMOD:35,349-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	8	1	0
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	153-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	257-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	211-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	282-UNIMOD:4,292-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	888-UNIMOD:4	0.03	27.0	2	2	2
PRT	sp|P47974|TISD_HUMAN	mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	174-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	523-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|O60911|CATL2_HUMAN	Cathepsin L2 OS=Homo sapiens OX=9606 GN=CTSV PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	323-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q92544|TM9S4_HUMAN	Transmembrane 9 superfamily member 4 OS=Homo sapiens OX=9606 GN=TM9SF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P52564-2|MP2K6_HUMAN	Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	253-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9P2J5-3|SYLC_HUMAN	Isoform 3 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	26-UNIMOD:35	0.06	27.0	2	2	1
PRT	sp|Q9H993|ARMT1_HUMAN	Damage-control phosphatase ARMT1 OS=Homo sapiens OX=9606 GN=ARMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	2	2
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	62-UNIMOD:4,63-UNIMOD:35	0.10	27.0	4	3	2
PRT	sp|Q8N3R9-2|MPP5_HUMAN	Isoform 2 of MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	139-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	128-UNIMOD:4,131-UNIMOD:35	0.15	27.0	3	2	1
PRT	sp|Q06203|PUR1_HUMAN	Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	486-UNIMOD:35,496-UNIMOD:4	0.06	27.0	2	2	2
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	62-UNIMOD:35,63-UNIMOD:35	0.07	27.0	2	1	0
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	4	4	4
PRT	sp|P20839-2|IMDH1_HUMAN	Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	110-UNIMOD:35,125-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|Q96G21|IMP4_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9H3G5|CPVL_HUMAN	Probable serine carboxypeptidase CPVL OS=Homo sapiens OX=9606 GN=CPVL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	271-UNIMOD:4,274-UNIMOD:4	0.02	27.0	2	1	0
PRT	sp|Q96IY1-2|NSL1_HUMAN	Isoform 2 of Kinetochore-associated protein NSL1 homolog OS=Homo sapiens OX=9606 GN=NSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	3	1	0
PRT	sp|O95684-2|CEP43_HUMAN	Isoform 2 of Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q5T9L3|WLS_HUMAN	Protein wntless homolog OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	71-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q96H35|RBM18_HUMAN	Probable RNA-binding protein 18 OS=Homo sapiens OX=9606 GN=RBM18 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	505-UNIMOD:4	0.02	27.0	3	3	3
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P17026|ZNF22_HUMAN	Zinc finger protein 22 OS=Homo sapiens OX=9606 GN=ZNF22 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	147-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	29-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q14344-2|GNA13_HUMAN	Isoform 2 of Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens OX=9606 GN=GNA13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q96SZ6-5|CK5P1_HUMAN	Isoform 5 of Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Homo sapiens OX=9606 GN=CDK5RAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:35	0.12	27.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NQ88|TIGAR_HUMAN	Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P07738|PMGE_HUMAN	Bisphosphoglycerate mutase OS=Homo sapiens OX=9606 GN=BPGM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	1	1	1
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	2	1	0
PRT	sp|Q96A65-2|EXOC4_HUMAN	Isoform 2 of Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q96CW5-2|GCP3_HUMAN	Isoform 2 of Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	138-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|Q14203-3|DCTN1_HUMAN	Isoform 3 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	64-UNIMOD:4	0.02	27.0	2	2	2
PRT	sp|Q96AX1|VP33A_HUMAN	Vacuolar protein sorting-associated protein 33A OS=Homo sapiens OX=9606 GN=VPS33A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96KN1|LRAT2_HUMAN	Protein LRATD2 OS=Homo sapiens OX=9606 GN=LRATD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8WV92|MITD1_HUMAN	MIT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MITD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	233-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	3	3	3
PRT	sp|Q6P1L5|F117B_HUMAN	Protein FAM117B OS=Homo sapiens OX=9606 GN=FAM117B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	319-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|O95985-3|TOP3B_HUMAN	Isoform 3 of DNA topoisomerase 3-beta-1 OS=Homo sapiens OX=9606 GN=TOP3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	2	2	2
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|Q9BZE1|RM37_HUMAN	39S ribosomal protein L37, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|O60870-2|KIN17_HUMAN	Isoform 2 of DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	0
PRT	sp|P12235|ADT1_HUMAN	ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	3	2	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	93-UNIMOD:35,237-UNIMOD:35	0.04	27.0	2	2	0
PRT	sp|Q9Y3Z3|SAMH1_HUMAN	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	362-UNIMOD:35	0.02	27.0	1	1	0
PRT	sp|P13995|MTDC_HUMAN	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	207-UNIMOD:35,211-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|Q96SI9|STRBP_HUMAN	Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	154-UNIMOD:35	0.17	27.0	3	3	3
PRT	sp|O15392|BIRC5_HUMAN	Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	84-UNIMOD:4	0.09	27.0	1	1	0
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=H3-4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	121-UNIMOD:35	0.19	27.0	3	2	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|O75150|BRE1B_HUMAN	E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	986-UNIMOD:4	0.02	27.0	2	2	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	39-UNIMOD:4	0.14	27.0	3	2	1
PRT	sp|Q9Y237|PIN4_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	126-UNIMOD:35	0.21	27.0	3	2	1
PRT	sp|P26367|PAX6_HUMAN	Paired box protein Pax-6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q8N6M0|OTU6B_HUMAN	Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	2	1	0
PRT	sp|Q9BZL1|UBL5_HUMAN	Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	1	1	1
PRT	sp|Q9UI36|DACH1_HUMAN	Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8IZH2|XRN1_HUMAN	5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P22694|KAPCB_HUMAN	cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9Y285|SYFA_HUMAN	Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	2	2	2
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P46199|IF2M_HUMAN	Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P35249|RFC4_HUMAN	Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	282-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	3	1	0
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	2	2	2
PRT	sp|Q8NCW5|NNRE_HUMAN	NAD(P)H-hydrate epimerase OS=Homo sapiens OX=9606 GN=NAXE PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	158-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	2	1
PRT	sp|Q9BW61|DDA1_HUMAN	DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	435-UNIMOD:4	0.02	26.0	4	4	4
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	234-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	270-UNIMOD:4	0.07	26.0	2	2	2
PRT	sp|P83436|COG7_HUMAN	Conserved oligomeric Golgi complex subunit 7 OS=Homo sapiens OX=9606 GN=COG7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	174-UNIMOD:4	0.03	26.0	3	2	1
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	3	1	0
PRT	sp|P50748|KNTC1_HUMAN	Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O60279|SUSD5_HUMAN	Sushi domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SUSD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8TEA1|NSUN6_HUMAN	tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 OS=Homo sapiens OX=9606 GN=NSUN6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|O43707-3|ACTN4_HUMAN	Isoform 3 of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	339-UNIMOD:35	0.04	26.0	3	2	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q9HCU5|PREB_HUMAN	Prolactin regulatory element-binding protein OS=Homo sapiens OX=9606 GN=PREB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	128-UNIMOD:4	0.07	26.0	2	2	2
PRT	sp|Q9NZ45|CISD1_HUMAN	CDGSH iron-sulfur domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CISD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	83-UNIMOD:4	0.11	26.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9Y376|CAB39_HUMAN	Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O60318-2|GANP_HUMAN	Isoform MCM3AP of Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	570-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9UHQ4|BAP29_HUMAN	B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	171-UNIMOD:4	0.11	26.0	2	2	2
PRT	sp|Q92620-2|PRP16_HUMAN	Isoform 2 of Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:4	0.07	26.0	2	2	2
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	245-UNIMOD:35	0.01	26.0	2	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	742-UNIMOD:4	0.02	26.0	2	1	0
PRT	sp|Q8IX01-4|SUGP2_HUMAN	Isoform 4 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P32929-2|CGL_HUMAN	Isoform 2 of Cystathionine gamma-lyase OS=Homo sapiens OX=9606 GN=CTH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q7L9L4|MOB1B_HUMAN	MOB kinase activator 1B OS=Homo sapiens OX=9606 GN=MOB1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.13	26.0	2	2	2
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q3B7T1-3|EDRF1_HUMAN	Isoform 2 of Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q6ZNB6|NFXL1_HUMAN	NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	779-UNIMOD:4,782-UNIMOD:35,783-UNIMOD:4,788-UNIMOD:4,792-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O95229|ZWINT_HUMAN	ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	2	2	2
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1287-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q15041-2|AR6P1_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	80-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	519-UNIMOD:4,1476-UNIMOD:4	0.02	26.0	3	3	3
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|P53365-3|ARFP2_HUMAN	Isoform 3 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9NQC3-3|RTN4_HUMAN	Isoform C of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q66GS9|CP135_HUMAN	Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9NW13-2|RBM28_HUMAN	Isoform 2 of RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q13445|TMED1_HUMAN	Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TMED1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q6IA86-4|ELP2_HUMAN	Isoform 4 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75880|SCO1_HUMAN	Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	294-UNIMOD:35	0.05	26.0	2	1	0
PRT	sp|P78332-2|RBM6_HUMAN	Isoform 2 of RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q15650|TRIP4_HUMAN	Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q8TCG1|CIP2A_HUMAN	Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	848-UNIMOD:35	0.01	26.0	3	1	0
PRT	sp|Q13283-2|G3BP1_HUMAN	Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	66-UNIMOD:35,73-UNIMOD:4	0.11	26.0	2	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	519-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	62-UNIMOD:35	0.12	26.0	3	2	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	940-UNIMOD:4	0.04	26.0	4	4	4
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|Q9UL63|MKLN1_HUMAN	Muskelin OS=Homo sapiens OX=9606 GN=MKLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	148-UNIMOD:4	0.03	26.0	2	2	2
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	171-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|P23378|GCSP_HUMAN	Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9Y6I9|TX264_HUMAN	Testis-expressed protein 264 OS=Homo sapiens OX=9606 GN=TEX264 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	204-UNIMOD:35	0.04	26.0	2	2	2
PRT	sp|O95470|SGPL1_HUMAN	Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q96J02-3|ITCH_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q86YB8|ERO1B_HUMAN	ERO1-like protein beta OS=Homo sapiens OX=9606 GN=ERO1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	165-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q02127|PYRD_HUMAN	Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Homo sapiens OX=9606 GN=DHODH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|Q9BWE0|REPI1_HUMAN	Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75379|VAMP4_HUMAN	Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.11	26.0	1	1	0
PRT	sp|Q5TAP6|UT14C_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog C OS=Homo sapiens OX=9606 GN=UTP14C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75694|NU155_HUMAN	Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q58A45|PAN3_HUMAN	PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UBF8|PI4KB_HUMAN	Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P06899|H2B1J_HUMAN	Histone H2B type 1-J OS=Homo sapiens OX=9606 GN=H2BC11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	386-UNIMOD:4,286-UNIMOD:35	0.08	26.0	6	5	4
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9UKJ3|GPTC8_HUMAN	G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q8WWK9|CKAP2_HUMAN	Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	2	2	1
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	2	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	217-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	1964-UNIMOD:4	0.01	26.0	4	3	1
PRT	sp|P52701|MSH6_HUMAN	DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q7Z6K5|ARPIN_HUMAN	Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	890-UNIMOD:35,893-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	286-UNIMOD:35,292-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P01889|HLAB_HUMAN	HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	349-UNIMOD:4,283-UNIMOD:4	0.12	26.0	2	2	2
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	133-UNIMOD:35,134-UNIMOD:35	0.13	25.0	3	2	1
PRT	sp|P22392-2|NDKB_HUMAN	Isoform 3 of Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	3	2	1
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.16	25.0	3	3	3
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	765-UNIMOD:4	0.02	25.0	2	2	2
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9BW91-2|NUDT9_HUMAN	Isoform 2 of ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q4LDG9-2|DNAL1_HUMAN	Isoform 2 of Dynein light chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.19	25.0	1	1	1
PRT	sp|Q99633|PRP18_HUMAN	Pre-mRNA-splicing factor 18 OS=Homo sapiens OX=9606 GN=PRPF18 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O75306-2|NDUS2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UNZ5|L10K_HUMAN	Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	67-UNIMOD:35	0.10	25.0	1	1	1
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.11	25.0	2	2	2
PRT	sp|Q9BY32-3|ITPA_HUMAN	Isoform 3 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	362-UNIMOD:35	0.06	25.0	3	2	1
PRT	sp|Q96A33-2|CCD47_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 47 OS=Homo sapiens OX=9606 GN=CCDC47	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	317-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	307-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q9GZZ1-2|NAA50_HUMAN	Isoform 2 of N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.16	25.0	1	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	676-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q01844-2|EWS_HUMAN	Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q92520|FAM3C_HUMAN	Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	2	2	2
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NXE4-5|NSMA3_HUMAN	Isoform 5 of Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	150-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q96PK6-3|RBM14_HUMAN	Isoform 3 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q86X55-2|CARM1_HUMAN	Isoform 2 of Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:35	0.06	25.0	2	2	2
PRT	sp|Q5T200-2|ZC3HD_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9BWH6-2|RPAP1_HUMAN	Isoform 2 of RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	84-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9NZL9-3|MAT2B_HUMAN	Isoform 3 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	17-UNIMOD:4,231-UNIMOD:4	0.11	25.0	2	2	2
PRT	sp|Q9GZQ8|MLP3B_HUMAN	Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	4	3	2
PRT	sp|Q8WVV9-5|HNRLL_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O75063|XYLK_HUMAN	Glycosaminoglycan xylosylkinase OS=Homo sapiens OX=9606 GN=FAM20B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q7Z478|DHX29_HUMAN	ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q96BW5-2|PTER_HUMAN	Isoform 2 of Phosphotriesterase-related protein OS=Homo sapiens OX=9606 GN=PTER	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	46-UNIMOD:35	0.17	25.0	2	2	2
PRT	sp|Q8TED1|GPX8_HUMAN	Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q5T440|CAF17_HUMAN	Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q969Z0-2|FAKD4_HUMAN	Isoform 2 of FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y263|PLAP_HUMAN	Phospholipase A-2-activating protein OS=Homo sapiens OX=9606 GN=PLAA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	631-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	557-UNIMOD:35,563-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	293-UNIMOD:35	0.06	25.0	4	2	0
PRT	sp|Q5VSL9-2|STRP1_HUMAN	Isoform 2 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|Q9UPN3-5|MACF1_HUMAN	Isoform 4 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	2	2
PRT	sp|Q9P2M7|CING_HUMAN	Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9NS87-2|KIF15_HUMAN	Isoform 2 of Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q5T0B9|ZN362_HUMAN	Zinc finger protein 362 OS=Homo sapiens OX=9606 GN=ZNF362 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	263-UNIMOD:35	0.09	25.0	1	1	1
PRT	sp|O00291-3|HIP1_HUMAN	Isoform 3 of Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	558-UNIMOD:35,158-UNIMOD:35	0.08	25.0	5	4	3
PRT	sp|P25490|TYY1_HUMAN	Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	298-UNIMOD:4,303-UNIMOD:4	0.05	25.0	2	2	2
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q13155-2|AIMP2_HUMAN	Isoform 2 of Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|O15382-2|BCAT2_HUMAN	Isoform B of Branched-chain-amino-acid aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=BCAT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	250-UNIMOD:4,253-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	69-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|P49593-2|PPM1F_HUMAN	Isoform 2 of Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P00414|COX3_HUMAN	Cytochrome c oxidase subunit 3 OS=Homo sapiens OX=9606 GN=MT-CO3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	10-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.00	25.0	1	1	0
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.00	25.0	1	1	0
PRT	sp|Q9UEG4|ZN629_HUMAN	Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	893-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q96HR8|NAF1_HUMAN	H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	204-UNIMOD:35	0.09	25.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P07954|FUMH_HUMAN	Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	506-UNIMOD:35	0.02	25.0	3	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|Q96RU2|UBP28_HUMAN	Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	126-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|P61923|COPZ1_HUMAN	Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	102-UNIMOD:4	0.04	25.0	3	3	3
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	641-UNIMOD:35,643-UNIMOD:4	0.01	25.0	2	2	2
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	3	2	1
PRT	sp|Q7L7X3|TAOK1_HUMAN	Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P50570|DYN2_HUMAN	Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O95166|GBRAP_HUMAN	Gamma-aminobutyric acid receptor-associated protein OS=Homo sapiens OX=9606 GN=GABARAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.19	25.0	2	2	2
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.16	25.0	2	2	2
PRT	sp|O95619|YETS4_HUMAN	YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9BZZ5|API5_HUMAN	Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q6ZRS2|SRCAP_HUMAN	Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q10471|GALT2_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|O43776|SYNC_HUMAN	Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	2	2	2
PRT	sp|Q53GS9|SNUT2_HUMAN	U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	353-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	326-UNIMOD:4	0.04	25.0	2	1	0
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	1	0
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	424-UNIMOD:35,434-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	156-UNIMOD:35,157-UNIMOD:35	0.07	25.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	5	2	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	475-UNIMOD:35,479-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9HBM0|VEZA_HUMAN	Vezatin OS=Homo sapiens OX=9606 GN=VEZT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9Y2X9|ZN281_HUMAN	Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|P42773|CDN2C_HUMAN	Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q8WYA6-3|CTBL1_HUMAN	Isoform 3 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	156-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q96GC9|VMP1_HUMAN	Vacuole membrane protein 1 OS=Homo sapiens OX=9606 GN=VMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q8IWR0-2|Z3H7A_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q6NSI4-3|RADX_HUMAN	Isoform 3 of RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q16795|NDUA9_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q6PJG2|MDEAS_HUMAN	Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15542-2|TAF5_HUMAN	Isoform Short of Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	227-UNIMOD:4,231-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	151-UNIMOD:35	0.04	24.0	2	2	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	3	3	3
PRT	sp|Q13356|PPIL2_HUMAN	RING-type E3 ubiquitin-protein ligase PPIL2 OS=Homo sapiens OX=9606 GN=PPIL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	2	2	2
PRT	sp|Q9H6T3-3|RPAP3_HUMAN	Isoform 3 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P36871-3|PGM1_HUMAN	Isoform 3 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	2	1	0
PRT	sp|P61513|RL37A_HUMAN	60S ribosomal protein L37a OS=Homo sapiens OX=9606 GN=RPL37A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|O75947-2|ATP5H_HUMAN	Isoform 2 of ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|P53582|MAP11_HUMAN	Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8TDI0|CHD5_HUMAN	Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	928-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	653-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q86X83-2|COMD2_HUMAN	Isoform 2 of COMM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=COMMD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|O94760-2|DDAH1_HUMAN	Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	153-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|O75419-2|CDC45_HUMAN	Isoform 2 of Cell division control protein 45 homolog OS=Homo sapiens OX=9606 GN=CDC45	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	2	2	2
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P11233|RALA_HUMAN	Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O15294-3|OGT1_HUMAN	Isoform 1 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	629-UNIMOD:35	0.04	24.0	3	3	3
PRT	sp|Q16850-2|CP51A_HUMAN	Isoform 2 of Lanosterol 14-alpha demethylase OS=Homo sapiens OX=9606 GN=CYP51A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q2TAY7|SMU1_HUMAN	WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	23-UNIMOD:4,30-UNIMOD:35	0.17	24.0	2	1	0
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	80-UNIMOD:4	0.10	24.0	3	2	1
PRT	sp|Q15555-2|MARE2_HUMAN	Isoform 2 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q8IXH7-4|NELFD_HUMAN	Isoform NELF-D of Negative elongation factor C/D OS=Homo sapiens OX=9606 GN=NELFCD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	354-UNIMOD:4,355-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q86YM7-3|HOME1_HUMAN	Isoform 3 of Homer protein homolog 1 OS=Homo sapiens OX=9606 GN=HOMER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q86Y79|PTH_HUMAN	Probable peptidyl-tRNA hydrolase OS=Homo sapiens OX=9606 GN=PTRH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	163-UNIMOD:4	0.06	24.0	3	2	1
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	54-UNIMOD:4	0.13	24.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	2	2	2
PRT	sp|O60287|NPA1P_HUMAN	Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	169-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q92800-5|EZH1_HUMAN	Isoform 5 of Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens OX=9606 GN=EZH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	160-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q92833-2|JARD2_HUMAN	Isoform 2 of Protein Jumonji OS=Homo sapiens OX=9606 GN=JARID2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q92900-2|RENT1_HUMAN	Isoform 2 of Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UJA3-2|MCM8_HUMAN	Isoform 2 of DNA helicase MCM8 OS=Homo sapiens OX=9606 GN=MCM8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8NEL9-3|DDHD1_HUMAN	Isoform 3 of Phospholipase DDHD1 OS=Homo sapiens OX=9606 GN=DDHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q15404-2|RSU1_HUMAN	Isoform 2 of Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	197-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	3	2	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9ULA0-2|DNPEP_HUMAN	Isoform 2 of Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y4J8-6|DTNA_HUMAN	Isoform 6 of Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	338-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|Q96EU6-2|RRP36_HUMAN	Isoform 2 of Ribosomal RNA processing protein 36 homolog OS=Homo sapiens OX=9606 GN=RRP36	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96I51-2|RCC1L_HUMAN	Isoform 2 of RCC1-like G exchanging factor-like protein OS=Homo sapiens OX=9606 GN=RCC1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	89-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|Q96S19-3|MTL26_HUMAN	Isoform 3 of Methyltransferase-like 26 OS=Homo sapiens OX=9606 GN=METTL26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	3	2	1
PRT	sp|Q16539-5|MK14_HUMAN	Isoform 5 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q2PZI1|D19L1_HUMAN	Probable C-mannosyltransferase DPY19L1 OS=Homo sapiens OX=9606 GN=DPY19L1 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9Y6Y8-2|S23IP_HUMAN	Isoform 2 of SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	393-UNIMOD:35	0.04	24.0	3	3	2
PRT	sp|Q9BW27-3|NUP85_HUMAN	Isoform 3 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P43360|MAGA6_HUMAN	Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	10-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	520-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	611-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P82675|RT05_HUMAN	28S ribosomal protein S5, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	3	2	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	362-UNIMOD:35	0.01	24.0	1	1	0
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	395-UNIMOD:35	0.11	24.0	2	2	2
PRT	sp|Q69YN2|C19L1_HUMAN	CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9BUK6|MSTO1_HUMAN	Protein misato homolog 1 OS=Homo sapiens OX=9606 GN=MSTO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	3	2	1
PRT	sp|Q9NQ48|LZTL1_HUMAN	Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q15645|PCH2_HUMAN	Pachytene checkpoint protein 2 homolog OS=Homo sapiens OX=9606 GN=TRIP13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	276-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q9H098|F107B_HUMAN	Protein FAM107B OS=Homo sapiens OX=9606 GN=FAM107B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|Q8IZQ5|SELH_HUMAN	Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96Q89|KI20B_HUMAN	Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5VT52|RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	224-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9P253|VPS18_HUMAN	Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q5F1R6|DJC21_HUMAN	DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P53990|IST1_HUMAN	IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	868-UNIMOD:35	0.01	24.0	2	1	0
PRT	sp|Q96BP3|PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	583-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	441-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	482-UNIMOD:4	0.01	24.0	3	3	3
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	3	3	3
PRT	sp|Q9P0I2|EMC3_HUMAN	ER membrane protein complex subunit 3 OS=Homo sapiens OX=9606 GN=EMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	251-UNIMOD:35	0.04	23.0	2	1	0
PRT	sp|Q86SQ0-2|PHLB2_HUMAN	Isoform 2 of Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	3	3	3
PRT	sp|Q9H2U2-6|IPYR2_HUMAN	Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P51648|AL3A2_HUMAN	Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q13011|ECH1_HUMAN	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O15078|CE290_HUMAN	Centrosomal protein of 290 kDa OS=Homo sapiens OX=9606 GN=CEP290 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q92664-2|TF3A_HUMAN	Isoform 2 of Transcription factor IIIA OS=Homo sapiens OX=9606 GN=GTF3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	154-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:4	0.16	23.0	2	2	2
PRT	sp|O43747|AP1G1_HUMAN	AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	160-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P53985-2|MOT1_HUMAN	Isoform 2 of Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8WXW3|PIBF1_HUMAN	Progesterone-induced-blocking factor 1 OS=Homo sapiens OX=9606 GN=PIBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q13418-3|ILK_HUMAN	Isoform 3 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q12834|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UJ14|GGT7_HUMAN	Glutathione hydrolase 7 OS=Homo sapiens OX=9606 GN=GGT7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	704-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9UH99-3|SUN2_HUMAN	Isoform 3 of SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y2G5-2|OFUT2_HUMAN	Isoform B of GDP-fucose protein O-fucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POFUT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	503-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|O14976-2|GAK_HUMAN	Isoform 2 of Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q6ZN17-2|LN28B_HUMAN	Isoform 2 of Protein lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	59-UNIMOD:4,62-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q9H040-3|SPRTN_HUMAN	Isoform 3 of SprT-like domain-containing protein Spartan OS=Homo sapiens OX=9606 GN=SPRTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q5NDL2-2|EOGT_HUMAN	Isoform 2 of EGF domain-specific O-linked N-acetylglucosamine transferase OS=Homo sapiens OX=9606 GN=EOGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	187-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q04760-2|LGUL_HUMAN	Isoform 2 of Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	124-UNIMOD:4	0.11	23.0	1	1	1
PRT	sp|Q9Y3C8|UFC1_HUMAN	Ubiquitin-fold modifier-conjugating enzyme 1 OS=Homo sapiens OX=9606 GN=UFC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P49750-1|YLPM1_HUMAN	Isoform 1 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q9Y375|CIA30_HUMAN	Complex I intermediate-associated protein 30, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	2	2	2
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	105-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	283-UNIMOD:4,287-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q15398-1|DLGP5_HUMAN	Isoform 2 of Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q92794|KAT6A_HUMAN	Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	33-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P29992|GNA11_HUMAN	Guanine nucleotide-binding protein subunit alpha-11 OS=Homo sapiens OX=9606 GN=GNA11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q9P0K7-4|RAI14_HUMAN	Isoform 4 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P56937-3|DHB7_HUMAN	Isoform 3 of 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7 OS=Homo sapiens OX=9606 GN=HSD17B7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P57772-2|SELB_HUMAN	Isoform 2 of Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q86TM6-2|SYVN1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	256-UNIMOD:4,264-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P38571-2|LICH_HUMAN	Isoform 2 of Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens OX=9606 GN=LIPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	297-UNIMOD:35	0.05	23.0	2	1	0
PRT	sp|O94901-5|SUN1_HUMAN	Isoform 5 of SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	352-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	297-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	822-UNIMOD:4,1498-UNIMOD:35	0.03	23.0	3	3	3
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	190-UNIMOD:35	0.04	23.0	2	1	0
PRT	sp|Q9NP77-2|SSU72_HUMAN	Isoform 2 of RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	20-UNIMOD:35	0.08	23.0	1	1	0
PRT	sp|Q14011|CIRBP_HUMAN	Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|Q9UK61-2|TASOR_HUMAN	Isoform 2 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P35219|CAH8_HUMAN	Carbonic anhydrase-related protein OS=Homo sapiens OX=9606 GN=CA8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	266-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q96JJ7-2|TMX3_HUMAN	Isoform 2 of Protein disulfide-isomerase TMX3 OS=Homo sapiens OX=9606 GN=TMX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|O96013-2|PAK4_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8N5L8|RP25L_HUMAN	Ribonuclease P protein subunit p25-like protein OS=Homo sapiens OX=9606 GN=RPP25L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	151-UNIMOD:35	0.02	23.0	1	1	0
PRT	sp|O60870|KIN17_HUMAN	DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	1	0
PRT	sp|Q8N954|GPT11_HUMAN	G patch domain-containing protein 11 OS=Homo sapiens OX=9606 GN=GPATCH11 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.12	23.0	2	2	2
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	218-UNIMOD:35	0.17	23.0	3	3	3
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P20585|MSH3_HUMAN	DNA mismatch repair protein Msh3 OS=Homo sapiens OX=9606 GN=MSH3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9Y5V3|MAGD1_HUMAN	Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75976|CBPD_HUMAN	Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96SN8|CK5P2_HUMAN	CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8N442|GUF1_HUMAN	Translation factor GUF1, mitochondrial OS=Homo sapiens OX=9606 GN=GUF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P04637|P53_HUMAN	Cellular tumor antigen p53 OS=Homo sapiens OX=9606 GN=TP53 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q15345|LRC41_HUMAN	Leucine-rich repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=LRRC41 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q53GS7|GLE1_HUMAN	Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	164-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q96GA3|LTV1_HUMAN	Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P09493|TPM1_HUMAN	Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q7L3B6|CD37L_HUMAN	Hsp90 co-chaperone Cdc37-like 1 OS=Homo sapiens OX=9606 GN=CDC37L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	159-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q03188|CENPC_HUMAN	Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q12778|FOXO1_HUMAN	Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P82673|RT35_HUMAN	28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99470|SDF2_HUMAN	Stromal cell-derived factor 2 OS=Homo sapiens OX=9606 GN=SDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q6PCB5-2|RSBNL_HUMAN	Isoform 2 of Lysine-specific demethylase RSBN1L OS=Homo sapiens OX=9606 GN=RSBN1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O43447-2|PPIH_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	88-UNIMOD:4	0.10	22.0	1	1	1
PRT	sp|Q9P032|NDUF4_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 OS=Homo sapiens OX=9606 GN=NDUFAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	224-UNIMOD:4	0.08	22.0	2	2	2
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	119-UNIMOD:4	0.08	22.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	249-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q5BJF2|SGMR2_HUMAN	Sigma intracellular receptor 2 OS=Homo sapiens OX=9606 GN=TMEM97 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|P06753-7|TPM3_HUMAN	Isoform 7 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	136-UNIMOD:4,143-UNIMOD:4	0.14	22.0	2	2	2
PRT	sp|Q13277-2|STX3_HUMAN	Isoform B of Syntaxin-3 OS=Homo sapiens OX=9606 GN=STX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	356-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	81-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q15393-2|SF3B3_HUMAN	Isoform 2 of Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	112-UNIMOD:4	0.05	22.0	1	1	0
PRT	sp|Q9UPT9-2|UBP22_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens OX=9606 GN=USP22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	371-UNIMOD:4,374-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P78356-2|PI42B_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P63151|2ABA_HUMAN	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	165-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9BXW7-2|HDHD5_HUMAN	Isoform 1 of Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9NQ50|RM40_HUMAN	39S ribosomal protein L40, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL40 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P51553-2|IDH3G_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q969X6-3|UTP4_HUMAN	Isoform 3 of U3 small nucleolar RNA-associated protein 4 homolog OS=Homo sapiens OX=9606 GN=UTP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	197-UNIMOD:4,164-UNIMOD:4	0.10	22.0	2	2	2
PRT	sp|Q9BXS6-7|NUSAP_HUMAN	Isoform 7 of Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q8WW12-3|PCNP_HUMAN	Isoform 3 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.24	22.0	2	1	0
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|Q6P3W7|SCYL2_HUMAN	SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	616-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q08209-5|PP2BA_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.18	22.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q15833-2|STXB2_HUMAN	Isoform 2 of Syntaxin-binding protein 2 OS=Homo sapiens OX=9606 GN=STXBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	350-UNIMOD:4,351-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	201-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9UHR5-2|S30BP_HUMAN	Isoform 2 of SAP30-binding protein OS=Homo sapiens OX=9606 GN=SAP30BP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	111-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q13619-2|CUL4A_HUMAN	Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1531-UNIMOD:35	0.01	22.0	2	2	2
PRT	sp|Q96S66-4|CLCC1_HUMAN	Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P11532-16|DMD_HUMAN	Isoform 10 of Dystrophin OS=Homo sapiens OX=9606 GN=DMD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1111-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q15047-3|SETB1_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens OX=9606 GN=SETDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	51-UNIMOD:35,53-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q2VPK5-3|CTU2_HUMAN	Isoform 2 of Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	220-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P27540-2|ARNT_HUMAN	Isoform 2 of Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|Q15797|SMAD1_HUMAN	Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	3	2	1
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	179-UNIMOD:35	0.02	22.0	2	2	2
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	23-UNIMOD:35	0.10	22.0	2	1	0
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P29590-14|PML_HUMAN	Isoform PML-14 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	189-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q8NEY1-5|NAV1_HUMAN	Isoform 5 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8TCF1-4|ZFAN1_HUMAN	Isoform 4 of AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	64-UNIMOD:4,181-UNIMOD:35,184-UNIMOD:4	0.11	22.0	2	2	2
PRT	sp|O60930|RNH1_HUMAN	Ribonuclease H1 OS=Homo sapiens OX=9606 GN=RNASEH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9UNS2-2|CSN3_HUMAN	Isoform 2 of COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96CD2-2|COAC_HUMAN	Isoform 2 of Phosphopantothenoylcysteine decarboxylase OS=Homo sapiens OX=9606 GN=PPCDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q12907|LMAN2_HUMAN	Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|O00754-2|MA2B1_HUMAN	Isoform 2 of Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y2I1-4|NISCH_HUMAN	Isoform 4 of Nischarin OS=Homo sapiens OX=9606 GN=NISCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	162-UNIMOD:4	0.13	22.0	3	1	0
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9NVX0|HAUS2_HUMAN	HAUS augmin-like complex subunit 2 OS=Homo sapiens OX=9606 GN=HAUS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	0
PRT	sp|Q92572|AP3S1_HUMAN	AP-3 complex subunit sigma-1 OS=Homo sapiens OX=9606 GN=AP3S1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9Y5K5|UCHL5_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8N0T1|RBIS_HUMAN	Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.14	22.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|O94822|LTN1_HUMAN	E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UNF0|PACN2_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q96G28|CFA36_HUMAN	Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P33552|CKS2_HUMAN	Cyclin-dependent kinases regulatory subunit 2 OS=Homo sapiens OX=9606 GN=CKS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|Q969Z0|FAKD4_HUMAN	FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q6PFW1|VIP1_HUMAN	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q96GM5|SMRD1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P35610|SOAT1_HUMAN	Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|A3KN83|SBNO1_HUMAN	Protein strawberry notch homolog 1 OS=Homo sapiens OX=9606 GN=SBNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UQR0|SCML2_HUMAN	Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9P1Y6|PHRF1_HUMAN	PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8N4V1|MMGT1_HUMAN	Membrane magnesium transporter 1 OS=Homo sapiens OX=9606 GN=MMGT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q8IUR7|ARMC8_HUMAN	Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	643-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q8N1G2|CMTR1_HUMAN	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=CMTR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	9-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q7L576|CYFP1_HUMAN	Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9HD15|SRA1_HUMAN	Steroid receptor RNA activator 1 OS=Homo sapiens OX=9606 GN=SRA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	161-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q9NUL3|STAU2_HUMAN	Double-stranded RNA-binding protein Staufen homolog 2 OS=Homo sapiens OX=9606 GN=STAU2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	488-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96CX2|KCD12_HUMAN	BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q6P4H8-2|ACKMT_HUMAN	Isoform 2 of ATP synthase subunit C lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ATPSCKMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	149-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|Q9UNN5|FAF1_HUMAN	FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|Q8TCC3-3|RM30_HUMAN	Isoform 3 of 39S ribosomal protein L30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.14	21.0	1	1	1
PRT	sp|Q14141-2|SEPT6_HUMAN	Isoform I of Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q13901|C1D_HUMAN	Nuclear nucleic acid-binding protein C1D OS=Homo sapiens OX=9606 GN=C1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|Q96BN8|OTUL_HUMAN	Ubiquitin thioesterase otulin OS=Homo sapiens OX=9606 GN=OTULIN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96C23|GALM_HUMAN	Galactose mutarotase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q00013-2|EM55_HUMAN	Isoform 2 of 55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q68E01-4|INT3_HUMAN	Isoform 4 of Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	464-UNIMOD:35	0.04	21.0	2	2	2
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	2	1	0
PRT	sp|Q9UJ41|RABX5_HUMAN	Rab5 GDP/GTP exchange factor OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P14735|IDE_HUMAN	Insulin-degrading enzyme OS=Homo sapiens OX=9606 GN=IDE PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	683-UNIMOD:35	0.04	21.0	3	3	3
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O00443|P3C2A_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	541-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	166-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q3KQU3-4|MA7D1_HUMAN	Isoform 4 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|O00399|DCTN6_HUMAN	Dynactin subunit 6 OS=Homo sapiens OX=9606 GN=DCTN6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q96SN8-4|CK5P2_HUMAN	Isoform 4 of CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P11171-6|EPB41_HUMAN	Isoform 6 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	151-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|P37198|NUP62_HUMAN	Nuclear pore glycoprotein p62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	191-UNIMOD:4	0.05	21.0	2	1	0
PRT	sp|Q5JRA6-2|TGO1_HUMAN	Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:4,77-UNIMOD:4	0.11	21.0	1	1	1
PRT	sp|Q9UPW6-2|SATB2_HUMAN	Isoform 2 of DNA-binding protein SATB2 OS=Homo sapiens OX=9606 GN=SATB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O14733|MP2K7_HUMAN	Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8IVD9|NUDC3_HUMAN	NudC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NUDCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	111-UNIMOD:35	0.06	21.0	3	2	1
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|Q96KQ7-2|EHMT2_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P11234|RALB_HUMAN	Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9NVX0-2|HAUS2_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 2 OS=Homo sapiens OX=9606 GN=HAUS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	0
PRT	sp|Q86TU7-3|SETD3_HUMAN	Isoform 3 of Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q4V328-4|GRAP1_HUMAN	Isoform 4 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	708-UNIMOD:35,713-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P63165-2|SUMO1_HUMAN	Isoform 2 of Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	15-UNIMOD:35	0.12	21.0	1	1	0
PRT	sp|Q9NRX4-2|PHP14_HUMAN	Isoform 2 of 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|Q6ZXV5-2|TMTC3_HUMAN	Isoform 2 of Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P09960-4|LKHA4_HUMAN	Isoform 4 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	302-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q96HA7-2|TONSL_HUMAN	Isoform 2 of Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	66-UNIMOD:4,124-UNIMOD:4	0.02	21.0	2	2	2
PRT	sp|Q15904|VAS1_HUMAN	V-type proton ATPase subunit S1 OS=Homo sapiens OX=9606 GN=ATP6AP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q68D91|MBLC2_HUMAN	Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MBLAC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	176-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P42575|CASP2_HUMAN	Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	52-UNIMOD:35,54-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q4V348|Z658B_HUMAN	Zinc finger protein 658B OS=Homo sapiens OX=9606 GN=ZNF658B PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	392-UNIMOD:4,395-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q16595-2|FRDA_HUMAN	Isoform 2 of Frataxin, mitochondrial OS=Homo sapiens OX=9606 GN=FXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9H147|TDIF1_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|Q5VT66-3|MARC1_HUMAN	Isoform 3 of Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MTARC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	85-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y5B8-2|NDK7_HUMAN	Isoform 2 of Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9HCG8|CWC22_HUMAN	Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens OX=9606 GN=CWC22 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	808-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|O75157-2|T22D2_HUMAN	Isoform 2 of TSC22 domain family protein 2 OS=Homo sapiens OX=9606 GN=TSC22D2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P35241-3|RADI_HUMAN	Isoform 3 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q5T6F0|DCA12_HUMAN	DDB1- and CUL4-associated factor 12 OS=Homo sapiens OX=9606 GN=DCAF12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9BW91|NUDT9_HUMAN	ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	25-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|Q9H4L5|OSBL3_HUMAN	Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	638-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	848-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q8NFF5|FAD1_HUMAN	FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	486-UNIMOD:35	0.02	21.0	1	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	112-UNIMOD:4	0.02	21.0	2	2	1
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	158-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O75521|ECI2_HUMAN	Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q15054|DPOD3_HUMAN	DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8WUR7|CO040_HUMAN	UPF0235 protein C15orf40 OS=Homo sapiens OX=9606 GN=C15orf40 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|P57076|CF298_HUMAN	Cilia- and flagella-associated protein 298 OS=Homo sapiens OX=9606 GN=CFAP298 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	39-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|O75306|NDUS2_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|P41227|NAA10_HUMAN	N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9NXF1|TEX10_HUMAN	Testis-expressed protein 10 OS=Homo sapiens OX=9606 GN=TEX10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P23919|KTHY_HUMAN	Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9H2M9|RBGPR_HUMAN	Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q01826|SATB1_HUMAN	DNA-binding protein SATB1 OS=Homo sapiens OX=9606 GN=SATB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q567U6|CCD93_HUMAN	Coiled-coil domain-containing protein 93 OS=Homo sapiens OX=9606 GN=CCDC93 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	310-UNIMOD:4,313-UNIMOD:4,316-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q02224-3|CENPE_HUMAN	Isoform 3 of Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q7Z7A1-2|CNTRL_HUMAN	Isoform 2 of Centriolin OS=Homo sapiens OX=9606 GN=CNTRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	871-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9Y3A2|UTP11_HUMAN	Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens OX=9606 GN=UTP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	71-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q9NPJ6-2|MED4_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 4 OS=Homo sapiens OX=9606 GN=MED4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	47-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|Q5TB30-2|DEP1A_HUMAN	Isoform 2 of DEP domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DEPDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9BSJ2-3|GCP2_HUMAN	Isoform 2 of Gamma-tubulin complex component 2 OS=Homo sapiens OX=9606 GN=TUBGCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q92540-2|SMG7_HUMAN	Isoform 2 of Protein SMG7 OS=Homo sapiens OX=9606 GN=SMG7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P61201|CSN2_HUMAN	COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9BUK6-3|MSTO1_HUMAN	Isoform 3 of Protein misato homolog 1 OS=Homo sapiens OX=9606 GN=MSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	216-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	35-UNIMOD:35	0.09	20.0	1	1	1
PRT	sp|Q53T94-2|TAF1B_HUMAN	Isoform 2 of TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Homo sapiens OX=9606 GN=TAF1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BYD6|RM01_HUMAN	39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q8TBZ6|TM10A_HUMAN	tRNA methyltransferase 10 homolog A OS=Homo sapiens OX=9606 GN=TRMT10A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	164-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9NPB8|GPCP1_HUMAN	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens OX=9606 GN=GPCPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|Q9ULV3-5|CIZ1_HUMAN	Isoform 5 of Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P00167-2|CYB5_HUMAN	Isoform 2 of Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q96AC1-2|FERM2_HUMAN	Isoform 2 of Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BX63|FANCJ_HUMAN	Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P05067-2|A4_HUMAN	Isoform APP305 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q8NEG7|DEN6B_HUMAN	Protein DENND6B OS=Homo sapiens OX=9606 GN=DENND6B PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O75575-2|RPC9_HUMAN	Isoform 2 of DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens OX=9606 GN=CRCP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:4	0.11	20.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y2X7-2|GIT1_HUMAN	Isoform 2 of ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q9H1A7|RPB1C_HUMAN	DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens OX=9606 GN=POLR2J3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q6P2H3-4|CEP85_HUMAN	Isoform 4 of Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O43920|NDUS5_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 OS=Homo sapiens OX=9606 GN=NDUFS5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q15363|TMED2_HUMAN	Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	86-UNIMOD:35	0.09	20.0	1	1	1
PRT	sp|Q8IWV8-4|UBR2_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q96EP5|DAZP1_HUMAN	DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|Q8NFF5-3|FAD1_HUMAN	Isoform 3 of FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	389-UNIMOD:35	0.03	20.0	1	1	0
PRT	sp|Q8WVC6-2|DCAKD_HUMAN	Isoform 2 of Dephospho-CoA kinase domain-containing protein OS=Homo sapiens OX=9606 GN=DCAKD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	0
PRT	sp|Q14BN4-7|SLMAP_HUMAN	Isoform 7 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|O43837-2|IDH3B_HUMAN	Isoform A of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q96S55-3|WRIP1_HUMAN	Isoform 3 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9BYD3-2|RM04_HUMAN	Isoform 2 of 39S ribosomal protein L4, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O75525-2|KHDR3_HUMAN	Isoform 2 of KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	144-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|Q7Z4H3-3|HDDC2_HUMAN	Isoform 3 of 5'-deoxynucleotidase HDDC2 OS=Homo sapiens OX=9606 GN=HDDC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	50-UNIMOD:35	0.21	20.0	1	1	1
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1764-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O00165-5|HAX1_HUMAN	Isoform 5 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|O60826|CCD22_HUMAN	Coiled-coil domain-containing protein 22 OS=Homo sapiens OX=9606 GN=CCDC22 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P13995-2|MTDC_HUMAN	Isoform 2 of Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	774-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P31942|HNRH3_HUMAN	Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	176-UNIMOD:35,199-UNIMOD:35	0.08	20.0	1	1	1
PRT	sp|P49902|5NTC_HUMAN	Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	260-UNIMOD:35	0.04	20.0	1	1	0
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	641-UNIMOD:35	0.02	20.0	1	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	66-UNIMOD:35,73-UNIMOD:4	0.03	20.0	1	1	0
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|Q3MII6|TBC25_HUMAN	TBC1 domain family member 25 OS=Homo sapiens OX=9606 GN=TBC1D25 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H4Z3|CAPAM_HUMAN	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q6ZN84|CCD81_HUMAN	Coiled-coil domain-containing protein 81 OS=Homo sapiens OX=9606 GN=CCDC81 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O14561|ACPM_HUMAN	Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	105-UNIMOD:35	0.10	20.0	1	1	1
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P08237|PFKAM_HUMAN	ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	525-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	468-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q8NE01|CNNM3_HUMAN	Metal transporter CNNM3 OS=Homo sapiens OX=9606 GN=CNNM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	469-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P29084|T2EB_HUMAN	Transcription initiation factor IIE subunit beta OS=Homo sapiens OX=9606 GN=GTF2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	781-UNIMOD:4,782-UNIMOD:35	0.02	20.0	2	2	2
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	144-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|Q9GZZ1|NAA50_HUMAN	N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	0
PRT	sp|Q9UM54|MYO6_HUMAN	Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|O60518|RNBP6_HUMAN	Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6DKI1|RL7L_HUMAN	60S ribosomal protein L7-like 1 OS=Homo sapiens OX=9606 GN=RPL7L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q8N5I9|CL045_HUMAN	Uncharacterized protein C12orf45 OS=Homo sapiens OX=9606 GN=C12orf45 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	186-UNIMOD:35,187-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q9Y6A1|POMT1_HUMAN	Protein O-mannosyl-transferase 1 OS=Homo sapiens OX=9606 GN=POMT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BUH6|PAXX_HUMAN	Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9H2J4|PDCL3_HUMAN	Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1576-UNIMOD:35	0.02	20.0	2	2	2
PRT	sp|Q12797|ASPH_HUMAN	Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	689-UNIMOD:35,700-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q5JRX3|PREP_HUMAN	Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|Q86XP3|DDX42_HUMAN	ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	623-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9UHD8|SEPT9_HUMAN	Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9BX40|LS14B_HUMAN	Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	173-UNIMOD:35	0.08	20.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O60333|KIF1B_HUMAN	Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q13043|STK4_HUMAN	Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	388-UNIMOD:35	0.04	20.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	759-UNIMOD:35,763-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q9UBK9|UXT_HUMAN	Protein UXT OS=Homo sapiens OX=9606 GN=UXT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	137-UNIMOD:35	0.08	19.0	1	1	1
PRT	sp|Q8IUF8-2|RIOX2_HUMAN	Isoform 2 of Ribosomal oxygenase 2 OS=Homo sapiens OX=9606 GN=RIOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P16220-3|CREB1_HUMAN	Isoform 3 of Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	226-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q8WX93-7|PALLD_HUMAN	Isoform 7 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O00423|EMAL1_HUMAN	Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96AP4|ZUP1_HUMAN	Zinc finger-containing ubiquitin peptidase 1 OS=Homo sapiens OX=9606 GN=ZUP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8IXI1|MIRO2_HUMAN	Mitochondrial Rho GTPase 2 OS=Homo sapiens OX=9606 GN=RHOT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	513-UNIMOD:35,519-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P46977-2|STT3A_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q7Z3K3-5|POGZ_HUMAN	Isoform 5 of Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9Y4B6-3|DCAF1_HUMAN	Isoform 3 of DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NRN7|ADPPT_HUMAN	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase OS=Homo sapiens OX=9606 GN=AASDHPPT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9BW92-2|SYTM_HUMAN	Isoform 2 of Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BW66-2|CINP_HUMAN	Isoform 2 of Cyclin-dependent kinase 2-interacting protein OS=Homo sapiens OX=9606 GN=CINP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|Q8N9Q2|SR1IP_HUMAN	Protein SREK1IP1 OS=Homo sapiens OX=9606 GN=SREK1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	18-UNIMOD:4,28-UNIMOD:4	0.09	19.0	1	1	1
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q04864-2|REL_HUMAN	Isoform 2 of Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	294-UNIMOD:35	0.06	19.0	2	2	2
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9H845|ACAD9_HUMAN	Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	271-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q8TEY7-3|UBP33_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens OX=9606 GN=USP33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O75319-2|DUS11_HUMAN	Isoform 2 of RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	199-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q4J6C6-4|PPCEL_HUMAN	Isoform 4 of Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9Y6X5|ENPP4_HUMAN	Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	287-UNIMOD:4,291-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|P22413|ENPP1_HUMAN	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96HY7|DHTK1_HUMAN	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Homo sapiens OX=9606 GN=DHTKD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	495-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	182-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O14562|UBFD1_HUMAN	Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	124-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|Q9Y697-2|NFS1_HUMAN	Isoform Cytoplasmic of Cysteine desulfurase, mitochondrial OS=Homo sapiens OX=9606 GN=NFS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	29-UNIMOD:4,38-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8WVV5-3|BT2A2_HUMAN	Isoform 3 of Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	55-UNIMOD:4,66-UNIMOD:35	0.06	19.0	1	1	1
PRT	sp|Q8TAP9|MPLKI_HUMAN	M-phase-specific PLK1-interacting protein OS=Homo sapiens OX=9606 GN=MPLKIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q5T6V5|QSPP_HUMAN	Queuosine salvage protein OS=Homo sapiens OX=9606 GN=C9orf64 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	328-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	150-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|O43567-2|RNF13_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	139-UNIMOD:4,145-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q8NFD5-4|ARI1B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NVQ4|FAIM1_HUMAN	Fas apoptotic inhibitory molecule 1 OS=Homo sapiens OX=9606 GN=FAIM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q8NDV7-2|TNR6A_HUMAN	Isoform 2 of Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UBL3-2|ASH2L_HUMAN	Isoform 2 of Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9BW71-2|HIRP3_HUMAN	Isoform 2 of HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	232-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NSI2-2|F207A_HUMAN	Isoform B of Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q9NRV9|HEBP1_HUMAN	Heme-binding protein 1 OS=Homo sapiens OX=9606 GN=HEBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q13433-2|S39A6_HUMAN	Isoform 2 of Zinc transporter ZIP6 OS=Homo sapiens OX=9606 GN=SLC39A6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q8ND04-3|SMG8_HUMAN	Isoform 3 of Protein SMG8 OS=Homo sapiens OX=9606 GN=SMG8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	576-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O15013-7|ARHGA_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P0CW19-2|LIMS3_HUMAN	Isoform 2 of LIM and senescent cell antigen-like-containing domain protein 3 OS=Homo sapiens OX=9606 GN=LIMS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	148-UNIMOD:35,156-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q06124-3|PTN11_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NR56|MBNL1_HUMAN	Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	783-UNIMOD:4	0.01	19.0	1	1	0
PRT	sp|Q9BWH6|RPAP1_HUMAN	RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8TEU7|RPGF6_HUMAN	Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q14DG7|T132B_HUMAN	Transmembrane protein 132B OS=Homo sapiens OX=9606 GN=TMEM132B PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	397-UNIMOD:35	0.02	19.0	1	1	0
PRT	sp|P01137|TGFB1_HUMAN	Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P07451|CAH3_HUMAN	Carbonic anhydrase 3 OS=Homo sapiens OX=9606 GN=CA3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q75N03|HAKAI_HUMAN	E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P63165|SUMO1_HUMAN	Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	40-UNIMOD:35	0.09	19.0	1	1	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	368-UNIMOD:35	0.06	19.0	2	2	2
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|H3BV12|GOG8Q_HUMAN	Golgin subfamily A member 8Q OS=Homo sapiens OX=9606 GN=GOLGA8Q PE=3 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	259-UNIMOD:35,264-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	399-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q5SZL2|CE85L_HUMAN	Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	2	1	0
PRT	sp|Q9P2N2-2|RHG28_HUMAN	Isoform 2 of Rho GTPase-activating protein 28 OS=Homo sapiens OX=9606 GN=ARHGAP28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q4J6C6|PPCEL_HUMAN	Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|Q9Y371|SHLB1_HUMAN	Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O60313|OPA1_HUMAN	Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|Q9NV88|INT9_HUMAN	Integrator complex subunit 9 OS=Homo sapiens OX=9606 GN=INTS9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NP77|SSU72_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	20-UNIMOD:35	0.06	19.0	1	1	0
PRT	sp|Q9NVI1|FANCI_HUMAN	Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15629|TRAM1_HUMAN	Translocating chain-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=TRAM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|O15126|SCAM1_HUMAN	Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	170-UNIMOD:35	0.06	19.0	1	1	1
PRT	sp|Q9UDX5|MTFP1_HUMAN	Mitochondrial fission process protein 1 OS=Homo sapiens OX=9606 GN=MTFP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96N16|JKIP1_HUMAN	Janus kinase and microtubule-interacting protein 1 OS=Homo sapiens OX=9606 GN=JAKMIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q02880|TOP2B_HUMAN	DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96RL1|UIMC1_HUMAN	BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9UHX1|PUF60_HUMAN	Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9H788|SH24A_HUMAN	SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9NX76|CKLF6_HUMAN	CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O95104|SCAF4_HUMAN	SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHI	1	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	74		ms_run[2]:scan=7666	20.931	4	4009.7924	4009.7924	L	R	62	107
PSM	KKDTDVGGGGKGTGGASAEGGPTGLAHG	2	sp|Q96F45|ZN503_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	73		ms_run[1]:scan=4889	16.831091372	3	2438.176402	2438.178593	D	R	255	283
PSM	KTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHI	3	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	68		ms_run[2]:scan=7589	20.816	5	4009.7924	4009.7924	L	R	62	107
PSM	RGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKL	4	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=8840	22.611	4	3515.6778	3515.6778	N	R	307	343
PSM	RKDGQMLPGEDEPLHALVTANTMENVK	5	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	63	6-UNIMOD:35	ms_run[1]:scan=10241	25.038185061333333	4	3008.468389	3008.469556	G	K	190	217
PSM	RLGHAGGNQSDASHLLNQSGGAGEDCQIFSTPGHP	6	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	26-UNIMOD:4	ms_run[2]:scan=9417	23.409	4	3571.6247	3571.6247	H	K	751	786
PSM	RHTHVQDGEAGGITQQIGATNVPLEAINEQT	7	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=10288	25.172	4	3283.6181	3283.6181	L	K	652	683
PSM	RTDGHPVMAAGSPCGHIGLWDLEDK	8	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	8-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=9969	24.375	4	2734.2592	2734.2592	F	K	298	323
PSM	KEPERQVQHEESTEGEADHSGYAGELGF	9	sp|Q92890-3|UFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=8998	22.849	4	3115.3755	3115.3755	Y	R	198	226
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPH	10	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	57		ms_run[1]:scan=4337	16.035667588266666	4	3249.379484	3249.380434	K	K	60	97
PSM	RKTQTVCNFTDGALVQHQEWDGKESTIT	11	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56	7-UNIMOD:4	ms_run[1]:scan=9600	23.6794002784	4	3248.549273	3248.552040	G	R	81	109
PSM	KDIELHLESSSHQETLDHIQ	12	sp|Q5BKZ1|ZN326_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55		ms_run[2]:scan=8915	22.726	3	2358.1452	2358.1452	E	K	325	345
PSM	RKDGQMLPGEDEPLHALVTANTMENVK	13	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	55	6-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=9688	23.821484826400003	4	3024.461921	3024.464471	G	K	190	217
PSM	RQRHELLLGAGSGPGAGQQQATPGALLQAGPP	14	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=10321	25.268	4	3132.6541	3132.6541	K	R	19	51
PSM	KENGVTHPIDYHTTDYVDEIK	15	sp|Q99536-2|VAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=8975	22.813	4	2473.1761	2473.1761	L	K	96	117
PSM	RETQAQPPDGDHSPGNHEQSYVGK	16	sp|Q9Y5Y5|PEX16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53		ms_run[2]:scan=4769	16.681	3	2633.1855	2633.1855	D	R	146	170
PSM	RTDGHPVMAAGSPCGHIGLWDLEDK	17	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	53	14-UNIMOD:4	ms_run[2]:scan=10289	25.176	4	2718.2643	2718.2643	F	K	298	323
PSM	RKQATTNVYQVQTGSEYTDTSNHSSLK	18	sp|Q14161|GIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	52		ms_run[1]:scan=7140	20.207494303466667	4	3042.459863	3042.464270	L	R	476	503
PSM	KDHQNGSMAAVNGHTNSFSPLENNVKP	19	sp|Q9NYP7|ELOV5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	8-UNIMOD:35	ms_run[2]:scan=8157	21.648	4	2908.3522	2908.3522	L	R	267	294
PSM	KPVPSSSGGDAHVPHGSQVIR	20	sp|Q5JRX3-3|PREP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=5405	17.556	4	2111.0872	2111.0872	E	K	722	743
PSM	KQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQG	21	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7482	20.678	5	4278.9128	4278.9128	K	K	734	773
PSM	RLQGQKEPGDQGPAHPPGADMSHSL	22	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	21-UNIMOD:35	ms_run[2]:scan=5922	18.33	4	2625.2354	2625.2354	Y	-	272	297
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPH	23	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=4568	16.393075565333334	4	3249.379484	3249.380434	K	K	60	97
PSM	KNLYHNLCTSLFPTIHGNDEVK	24	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	8-UNIMOD:4	ms_run[2]:scan=10218	24.969	4	2599.2853	2599.2853	D	R	344	366
PSM	RHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIG	25	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	33-UNIMOD:4	ms_run[2]:scan=11093	28.437	4	3719.8061	3719.8061	E	R	80	116
PSM	RNALQQENHIIDGVKVQVHT	26	sp|Q9GZT3|SLIRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50		ms_run[2]:scan=9091	22.981	4	2298.2193	2298.2193	L	R	74	94
PSM	KKIKQCLEDSDAGASNEYDSSPAAWN	27	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50	6-UNIMOD:4	ms_run[1]:scan=8526	22.156764558133332	3	2883.298248	2883.298116	T	K	44	70
PSM	RKDGQMLPGEDEPLHALVTANTMENVK	28	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50	23-UNIMOD:35	ms_run[1]:scan=10072	24.607533781066664	4	3008.466936	3008.469556	G	K	190	217
PSM	KMHDYDGNNLLDGLELSTAITHVH	29	sp|Q8NI22-2|MCFD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	2-UNIMOD:35	ms_run[2]:scan=10982	27.959	4	2708.2864	2708.2864	F	K	26	50
PSM	KVTSVGNPTIKPHSVPSHTLPSHPVTPSS	30	sp|Q14155-6|ARHG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7285	20.405	4	2987.5829	2987.5829	T	K	400	429
PSM	KKTLTDGVLDINHEQENTPSTSGK	31	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=8005	21.421031969066668	4	2611.307955	2611.308939	Q	R	213	237
PSM	KGGAAVDPDSGLEHSAHVLEKGG	32	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=8266	21.793	4	2230.0978	2230.0978	L	K	528	551
PSM	KQEILENKDVVVQHVHFDGLG	33	sp|Q9Y512|SAM50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=9980	24.4	4	2403.2547	2403.2547	A	R	36	57
PSM	RCLAFHDISPQAPTHFLVIPK	34	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	2-UNIMOD:4	ms_run[2]:scan=10512	25.883	4	2446.2944	2446.2944	D	K	37	58
PSM	RGDEELDSLIKATIAGGGVIPHIH	35	sp|Q71UI9|H2AV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=11457	29.9732418672	4	2497.326102	2497.328886	I	K	92	116
PSM	KKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	36	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=6608	19.340697764266668	3	4135.426120	4133.416747	K	-	183	216
PSM	KKQFDAGTVNYEQPTKDGIDHSNIGN	37	sp|P52756|RBM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=7947	21.334069972266665	4	2875.371130	2875.373664	R	K	723	749
PSM	KKEEDLEDKNNFGAEPPHQNGECYPNE	38	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	23-UNIMOD:4	ms_run[1]:scan=7397	20.5643166768	4	3187.376260	3187.378886	D	K	823	850
PSM	RLSGPLKEQYAQEHGLNFQ	39	sp|Q15126|PMVK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=9209	23.125	3	2214.1182	2214.1182	L	R	42	61
PSM	RMVVNEGSDGGQSVYHVHLHVLGG	40	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	2-UNIMOD:35	ms_run[2]:scan=9295	23.235	4	2562.2398	2562.2398	Y	R	95	119
PSM	RSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC	41	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	28-UNIMOD:35,32-UNIMOD:4	ms_run[2]:scan=6849	19.748	4	3240.4524	3240.4524	S	-	282	314
PSM	RYGPPHETDGHGLAEATQSSKPGSVML	42	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	26-UNIMOD:35	ms_run[2]:scan=8489	22.102	4	2837.3403	2837.3403	K	R	1211	1238
PSM	KRSEAEEAITSFNGHKPPGSSEPITV	43	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=9543	23.5858466912	4	2767.369564	2767.377687	D	K	156	182
PSM	KHQDLQFAGLLNPLDSPHHM	44	sp|Q5T280|CI114_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	20-UNIMOD:35	ms_run[2]:scan=10527	25.939	4	2313.1324	2313.1324	P	R	162	182
PSM	KKENALVQMADGNQAQLAMSHLNGH	45	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	9-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=7959	21.352	4	2736.3072	2736.3072	N	K	373	398
PSM	KLHQLAMQQSHFPMTHGNTGFSGIESSSPEV	46	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	7-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=9063	22.948	4	3413.5769	3413.5769	T	K	210	241
PSM	RSQEELEAHVVNDHDNDANIHTQS	47	sp|Q8TCN5-2|ZN507_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6993	19.982	4	2757.2339	2757.2339	S	K	165	189
PSM	RTHYSNIEANESEEVRQF	48	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=8588	22.25	3	2208.0196	2208.0196	P	R	84	102
PSM	KKKILATPPQEDAPSVDIANI	49	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=9813	24.060514641066668	3	2247.246467	2247.247448	S	R	281	302
PSM	KRKSEDGTPAEDGTPAATGGSQPPSMG	50	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	26-UNIMOD:35	ms_run[1]:scan=4513	16.3002513064	3	2644.205082	2644.203488	K	R	1183	1210
PSM	KEKEEETKTSNGDLSDSTVSADPVVK	51	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=6433	19.063582905866667	4	2792.357116	2792.356343	K	-	1148	1174
PSM	KLHQLAMQQSHFPMTHGNTGFSGIESSSPEV	52	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	7-UNIMOD:35	ms_run[2]:scan=9506	23.53	4	3397.582	3397.5820	T	K	210	241
PSM	KTIEEQLDEEHLESHK	53	sp|Q9Y2D5-7|AKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=8170	21.666	3	1963.9487	1963.9487	E	K	337	353
PSM	KVKHLDGEEDGSSDQSQASGTTGG	54	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=3742	14.945	3	2389.063	2389.0630	R	R	161	185
PSM	KYEIDLDTSDHAHLEHIT	55	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=9245	23.168	3	2136.0124	2136.0124	A	R	723	741
PSM	RAKHTQENCETWGVNGETGTLVDM	56	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	9-UNIMOD:4,24-UNIMOD:35	ms_run[2]:scan=8902	22.709	4	2748.2232	2748.2232	L	K	429	453
PSM	RETQAQPPDGDHSPGNHEQSYVGK	57	sp|Q9Y5Y5|PEX16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=4746	16.649	4	2633.1855	2633.1855	D	R	146	170
PSM	RKSDSDMWINQSSSLDSSTSSQEHLNHSS	58	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	7-UNIMOD:35	ms_run[2]:scan=8003	21.418	4	3265.4178	3265.4178	D	K	1282	1311
PSM	RLYAHVYGNGQSEKPDENE	59	sp|Q6P3X3|TTC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6125	18.636	3	2205.0087	2205.0087	W	K	713	732
PSM	RVCPTCQQVLAHGDASSHQALHAA	60	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7394	20.561	4	2613.2289	2613.2289	C	R	857	881
PSM	RVGSHITGGDIYGIVSENSLIKH	61	sp|P38606-2|VATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=10452	25.665	4	2451.287	2451.2870	L	K	109	132
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDD	62	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	45		ms_run[1]:scan=4360	16.069144451733333	4	3015.2698	3015.2682	K	P	60	95
PSM	RKTTQSGQMSGEGKAGPPGGSS	63	sp|Q16630|CPSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	9-UNIMOD:35	ms_run[1]:scan=3396	14.551419029066667	3	2119.993059	2119.991644	S	R	172	194
PSM	RKAQAVSEEEEEEEGKSSSP	64	sp|Q9GZR7|DDX24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=4692	16.573086814666667	3	2205.002927	2205.003314	K	K	76	96
PSM	KFEQSHLHMSSETQANNELTTNGHGPPAS	65	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	9-UNIMOD:35	ms_run[2]:scan=6498	19.153	4	3164.4218	3164.4218	K	K	48	77
PSM	KHHSWSDSSVGCEQAPEEVSEA	66	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	12-UNIMOD:4	ms_run[2]:scan=7814	21.139	3	2455.0346	2455.0346	E	R	510	532
PSM	KTKGHLDAELDAYMAQTDPETND	67	sp|Q9Y3Y2-4|CHTOP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=10090	24.641	3	2562.1544	2562.1544	S	-	180	203
PSM	RHQGVMVGMGQKDSYVGDEAQS	68	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5791	18.128	3	2410.0642	2410.0642	P	K	39	61
PSM	RLQGQKEPGDQGPAHPPGADMSHSL	69	sp|Q9Y399|RT02_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7276	20.391	4	2609.2405	2609.2405	Y	-	272	297
PSM	RREDNLNDSSQQLQDSLR	70	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=8220	21.733429927466666	3	2173.045795	2173.047185	R	K	816	834
PSM	KKFACNGTVIEHPEYGEVIQLQGDQR	71	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	5-UNIMOD:4	ms_run[1]:scan=9362	23.329927756	4	3015.487916	3015.487255	K	K	65	91
PSM	KAPQTPRSGAAHLCDSQETNCSTAGHS	72	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=4822	16.748	4	2867.2675	2867.2675	T	K	625	652
PSM	KLKQSGEPFLQDGSCINVAPHLH	73	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	15-UNIMOD:4	ms_run[2]:scan=9565	23.619	4	2574.3013	2574.3013	K	K	890	913
PSM	KPKTITGFQTHTTPVLLAHGE	74	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8865	22.653	4	2275.2325	2275.2325	G	R	699	720
PSM	KQATYGYYLGNPAEFHDSSDHHTF	75	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9925	24.282	4	2784.2205	2784.2205	Y	K	90	114
PSM	KYDLILDEQAEDSKSSHSHTS	76	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7977	21.378	4	2389.1034	2389.1034	T	K	362	383
PSM	REHHAEAAQFQEDVNADPEVQ	77	sp|Q7Z6J9|SEN54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7916	21.283	3	2419.0789	2419.0789	E	R	353	374
PSM	RGRGGPPGQFHDNANGGQNGTVQEIMIPAG	78	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	26-UNIMOD:35	ms_run[2]:scan=8935	22.756	4	3047.438	3047.4380	S	K	214	244
PSM	RHESGASIKIDEPLEGSED	79	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8285	21.815	3	2067.9709	2067.9709	I	R	390	409
PSM	RHQGVMVGMGQKDSYVGDEAQS	80	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7780	21.094	3	2378.0743	2378.0743	P	K	39	61
PSM	RHVVSCSSQDSTHCAENLL	81	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	6-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7901	21.261	3	2198.9797	2198.9797	L	K	7	26
PSM	RIMGLDLPDGGHLTHGYMSDVK	82	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	18-UNIMOD:35	ms_run[2]:scan=9944	24.328	4	2427.1675	2427.1675	D	R	139	161
PSM	RKDSVWGSGGGQQSVNHLV	83	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8799	22.55	3	2010.0031	2010.0031	K	K	299	318
PSM	RQLFHPEQLITGKEDAANNYA	84	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=10049	24.556	3	2414.1979	2414.1979	Y	R	49	70
PSM	RRNENSEVDTSAGSGSAPSVLHQ	85	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6631	19.374	3	2397.1269	2397.1269	E	R	1475	1498
PSM	RVAPEEHPVLLTEAPLNPKAN	86	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9410	23.398	3	2294.2383	2294.2383	L	R	95	116
PSM	KKLQEQLEKAEDGSSS	87	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=6059	18.53293851013333	2	1775.892638	1775.890122	V	K	1389	1405
PSM	KRLDEELEDAEKNLGESEI	88	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=10856	27.368673844	3	2216.080369	2216.080836	L	R	82	101
PSM	KKNDKEAAGEGPALYEDPPDQ	89	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=7262	20.371582524799997	3	2271.065484	2271.065521	A	K	31	52
PSM	KKKEQMIDLQNLLTTQSPSV	90	sp|Q9BVJ6|UT14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	6-UNIMOD:35	ms_run[1]:scan=10621	26.30166836	3	2316.235255	2316.235898	K	K	553	573
PSM	RKQELVAELDQDEKDQQNTS	91	sp|O43318|M3K7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=8178	21.6756822488	3	2373.138874	2373.140811	Q	R	546	566
PSM	KKDQVTAQEIFQDNHEDGPTAK	92	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=8022	21.443942132266667	4	2498.201400	2498.203745	K	K	544	566
PSM	KKKPFMLDEEGDTQTEETQPSET	93	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=7980	21.381677972533335	3	2667.221224	2667.222157	K	K	19	42
PSM	RKAVIKNADMSEEMQQDSVECATQALE	94	sp|P63167|DYL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	14-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=9092	22.981905051733335	4	3096.415724	3096.416200	D	K	4	31
PSM	RKAVIKNADMSEEMQQDSVECATQALE	95	sp|P63167|DYL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	10-UNIMOD:35,14-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=8659	22.358421529333334	4	3112.408349	3112.411115	D	K	4	31
PSM	KAETPHGAEEECKAETPHGAEEEC	96	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	12-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=4648	16.506	4	2695.1126	2695.1126	H	R	213	237
PSM	KHAAENPGKYNILGTNTIMD	97	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	19-UNIMOD:35	ms_run[2]:scan=8900	22.707	3	2202.0739	2202.0739	T	K	497	517
PSM	KHFPEAGIHYPDSTTGDGKPLATDYNGNCSLE	98	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	29-UNIMOD:4	ms_run[2]:scan=9188	23.098	4	3490.5736	3490.5736	F	K	84	116
PSM	KLFVGGIKEDTEEHHL	99	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8625	22.3	4	1850.9527	1850.9527	K	R	113	129
PSM	KLRFPAEDEFPDLSAHNNHMA	100	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=9976	24.394	4	2454.1386	2454.1386	L	K	11	32
PSM	KPVTYEEAHAPHYIAH	101	sp|Q96EL2|RT24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6430	19.06	4	1861.9111	1861.9111	D	R	49	65
PSM	KTVETRDGQVINETSQHHDDLE	102	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6226	18.759	4	2550.1946	2550.1946	I	-	445	467
PSM	KTVETRDGQVINETSQHHDDLE	103	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7044	20.062	3	2550.1946	2550.1946	I	-	445	467
PSM	KVHKEDDGVPVICQVEHPAVTGNLQTQ	104	sp|Q9BY67-2|CADM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	13-UNIMOD:4	ms_run[2]:scan=9291	23.229	4	2997.4978	2997.4978	L	R	208	235
PSM	KYVLENHPGTNSNYQMHLLK	105	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	16-UNIMOD:35	ms_run[2]:scan=7777	21.091	4	2401.1849	2401.1849	K	K	214	234
PSM	RDLHESSFSLSGSQIDDHVPK	106	sp|Q9BPU6|DPYL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9077	22.967	4	2353.1299	2353.1299	M	R	526	547
PSM	RGGSGSHNWGTVKDELTESP	107	sp|Q8NC51-2|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8825	22.589	3	2112.9825	2112.9825	K	K	210	230
PSM	RHQGVMVGMGQKDSYVGDEAQS	108	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	9-UNIMOD:35	ms_run[2]:scan=6450	19.084	3	2394.0692	2394.0692	P	K	39	61
PSM	RVHGPGIQSGTTNKPN	109	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=3976	15.274	2	1661.8598	1661.8598	V	K	1359	1375
PSM	KKCLELFSELAEDKENY	110	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	3-UNIMOD:4	ms_run[1]:scan=10564	26.0855239744	3	2115.018769	2115.019422	V	K	410	427
PSM	RKKESDLPSAILQTSGVSEFT	111	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=10705	26.649430579466664	3	2292.196156	2292.196141	K	K	269	290
PSM	KKPLPDHVSIVEPKDEILPTTPISEQ	112	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=9893	24.21127594693333	4	2909.573627	2909.574990	P	K	201	227
PSM	KEAGHGTQKEEIPEEELAEDVEEIDHAE	113	sp|P20020-6|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10813	27.161	4	3160.432	3160.4320	L	R	1034	1062
PSM	KEVSMDDHKLSLDELH	114	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:35	ms_run[2]:scan=7933	21.314	4	1910.9044	1910.9044	K	R	37	53
PSM	KHKSSLNSSPWSGLMALGNS	115	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	15-UNIMOD:35	ms_run[2]:scan=10216	24.965	3	2116.0371	2116.0371	S	R	10	30
PSM	KHRPQVAIICGSGLGGLTD	116	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:4	ms_run[2]:scan=9734	23.906	3	1978.0418	1978.0418	T	K	22	41
PSM	KPAAVAAENEEIGSHIKH	117	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6468	19.107	4	1899.9803	1899.9803	A	R	1901	1919
PSM	KTESNQEVANPEHYIKHPLQN	118	sp|P06730|IF4E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8159	21.651	4	2475.2142	2475.2142	E	R	21	42
PSM	KTVETRDGQVINETSQHHDDLE	119	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6358	18.954	4	2550.1946	2550.1946	I	-	445	467
PSM	KVNNPDNHAHYTEADDDDFEPHAII	120	sp|Q9Y4K4|M4K5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9364	23.332	4	2876.2638	2876.2638	D	R	293	318
PSM	RIMGLDLPDGGHLTHGYMSDVK	121	sp|P34897-3|GLYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9336	23.292	3	2443.1624	2443.1624	D	R	139	161
PSM	KKKEPAITSQNSPEA	122	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4108	15.533837488	2	1626.858250	1626.857700	E	R	89	104
PSM	KKDESQEGKQQYLQSIEE	123	sp|P21912|SDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7821	21.148267109866666	3	2166.045277	2166.044057	K	R	159	177
PSM	KKISSIQSIVPALEIANAHR	124	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=10337	25.318060452	4	2174.252413	2174.253536	E	K	249	269
PSM	RKLQELSSKADEASELACPTP	125	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41	18-UNIMOD:4	ms_run[1]:scan=8641	22.329407245866665	3	2329.159214	2329.158375	L	K	2185	2206
PSM	RKFEEMNAELEENKELAQN	126	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41	6-UNIMOD:35	ms_run[1]:scan=7410	20.582224864	3	2337.088575	2337.090690	A	R	323	342
PSM	KDHQYQFLEDAVRNQ	127	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9740	23.918	3	1889.902	1889.9020	H	R	238	253
PSM	KEKLCYVALDFEQEMATAASSSSLE	128	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:4	ms_run[2]:scan=11469	30.023	3	2806.3041	2806.3041	I	K	213	238
PSM	KGTQSLNPHNDYCQHFVDTGH	129	sp|Q9HCE5|MET14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	13-UNIMOD:4	ms_run[2]:scan=7606	20.839	4	2454.0771	2454.0771	L	R	108	129
PSM	KKHEALMSDLSAYGSSIQAL	130	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35	ms_run[2]:scan=10221	24.976	3	2164.0834	2164.0834	L	R	930	950
PSM	KPIPRPDPVHNNEETHDQVL	131	sp|Q9Y6G3|RM42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7167	20.242	3	2334.1717	2334.1717	T	K	73	93
PSM	KVGAVDADKHHSLGGQYGVQGFPTI	132	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10027	24.501	4	2580.3085	2580.3085	V	K	74	99
PSM	RGLPVTCEVAPHHLFLSHDDLE	133	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:4	ms_run[2]:scan=10005	24.457	4	2541.2434	2541.2434	A	R	1630	1652
PSM	RGRGGPPGQFHDNANGGQNGTVQEIMIPAG	134	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9374	23.347	4	3031.4431	3031.4431	S	K	214	244
PSM	RGSSVDAPPRPCHTTPDSQFGTEHVL	135	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	12-UNIMOD:4	ms_run[2]:scan=8420	22.002	4	2847.3358	2847.3358	Q	R	624	650
PSM	RHATALEELSEQLEQAK	136	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10790	27.053	3	1951.9963	1951.9963	Q	R	1200	1217
PSM	RHQGVMVGMGQKDSYVGDEAQS	137	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:35	ms_run[2]:scan=7036	20.05	3	2394.0692	2394.0692	P	K	39	61
PSM	RPHEGPGGGMGAGGGH	138	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	10-UNIMOD:35	ms_run[2]:scan=3336	14.47	3	1445.6218	1445.6218	H	R	814	830
PSM	RPHEGPGGGMGNSSGH	139	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	10-UNIMOD:35	ms_run[2]:scan=3276	14.396	3	1548.6488	1548.6488	H	R	752	768
PSM	RRFGVPVIADGGIQNVGHIA	140	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10363	25.387	3	2075.1388	2075.1388	A	K	355	375
PSM	RSQEIDDHQHEMSVLQNAHQQ	141	sp|Q15643-2|TRIPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	12-UNIMOD:35	ms_run[2]:scan=5750	18.054	4	2545.1364	2545.1364	N	K	225	246
PSM	RKFGEAIGMGFPVKVPY	142	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	9-UNIMOD:35	ms_run[1]:scan=10434	25.616279254133335	3	1911.007842	1911.007676	S	R	878	895
PSM	RKSAVEAQNEVTENPKQ	143	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=4300	15.989932643466666	3	1926.974745	1926.975918	D	K	616	633
PSM	RKLEEVLSTEGAEENGNSDK	144	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7586	20.81188385733333	3	2204.055680	2204.055684	K	K	520	540
PSM	KSRGKVEIDQQQLTQQQLNGN	145	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7433	20.6134123992	3	2411.250173	2411.251699	S	-	344	365
PSM	KKKPDYLPYAEDESVDDLAQQ	146	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=9783	24.003235632533332	3	2451.180359	2451.180550	R	K	308	329
PSM	RKAQPAQPADEPAEKADEPMEH	147	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	20-UNIMOD:35	ms_run[1]:scan=3891	15.1155131528	4	2460.133967	2460.133952	Q	-	242	264
PSM	KKKPFMLDEEGDTQTEETQPSET	148	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	6-UNIMOD:35	ms_run[1]:scan=7272	20.3858618336	3	2683.216500	2683.217072	K	K	19	42
PSM	RRSYDVPPPPMEPDHPFYSNISKD	149	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	11-UNIMOD:35	ms_run[1]:scan=8954	22.783802128266665	4	2859.328383	2859.328629	W	R	116	140
PSM	KAKQNQVASPQPPHPGEITNAHNSSCISN	150	sp|Q8IWZ8-2|SUGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	26-UNIMOD:4	ms_run[2]:scan=6499	19.158	4	3110.4952	3110.4952	Q	K	53	82
PSM	KGGVVAGNVAHILDSNHGK	151	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8650	22.346	4	1871.9966	1871.9966	A	K	1212	1231
PSM	KHASQKDYSSGFGG	152	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5018	17.026	2	1467.6743	1467.6743	E	K	147	161
PSM	KHQAFEAELHANAD	153	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6916	19.851	2	1579.7379	1579.7379	Q	R	1571	1585
PSM	KIKQHLENDPGSNEDTDIP	154	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7095	20.146	3	2149.0287	2149.0287	E	K	102	121
PSM	KKHLVVPGDTITTDTGFM	155	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	18-UNIMOD:35	ms_run[2]:scan=9140	23.041	3	1975.0085	1975.0085	T	R	23	41
PSM	KKYVATLGVEVHPLVFHTN	156	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=9935	24.308	4	2151.1841	2151.1841	E	R	37	56
PSM	KSKAIIEEYLHLNDM	157	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	15-UNIMOD:35	ms_run[2]:scan=10430	25.606	3	1818.9186	1818.9186	K	K	1049	1064
PSM	KSMTEAEQQQLIDDHFLFD	158	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35	ms_run[2]:scan=10938	27.748	3	2310.0474	2310.0474	L	K	177	196
PSM	KYYLHDDREGEGSD	159	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5336	17.459	2	1682.7172	1682.7172	K	K	879	893
PSM	RESHTAVVYTEKDN	160	sp|P51610-3|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4461	16.224	2	1647.7853	1647.7853	P	K	200	214
PSM	RFHQLDIDDLQSIRAL	161	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=10931	27.717	3	1939.0276	1939.0276	P	R	58	74
PSM	RHYNEEGSQVYNDAHILE	162	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8898	22.703	3	2172.9825	2172.9825	A	K	598	616
PSM	RLDLEGNEYPIHSTPNCHDHE	163	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=8243	21.764	4	2532.1088	2532.1088	Y	R	1011	1032
PSM	RPGGVVHSFSHNVGPGD	164	sp|Q969H8|MYDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6760	19.58	2	1717.8285	1717.8285	V	K	43	60
PSM	RQKLFQFLQAEPHNSLG	165	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=10429	25.604	3	2012.0592	2012.0592	V	K	985	1002
PSM	RVLATEDRSDHLIQTDTVNLH	166	sp|P51151|RAB9A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8599	22.265	3	2432.2408	2432.2408	R	R	171	192
PSM	RPHEGPGGGMGNSSGH	167	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	10-UNIMOD:35	ms_run[1]:scan=3292	14.414805227733332	3	1548.648754	1548.648787	H	R	752	768
PSM	KKASFASASAEVGK	168	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5247	17.337840130666667	2	1379.745156	1379.740879	P	K	77	91
PSM	KKLQGEVEKYQQLQ	169	sp|O15212|PFD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6960	19.936090044	2	1717.933605	1717.936285	Q	K	7	21
PSM	RRPYAPINANAIKAECSI	170	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	16-UNIMOD:4	ms_run[1]:scan=9068	22.955463595466664	3	2043.069539	2043.068378	A	R	480	498
PSM	KKFFDANYDGKDYDPVAA	171	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=9530	23.56947819626667	3	2062.961339	2062.963622	F	R	112	130
PSM	RKAGTQIENIDEDFRDGL	172	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=10233	25.0093123016	3	2076.023456	2076.023596	L	K	65	83
PSM	KKPKLSEEVVVAPNQESGM	173	sp|Q6PJT7|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	19-UNIMOD:35	ms_run[1]:scan=7307	20.445690382133332	3	2085.079489	2085.077606	L	K	470	489
PSM	RKTASVLSKDDVAPESGDTTV	174	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7411	20.583939666933336	3	2175.100676	2175.101906	A	K	310	331
PSM	KKEEDLEDKNNFGAEPPHQNGECYPNE	175	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	23-UNIMOD:4	ms_run[1]:scan=7568	20.790969544533333	4	3188.364711	3187.378886	D	K	823	850
PSM	KASHHIYPYSSSQDDEEWL	176	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9841	24.111	3	2291.0131	2291.0131	S	R	201	220
PSM	KHCIPLKPSNELTNSTVVIDTH	177	sp|Q8WWK9-6|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4	ms_run[2]:scan=8805	22.56	4	2502.2901	2502.2901	G	K	49	71
PSM	KIMTYLFDFPHGPKPGSSH	178	sp|P49902-2|5NTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:35	ms_run[2]:scan=10057	24.577	4	2174.0619	2174.0619	D	R	229	248
PSM	KKYVATLGVEVHPLVFHTN	179	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9946	24.332	4	2151.1841	2151.1841	E	R	37	56
PSM	KLDKAQIHDLVLVGGST	180	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9771	23.982	3	1793.0047	1793.0047	A	R	325	342
PSM	KLFVGGIKEDTEEHHL	181	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8355	21.92	4	1850.9527	1850.9527	K	R	113	129
PSM	KLHHQNQQQIQQQQQQLQ	182	sp|Q96RN5-3|MED15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4775	16.691	3	2282.1628	2282.1628	I	R	151	169
PSM	KRGFGFVTFDDHDPVD	183	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10350	25.356	3	1850.8588	1850.8588	K	K	152	168
PSM	KTKGHLDAELDAYMAQTDPETND	184	sp|Q9Y3Y2-4|CHTOP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	14-UNIMOD:35	ms_run[2]:scan=8725	22.447	3	2578.1493	2578.1493	S	-	180	203
PSM	RAANFENHSGKLGATAE	185	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5494	17.693	3	1771.8602	1771.8602	E	K	629	646
PSM	RAGMSYYNSPGLHVQHMGTSHGIT	186	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	4-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=7190	20.285	4	2632.1911	2632.1911	T	R	387	411
PSM	RHCDEVGFNAEEAHNIV	187	sp|P51808|DYLT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4	ms_run[2]:scan=9042	22.918	3	1995.8857	1995.8857	H	K	6	23
PSM	RHGESGSMAVFHQTQGPSYSES	188	sp|P15151-3|PVR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	8-UNIMOD:35	ms_run[2]:scan=6541	19.234	3	2394.0295	2394.0295	A	K	68	90
PSM	RIHTGEKPYECVQCG	189	sp|P17028|ZNF24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5769	18.079	2	1832.8298	1832.8298	Q	K	327	342
PSM	RLHLQGQTMQDPFGEK	190	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:35	ms_run[2]:scan=8084	21.543	3	1899.9261	1899.9261	D	R	181	197
PSM	RQPLTVEHMYEDISQDHVK	191	sp|Q9NT62-2|ATG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10011	24.468	4	2324.1219	2324.1219	Q	K	224	243
PSM	RTPHYGSQTPLHDGS	192	sp|O00267-2|SPT5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5183	17.255	2	1651.7703	1651.7703	S	R	794	809
PSM	KCVDDHMHLIPTMTK	193	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	2-UNIMOD:4,7-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=5678	17.94766312373333	3	1856.869276	1856.858311	T	K	113	128
PSM	KKGPGLAVQSGDKT	194	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=4126	15.5882537376	2	1384.767602	1384.767428	Q	K	152	166
PSM	RRGFCFITYTDEEPVK	195	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	5-UNIMOD:4	ms_run[1]:scan=9922	24.277890296800003	3	2016.971462	2016.972747	E	K	273	289
PSM	RKILQDGGLQVVEKQNLS	196	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8955	22.786318974933334	3	2024.137884	2024.137838	C	K	20	38
PSM	KKLTGKDVNFEFPEFQL	197	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=10984	27.9702155848	3	2039.072543	2039.072778	Y	-	178	195
PSM	RKDPSKNQGGGLSSSGAGEGQGP	198	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=4243	15.881083081866667	3	2170.035837	2170.036286	Q	K	986	1009
PSM	KTALQPLKHSDSKEDDGQEIA	199	sp|Q5ZPR3-2|CD276_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=5956	18.379464383466665	3	2309.149966	2309.149919	S	-	296	317
PSM	KKIKNENTEGSPQEDGVELEGL	200	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8839	22.608261552533335	3	2413.198209	2413.197263	K	K	1237	1259
PSM	RKKASLVALPEQTASEEETPPPLLT	201	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=10194	24.919700490666667	4	2704.463571	2704.464711	D	K	396	421
PSM	KKTFPTVNPTTGEVIGHVAEGDRADVD	202	sp|P30837|AL1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=9438	23.44566672426667	4	2852.429252	2852.430451	S	R	51	78
PSM	KDHMVTMHDVLDAQWLYDNH	203	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=10277	25.145	4	2499.0947	2499.0947	E	K	257	277
PSM	KFTMDCVAPTIHVYEHHEN	204	sp|O43402|EMC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=8141	21.627	4	2343.0412	2343.0412	T	R	131	150
PSM	KHHLQPENPGPGGAAPSLEQN	205	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6701	19.479	3	2177.0614	2177.0614	K	R	388	409
PSM	KIHMGSCAENTAK	206	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=3344	14.481	3	1461.6704	1461.6704	N	K	190	203
PSM	KIKADIIYPGHGPVIHNAEA	207	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8496	22.111	4	2142.1586	2142.1586	L	K	189	209
PSM	KMAVTFIGNSTAIQELFK	208	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:35	ms_run[2]:scan=11241	29.04	3	2013.0605	2013.0605	L	R	362	380
PSM	KNLTEQNSYSNIPHEGKHTPLYE	209	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7998	21.412	4	2698.2987	2698.2987	G	R	410	433
PSM	KSDSHGPKEDGGF	210	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4499	16.278	2	1359.6055	1359.6055	L	R	381	394
PSM	KTKSHDDGNIDLESDSFL	211	sp|P18583-6|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10097	24.657	3	2019.9385	2019.9385	S	K	139	157
PSM	KTLEHLQLSHDQLLEVK	212	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9175	23.083	4	2030.116	2030.1160	Q	R	472	489
PSM	KVHLVGIDIFTGK	213	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10530	25.953	2	1425.8344	1425.8344	A	K	55	68
PSM	RDHAVVVGVYRPPP	214	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7684	20.96	2	1560.8525	1560.8525	E	K	304	318
PSM	RKCQYVGNCSFAHSPEE	215	sp|Q9UGR2|Z3H7B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6716	19.504	3	2067.8891	2067.8891	G	R	767	784
PSM	RKDLYANTVLSGGTTMYPGIAD	216	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:35	ms_run[2]:scan=10303	25.218	3	2358.1526	2358.1526	I	R	290	312
PSM	RKDMSGHYQNALYLGDVSE	217	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9385	23.362	3	2182.0113	2182.0113	I	R	726	745
PSM	RLHHPAQGSAAGTPYPSSASL	218	sp|Q9NSV4-7|DIAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7508	20.712	3	2104.045	2104.0450	P	R	7	28
PSM	RQEAVSMIPPLLLNVRPHH	219	sp|Q08J23-2|NSUN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:35	ms_run[2]:scan=10334	25.309	3	2222.2106	2222.2106	S	K	125	144
PSM	RTTGIVMDSGDGVTHTVPIYEGYALPHAIL	220	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:35	ms_run[2]:scan=10983	27.965	4	3198.6019	3198.6019	G	R	147	177
PSM	KHIYYITGETKDQVANSAFVE	221	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9339	23.29714494186667	4	2414.201191	2412.196141	Q	R	489	510
PSM	KRPAEDMEEEQAFK	222	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	7-UNIMOD:35	ms_run[1]:scan=5231	17.315021597866668	3	1722.788728	1722.788300	G	R	21	35
PSM	KRETGVDLTKDNMALQ	223	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	13-UNIMOD:35	ms_run[1]:scan=6702	19.480486321866668	3	1833.923951	1833.925462	F	R	291	307
PSM	RKTEELEEESFPERS	224	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7290	20.419017682666667	2	1864.880621	1864.880286	Q	K	485	500
PSM	RKPVEEKSEEGNVSAPGPES	225	sp|Q03164|KMT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4745	16.643657141066665	3	2125.029530	2125.028741	P	K	1264	1284
PSM	KKFYPLEIDYGQDEEAVK	226	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=10061	24.587002792266667	3	2171.074864	2171.078651	P	K	636	654
PSM	KKIKGIQQATTGVSQETSENPGN	227	sp|P04150|GCR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=6046	18.5044553424	3	2414.237973	2414.240131	K	K	495	518
PSM	RKAQPAQPADEPAEKADEPMEH	228	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=4918	16.867005621333334	4	2444.137213	2444.139037	Q	-	242	264
PSM	RRQVQSLTCEVDALKGTNESLE	229	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	9-UNIMOD:4	ms_run[1]:scan=9872	24.180528224266666	4	2532.261000	2532.260215	Y	R	320	342
PSM	RRASQGLLSSIENSESDSSEAKEEGS	230	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=9313	23.25838228026667	4	2752.273679	2752.274738	T	R	1539	1565
PSM	KALNEHHVNATLDLIEGSMTVCTTK	231	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	19-UNIMOD:35,22-UNIMOD:4	ms_run[2]:scan=9563	23.613	4	2797.3739	2797.3739	Q	K	81	106
PSM	KFASDDEHDEHDENGATGPVK	232	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4509	16.291	4	2296.9832	2296.9832	T	R	363	384
PSM	KGVPHPEDDHSQVEGPESLR	233	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6679	19.448	3	2212.0509	2212.0509	Q	-	678	698
PSM	KHLCQQLQAEQAAAEK	234	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:4	ms_run[2]:scan=6398	19.01	3	1851.9261	1851.9261	A	R	1364	1380
PSM	KKAHLMEIQVNGGTVAE	235	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:35	ms_run[2]:scan=7230	20.335	3	1839.9513	1839.9513	Q	K	176	193
PSM	KQKTDVSTEHPPFYYNIH	236	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8803	22.558	4	2203.0698	2203.0698	K	R	622	640
PSM	KRGFAFVTFDDHDSVD	237	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10273	25.133	3	1854.8537	1854.8537	K	K	145	161
PSM	KRGFAFVTFDDHDSVD	238	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10427	25.6	3	1854.8537	1854.8537	K	K	145	161
PSM	KVFEHFLENLDKS	239	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10343	25.331	2	1604.8199	1604.8199	V	R	393	406
PSM	KVHSPSGAVEECHVSELEPDKYAV	240	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:4	ms_run[2]:scan=8774	22.514	4	2666.2646	2666.2646	A	R	2142	2166
PSM	RAHQVVEDGYEFFAK	241	sp|P36873-2|PP1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9714	23.862	3	1794.8689	1794.8689	C	R	246	261
PSM	RAKYIYDSAFHPDTGE	242	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8661	22.36	3	1868.8693	1868.8693	W	K	70	86
PSM	RDLPSGRPGTTGPAGAQYTPHSHQFP	243	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7921	21.293	4	2731.3215	2731.3215	S	R	741	767
PSM	RGKSGPLFNFDVHDDV	244	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10366	25.394	3	1801.8747	1801.8747	A	R	273	289
PSM	RHAEQERDELADEITNSASG	245	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8580	22.239	3	2227.0101	2227.0101	R	K	1704	1724
PSM	RHKIIILDEADSMTDGAQQAL	246	sp|P35250|RFC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:35	ms_run[2]:scan=9751	23.947	3	2340.1744	2340.1744	G	R	134	155
PSM	RIHEGCEEPATHNALA	247	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:4	ms_run[2]:scan=5359	17.488	3	1803.8322	1803.8322	A	K	865	881
PSM	RKNVLGHMQQGGSPTPFD	248	sp|P08237-2|PFKAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8344	21.906	3	1967.9636	1967.9636	S	R	624	642
PSM	RNCKCGQEEHDVLLSNEED	249	sp|Q9UGI8|TES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=6932	19.882	3	2330.9856	2330.9856	C	R	42	61
PSM	RNKGQDLLALIVAQH	250	sp|Q86WJ1-5|CHD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10913	27.636	3	1674.9529	1674.9529	S	R	510	525
PSM	RPSHAQLHSDYMQPLTEA	251	sp|Q9NQH7-3|XPP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:35	ms_run[2]:scan=7178	20.264	3	2095.9745	2095.9745	M	K	208	226
PSM	RPVDYPKDYLSHQVPISFH	252	sp|Q6Y288|B3GLT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10189	24.905	4	2297.1593	2297.1593	A	K	445	464
PSM	RQLGGKDGPPHQVLVVPLHS	253	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8646	22.34	4	2133.1807	2133.1807	K	R	73	93
PSM	RSHSIFLINVKQENTQTEQ	254	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9288	23.226	3	2271.1608	2271.1608	S	K	203	222
PSM	RTHNGESVSYLFSHVPL	255	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10812	27.159	3	1941.9697	1941.9697	R	-	235	252
PSM	RVIHLSNLPHSGYSDSAVL	256	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9694	23.83	3	2064.0752	2064.0752	G	K	496	515
PSM	RKGVAINMVTEEDK	257	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7151	20.2244460064	2	1588.820708	1588.824291	G	R	368	382
PSM	KSRGKVEIDQQQLTQQQLNGN	258	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7607	20.839937807733335	3	2414.242116	2411.251699	S	-	344	365
PSM	KKALAAAGYDVEKNNS	259	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=5480	17.679346277866667	3	1677.868648	1677.868599	L	R	66	82
PSM	RKFLESTDSFNNELK	260	sp|Q969G3|SMCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8877	22.67137594986667	3	1826.918558	1826.916277	K	R	257	272
PSM	KDHTLEDEDVIQIVKK	261	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=9006	22.859608274666666	4	1909.017283	1909.015657	G	-	352	368
PSM	RKNQDEESQEAPELLK	262	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6970	19.9507999312	3	1912.952141	1912.949034	R	R	588	604
PSM	KRNEAKTGADTTAAGPLFQQ	263	sp|O60828|PQBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7833	21.1694877672	3	2103.072373	2103.070881	P	R	223	243
PSM	RKGKEDEGEEAASPMLQIQ	264	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8524	22.151531332	3	2115.025776	2115.026633	R	R	2398	2417
PSM	RKGKEDEGEEAASPMLQIQ	265	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	15-UNIMOD:35	ms_run[1]:scan=7218	20.322445339199998	3	2131.019511	2131.021548	R	R	2398	2417
PSM	KKKETVSEAPPLLFSDEEE	266	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=9892	24.2100072512	3	2175.093827	2175.094695	T	K	714	733
PSM	KKKEGVILTNESAASTGQPDNDVTEGQ	267	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7187	20.2817311528	4	2815.378509	2815.383560	E	R	710	737
PSM	KKDDVTSSTGPHKELSSTEAGSTVAGAAL	268	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7946	21.332440820266665	4	2843.412875	2843.414861	L	R	1124	1153
PSM	KGHTEVIVPHLTESYNSH	269	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8186	21.686	4	2047.0123	2047.0123	T	R	123	141
PSM	KHGSYEDAVHSGALND	270	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6394	19.007	3	1698.7598	1698.7598	D	-	541	557
PSM	KHKDVIINQEGEYI	271	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8522	22.146	2	1684.8784	1684.8784	D	K	156	170
PSM	KHNGPNDASDGTVRL	272	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5973	18.402	3	1579.7703	1579.7703	M	R	6	21
PSM	KKGPSGYGFNLHSD	273	sp|O14745-2|NHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7715	21.002	3	1505.7263	1505.7263	M	K	2	16
PSM	KKWESPAQNTAHLDQFE	274	sp|P17612-2|KAPCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8730	22.451	3	2027.9701	2027.9701	L	R	21	38
PSM	KRGFGFVTFDDHDPVD	275	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10477	25.754	3	1850.8588	1850.8588	K	K	152	168
PSM	KRPPSVGDVFHGIS	276	sp|P78312-3|F193A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9442	23.45	3	1494.7943	1494.7943	S	K	638	652
PSM	RHAIYDKLDDDGLIAPGV	277	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10163	24.834	3	1967.0112	1967.0112	M	R	841	859
PSM	RHLVYESDQNKDG	278	sp|O43852-9|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4521	16.318	2	1559.7328	1559.7328	A	K	110	123
PSM	RHYTGPGDQTVNPQNGFVRN	279	sp|Q9UHI6|DDX20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7521	20.729	3	2256.0784	2256.0784	I	K	614	634
PSM	RKDMSGHYQNALYLGDVSE	280	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35	ms_run[2]:scan=9130	23.028	3	2198.0062	2198.0062	I	R	726	745
PSM	RKEYEQELSDDLHVE	281	sp|Q7Z7F7|RM55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9275	23.212	3	1888.8803	1888.8803	S	R	103	118
PSM	RLHNQKTGQEVVFVAEPDN	282	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8100	21.572	3	2180.0974	2180.0974	V	K	405	424
PSM	RLLHGFNAEGIHFS	283	sp|Q9UNQ2|DIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10089	24.637	3	1596.8161	1596.8161	I	-	300	314
PSM	RLYSLALHPNAFK	284	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9539	23.582	3	1528.8514	1528.8514	K	R	1062	1075
PSM	RPKFSVCVLGDQQHCDEA	285	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=8901	22.708	3	2144.9732	2144.9732	P	K	60	78
PSM	RPNQHNTVKLGAFQAQE	286	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8010	21.428	3	1936.9868	1936.9868	H	K	87	104
PSM	RPSHAQLHSDYMQPLTEA	287	sp|Q9NQH7-3|XPP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35	ms_run[2]:scan=7191	20.286	3	2095.9745	2095.9745	M	K	208	226
PSM	RQKQASHAQLGDAYDQEI	288	sp|P07197|NFM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7758	21.066	3	2056.9926	2056.9926	L	R	137	155
PSM	RSHTEEDCTEELFDFLHA	289	sp|P07919|QCR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4	ms_run[2]:scan=11277	29.189	3	2234.9539	2234.9539	S	R	60	78
PSM	RSHTSLKDELSDVSQGGS	290	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8529	22.163	2	1901.9079	1901.9079	P	K	241	259
PSM	RTREEECHFYAGGQVYPGEAS	291	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4	ms_run[2]:scan=8296	21.832	3	2442.0659	2442.0659	P	R	45	66
PSM	RLLGHWEEAAHDLALAC	292	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:4	ms_run[1]:scan=10740	26.813533706933335	3	1960.957968	1960.957765	H	K	193	210
PSM	KRPAEDMEEEQAFK	293	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=6583	19.295973403199998	3	1706.791515	1706.793385	G	R	21	35
PSM	KRAAEDDEDDDVDTK	294	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=3571	14.780786102933332	3	1720.738406	1720.738767	G	K	89	104
PSM	RKTGQAPGYSYTAANKN	295	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4685	16.5644620448	3	1825.906208	1825.907110	G	K	39	56
PSM	KKDEKTDTLEDLFPTT	296	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=10544	26.014328739466666	3	1879.941531	1879.941489	A	K	465	481
PSM	KKEEKEDEISLEDLIE	297	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=10727	26.7537737032	3	1945.972778	1945.973183	K	R	222	238
PSM	KKIFVGGIKEDTEEYNL	298	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=9597	23.674735758133334	3	1982.035076	1982.036058	V	R	126	143
PSM	RKDELSDWSLAGEDDRDS	299	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=9626	23.720494040266665	3	2092.928849	2092.929755	E	R	415	433
PSM	RKYSDYIKGSNLDAPEPY	300	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=9254	23.1813556464	3	2115.026031	2115.027284	Y	R	974	992
PSM	KKLTTLADLFRPPIDLMH	301	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:35	ms_run[1]:scan=11024	28.155010124	4	2124.177746	2124.176532	D	K	133	151
PSM	KAHYEAEIKNSQEAQ	302	sp|Q92990|GLMN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4717	16.607	3	1744.838	1744.8380	S	K	517	532
PSM	KEQSIFGDHRDEEEETHM	303	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	18-UNIMOD:35	ms_run[2]:scan=6448	19.083	4	2231.9389	2231.9389	L	K	252	270
PSM	KFQGIKHECQANGPEDLN	304	sp|P60981-2|DEST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:4	ms_run[2]:scan=6647	19.403	3	2083.9745	2083.9745	K	R	110	128
PSM	KGFGFVSYEKHEDAN	305	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8417	21.999	3	1726.7951	1726.7951	S	K	231	246
PSM	KGHQFSCVCLHGD	306	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=6875	19.792	3	1543.666	1543.6660	K	R	408	421
PSM	KGVPHPEDDHSQVEGPESLR	307	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6515	19.193	4	2212.0509	2212.0509	Q	-	678	698
PSM	KHFSQGSALILHQ	308	sp|P17028|ZNF24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7802	21.124	3	1464.7837	1464.7837	G	R	258	271
PSM	KHGSYEDAVHSGALND	309	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6415	19.038	2	1698.7598	1698.7598	D	-	541	557
PSM	KHHSLGGQYGVQGFPTI	310	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9989	24.422	3	1824.9271	1824.9271	D	K	82	99
PSM	KHIGYDDSSKGFDY	311	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8152	21.643	3	1630.7264	1630.7264	V	K	25	39
PSM	KHLNEIDLFHCIDPNDS	312	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4	ms_run[2]:scan=10681	26.552	3	2065.9527	2065.9527	F	K	48	65
PSM	KHNNQQALSHSIEEGL	313	sp|Q99496|RING2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8273	21.802	3	1803.8864	1803.8864	N	K	133	149
PSM	KHPVSCKDTPGFIVN	314	sp|Q16836|HCDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4	ms_run[2]:scan=7480	20.676	3	1697.8559	1697.8559	G	R	206	221
PSM	KIHMGSCAENTAK	315	sp|P24752|THIL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=4018	15.355	3	1445.6755	1445.6755	N	K	190	203
PSM	KIKSHCFVTYSTVEEAVAT	316	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:4	ms_run[2]:scan=9640	23.744	3	2169.0776	2169.0776	D	R	1034	1053
PSM	KKFMDQHPEMDFS	317	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5812	18.151	2	1670.7069	1670.7069	L	K	314	327
PSM	KKMQAHIQDLEEQLDEEEGA	318	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35	ms_run[2]:scan=9443	23.451	3	2356.0853	2356.0853	K	R	946	966
PSM	KKQELEEILHDLES	319	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10963	27.868	3	1709.8836	1709.8836	A	R	916	930
PSM	KLKDYAFVHFED	320	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10004	24.455	3	1510.7456	1510.7456	K	R	274	286
PSM	KLYHNEVEIEKLN	321	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7969	21.366	3	1627.857	1627.8570	F	K	227	240
PSM	KPHIYYGSLEEKE	322	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7615	20.85	3	1591.7882	1591.7882	K	R	26	39
PSM	KRDFSAPTLEDHFN	323	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9001	22.854	3	1675.7954	1675.7954	Y	K	357	371
PSM	KRGFAFVTFDDHDTVD	324	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10307	25.231	3	1868.8693	1868.8693	K	K	144	160
PSM	KRGHVFEESQVAGTPMFVV	325	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:35	ms_run[2]:scan=9884	24.197	3	2133.0677	2133.0677	R	K	766	785
PSM	KSLQQVDEHSKPPHL	326	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6352	18.943	3	1741.9111	1741.9111	N	R	605	620
PSM	KSPDDPSRYISPDQLADLY	327	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10951	27.81	3	2179.0433	2179.0433	F	K	262	281
PSM	KTGVHHYSGNNIELGTACG	328	sp|P62888|RL30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	18-UNIMOD:4	ms_run[2]:scan=6783	19.624	3	2013.9327	2013.9327	A	K	68	87
PSM	KVKEHINSVSAM	329	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:35	ms_run[2]:scan=3880	15.097	2	1357.7024	1357.7024	N	K	1496	1508
PSM	KWTSQHSNTQTLGK	330	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4595	16.432	3	1614.8114	1614.8114	A	-	1006	1020
PSM	KYAAELHLVHWNT	331	sp|P00918|CAH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9889	24.206	3	1580.81	1580.8100	K	K	113	126
PSM	KYGAHNYHPLPVALE	332	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8991	22.84	3	1707.8733	1707.8733	Y	R	49	64
PSM	KYNSHSLENESIK	333	sp|Q13496-2|MTM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5560	17.787	3	1547.758	1547.7580	S	R	8	21
PSM	RARGNWEQPQNQNQTQH	334	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4494	16.27	3	2090.9743	2090.9743	N	K	9	26
PSM	RCGESGHLAKDCDLQEDACYNCG	335	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,12-UNIMOD:4,19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=7070	20.108	4	2714.0578	2714.0578	Y	R	39	62
PSM	RCLALATHDNPLR	336	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=7766	21.076	3	1535.7991	1535.7991	L	R	559	572
PSM	RCPGESSHICDFIR	337	sp|P50897-2|PPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8726	22.448	3	1732.7774	1732.7774	P	K	48	62
PSM	RDAGLHCLELGHTGEAGPHAMV	338	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,21-UNIMOD:35	ms_run[2]:scan=8558	22.211	4	2343.0848	2343.0848	Y	R	969	991
PSM	RDGVYFLYEALHGPPK	339	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10936	27.737	3	1860.9523	1860.9523	V	K	232	248
PSM	RDHNEEEGEETGLRDE	340	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4870	16.81	3	1913.7987	1913.7987	G	K	440	456
PSM	RFPPYHVGQTFDR	341	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8546	22.196	3	1618.8005	1618.8005	R	R	236	249
PSM	RGHDDLGDHYLDCGDLSNAL	342	sp|Q13098-5|CSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:4	ms_run[2]:scan=10357	25.373	4	2241.9709	2241.9709	R	K	159	179
PSM	RGRNSATSADEQPHIGNY	343	sp|Q7KZI7-10|MARK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6571	19.279	3	1971.9147	1971.9147	I	R	3	21
PSM	RHPHDIIDDINSGAVECPAS	344	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:4	ms_run[2]:scan=10021	24.49	3	2202.0124	2202.0124	G	-	113	133
PSM	RHSSNPPLESHVGWVMDS	345	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:35	ms_run[2]:scan=8543	22.192	3	2049.9327	2049.9327	T	R	744	762
PSM	RHVVLGAIENKVES	346	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8164	21.658	2	1549.8576	1549.8576	G	K	154	168
PSM	RIFHTVTTTDDPVIR	347	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8326	21.881	3	1769.9424	1769.9424	K	K	173	188
PSM	RIIGAKDHASIQMNVAEVD	348	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=7710	20.996	3	2082.0528	2082.0528	N	K	22	41
PSM	RKILALLDALSTVHSQ	349	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10994	28.017	3	1764.0258	1764.0258	E	K	1205	1221
PSM	RKLVEALCAAGH	350	sp|P23919-2|KTHY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:4	ms_run[2]:scan=7374	20.537	2	1323.7081	1323.7081	S	R	24	36
PSM	RKPDAYTEQLHNEEENEDA	351	sp|Q9P0T7|TMEM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6880	19.797	3	2286.9989	2286.9989	I	R	117	136
PSM	RMHEDINEEWISDKT	352	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=8592	22.258	3	1917.8527	1917.8527	P	R	165	180
PSM	RMPLATSTDHGHNLQTVQLLIK	353	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=9497	23.517	5	2488.322	2488.3220	E	K	1491	1513
PSM	RNVVAVGTGGRGTHD	354	sp|Q969S3|ZN622_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4391	16.116	3	1494.7651	1494.7651	A	R	156	171
PSM	RPMIHELLTEGR	355	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8849	22.626	3	1450.7715	1450.7715	A	R	695	707
PSM	RSLHDALCVLAQTVKDS	356	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:4	ms_run[2]:scan=11170	28.748	3	1911.9836	1911.9836	E	R	341	358
PSM	RSNAIFGMGVLAEHGGHPAQEHFP	357	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=9476	23.489	4	2574.2186	2574.2186	V	K	916	940
PSM	RVNVGAGSHPNKV	358	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4274	15.941	2	1333.7215	1333.7215	F	K	760	773
PSM	RVTSFRDLIHDQDEDEEEEEGQ	359	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9923	24.279	4	2675.1583	2675.1583	N	R	71	93
PSM	KKATVNLLGEEK	360	sp|Q00765|REEP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6517	19.195148665066665	2	1328.765016	1328.766366	A	K	175	187
PSM	KRPLEDGDQPDAK	361	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3771	14.975541402133333	3	1467.732184	1467.731771	Q	K	64	77
PSM	KKAQQELEEQTR	362	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3932	15.186514632266666	2	1486.773299	1486.773970	T	R	359	371
PSM	KVVYPSKADLATAPPHVTVVR	363	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8632	22.316348911200002	3	2249.285928	2247.273938	L	-	563	584
PSM	KKPWQLQGEVTAQK	364	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7705	20.9899724096	3	1639.905054	1639.904590	E	R	381	395
PSM	RKDYTSGAMLTGELK	365	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8478	22.084256725600003	3	1668.851522	1668.850506	I	K	417	432
PSM	RKVESLQEEIAFLK	366	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10460	25.690043238933335	3	1688.945433	1688.946121	E	K	222	236
PSM	KKIIEDQQESLNKW	367	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8352	21.917330770933333	3	1757.932085	1757.931199	L	K	316	330
PSM	RKESEFDDEPKFMS	368	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	13-UNIMOD:35	ms_run[1]:scan=7532	20.742009295733332	3	1759.771386	1759.772316	G	K	441	455
PSM	RKLVIIEGDLERTEE	369	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9044	22.923965770933332	3	1798.978850	1798.978878	A	R	168	183
PSM	KRWIGSETDLEPPVVK	370	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9357	23.322665226933335	3	1853.007815	1853.004699	L	R	15	31
PSM	KRDMPPAFIKVENACT	371	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	4-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=8345	21.90825798666667	3	1891.929575	1891.928439	L	K	71	87
PSM	RKVENEDMNKDQILLE	372	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8383	21.958668076	3	1972.990680	1972.988791	G	K	309	325
PSM	KKKQGEDNSTAQDTEELE	373	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4764	16.672300689333333	3	2048.949349	2048.949822	K	K	449	467
PSM	RRSDSASSEPVGIYQGFEK	374	sp|Q05655|KPCD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8912	22.72337535626667	3	2112.024494	2112.023596	S	K	300	319
PSM	KKKTEFLDLDNSPLSPPSP	375	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10480	25.769292782133334	3	2112.110848	2112.110286	E	R	187	206
PSM	RRSYDVPPPPMEPDHPFYSNISKD	376	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	11-UNIMOD:35	ms_run[1]:scan=8944	22.772269106666666	4	2859.328383	2859.328629	W	R	116	140
PSM	RKDPELWGSVLLESNPYR	377	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10893	27.5454852512	3	2158.116499	2158.117103	R	R	950	968
PSM	KIKAKYPDYEVTWANDGY	378	sp|Q9NRX4|PHP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9880	24.192457335466667	3	2160.051363	2160.052771	E	-	108	126
PSM	RKDPSKNQGGGLSSSGAGEGQGP	379	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4103	15.513060834133334	3	2170.035837	2170.036286	Q	K	986	1009
PSM	KKYEDICPSTHNMDVPNIK	380	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=7122	20.181431943733333	4	2304.082690	2304.087853	G	R	67	86
PSM	RKKGLEMDPIDCTPPEYILPGS	381	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	7-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=10166	24.838774071466666	3	2531.240325	2531.239997	K	R	173	195
PSM	RRPASQKDSGAASEQATAAPNPCSSSS	382	sp|Q9BU23|LMF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	23-UNIMOD:4	ms_run[1]:scan=4217	15.8225917376	3	2717.241872	2717.242333	K	R	674	701
PSM	KKDDVTSSTGPHKELSSTEAGSTVAGAAL	383	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7964	21.360588852	4	2843.412875	2843.414861	L	R	1124	1153
PSM	KKLGEMWSEQSAKD	384	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:35	ms_run[1]:scan=5727	18.0254230576	3	1652.788341	1651.787572	A	K	127	141
PSM	KAKDNFNFLHLN	385	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10160	24.827	3	1459.7572	1459.7572	H	R	770	782
PSM	KDFWGDDYKNHV	386	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8987	22.835	3	1522.6841	1522.6841	G	K	38	50
PSM	KEHPYDAAKDSIL	387	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7935	21.316	3	1485.7464	1485.7464	S	R	94	107
PSM	KFEHCNFNDVTTRL	388	sp|P13987|CD59_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:4	ms_run[2]:scan=9122	23.02	3	1779.8363	1779.8363	W	R	66	80
PSM	KFEQSHLHMSSETQANNELTTNGHGPPAS	389	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:35	ms_run[2]:scan=6532	19.221	4	3164.4218	3164.4218	K	K	48	77
PSM	KFTMDCVAPTIHVYEHHEN	390	sp|O43402|EMC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4	ms_run[2]:scan=9464	23.475	4	2327.0463	2327.0463	T	R	131	150
PSM	KGHYTEGAELVDSVLDVV	391	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11477	30.054	3	1929.9684	1929.9684	A	R	103	121
PSM	KGKTVGFGTNNSEHITYLEHNPYE	392	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9142	23.045	4	2734.2987	2734.2987	K	K	599	623
PSM	KHAAENPGKYNILGTNTIMD	393	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9673	23.8	3	2186.079	2186.0790	T	K	497	517
PSM	KHHLGAATPENPEIELL	394	sp|Q99417|MYCBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9823	24.076	3	1867.9792	1867.9792	L	R	49	66
PSM	KHLLGAEHGDEP	395	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5095	17.13	2	1301.6364	1301.6364	N	R	341	353
PSM	KHNVGVKCATITPDE	396	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:4	ms_run[2]:scan=5541	17.758	3	1667.8301	1667.8301	K	K	66	81
PSM	KHWMLDKLTGVFAP	397	sp|P22090|RS4Y1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35	ms_run[2]:scan=10637	26.364	3	1657.865	1657.8650	P	R	16	30
PSM	KIKPHLMSQELPEDWD	398	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9869	24.172	3	1964.9666	1964.9666	G	K	350	366
PSM	KIRLQAYHTQTTPLIEYY	399	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10223	24.981	3	2237.1845	2237.1845	L	R	136	154
PSM	KLKDYAFIHFDE	400	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10342	25.327	3	1524.7613	1524.7613	K	R	217	229
PSM	KLSSEHYSSQSHGNSMTELKPSS	401	sp|Q9UHB7-3|AFF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:35	ms_run[2]:scan=4824	16.751	4	2536.15	2536.1500	P	K	269	292
PSM	KNKHEAMITDLEE	402	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:35	ms_run[2]:scan=6510	19.185	2	1572.7454	1572.7454	L	R	1022	1035
PSM	KPHSVSLNDTETR	403	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4728	16.622	3	1482.7427	1482.7427	P	K	161	174
PSM	KQILEDAAALIIHHVK	404	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10824	27.214	4	1798.0465	1798.0465	D	R	784	800
PSM	KQNQHEELQNVR	405	sp|Q8NHH9-3|ATLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4354	16.061	3	1521.7648	1521.7648	V	K	99	111
PSM	KRGHVFEESQVAGTPMFVV	406	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:35	ms_run[2]:scan=9864	24.162	3	2133.0677	2133.0677	R	K	766	785
PSM	KSGYHQSASEHGLVVIAPDTSPRGCNI	407	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	25-UNIMOD:4	ms_run[2]:scan=8789	22.536	4	2879.3984	2879.3984	S	K	64	91
PSM	KYHTINGHNCEV	408	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4	ms_run[2]:scan=4794	16.713	2	1470.6674	1470.6674	Q	K	165	177
PSM	KYIIDKYGNHPAFY	409	sp|Q5SRI9|MANEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9342	23.3	3	1727.8671	1727.8671	V	R	239	253
PSM	KYNQATQTFHQWRDA	410	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8214	21.725	3	1892.8918	1892.8918	L	R	69	84
PSM	RATSPSSSVSGDFDDGHHSVSTPGPSR	411	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6794	19.646	4	2726.2281	2726.2281	R	K	7	34
PSM	RDKVAGHSLGYGFVNYVTA	412	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10362	25.385	3	2053.0381	2053.0381	I	K	53	72
PSM	REGYAWAEDKEHCEEYG	413	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:4	ms_run[2]:scan=7941	21.325	3	2127.8592	2127.8592	L	R	181	198
PSM	REKEHYCLADLASLMD	414	sp|Q92552|RT27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=10280	25.153	3	1965.8924	1965.8924	A	K	43	59
PSM	RFIPHENGVHTIDV	415	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8568	22.222	3	1632.8372	1632.8372	V	K	2166	2180
PSM	RHALDAHQQSIPAVLEIPS	416	sp|Q16864|VATF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10265	25.111	3	2081.1018	2081.1018	V	K	75	94
PSM	RHPHDIIDDINSGAVECPAS	417	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=9690	23.824	3	2202.0124	2202.0124	G	-	113	133
PSM	RHPHDIIDDINSGAVECPAS	418	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=9877	24.188	3	2202.0124	2202.0124	G	-	113	133
PSM	RHTNPIVENGQTHPCQ	419	sp|Q9Y5L0-3|TNPO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	15-UNIMOD:4	ms_run[2]:scan=4644	16.5	3	1886.8806	1886.8806	F	K	620	636
PSM	RHVDLGGGLKPPGYYVQ	420	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9495	23.515	3	1854.9741	1854.9741	S	R	2205	2222
PSM	RHWILPQDYDHAQAEA	421	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9274	23.211	3	1948.918	1948.9180	I	R	219	235
PSM	RIVEKYGYTHLSAGELL	422	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10055	24.574	3	1948.0418	1948.0418	A	R	22	39
PSM	RKDVFFYQADDEHYIP	423	sp|Q9NRH3|TBG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10411	25.548	3	2041.9534	2041.9534	D	R	47	63
PSM	RKNVLGHMQQGGAPSPFD	424	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=7506	20.709	3	1953.9479	1953.9479	C	R	657	675
PSM	RLEHAFCTETRPYNQGA	425	sp|Q9BV20|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4	ms_run[2]:scan=7367	20.529	3	2048.9487	2048.9487	G	R	193	210
PSM	RLHPGELADTPKSE	426	sp|Q9Y483-4|MTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5930	18.342	3	1548.7896	1548.7896	D	R	302	316
PSM	RLKGSGNLEAIHII	427	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9681	23.813	3	1519.8835	1519.8835	L	K	142	156
PSM	RLQADPQRFPHGI	428	sp|P06280|AGAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8448	22.045	3	1533.8164	1533.8164	G	R	105	118
PSM	RNKTEDLEATSEHF	429	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7581	20.806	3	1675.7802	1675.7802	L	K	45	59
PSM	RNMSVIAHVDHG	430	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6210	18.731	2	1334.6514	1334.6514	I	K	20	32
PSM	RPHEGPGGGISGGSGH	431	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3733	14.936	3	1457.676	1457.6760	H	R	798	814
PSM	RPHEGPGGGMGSGH	432	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=3269	14.37	3	1347.5738	1347.5738	H	R	768	782
PSM	RQHCCPAGYTCNVKA	433	sp|P28799-3|GRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4,5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=5197	17.273	3	1820.7869	1820.7869	D	R	298	313
PSM	RQHLEETTQKAESQLLEC	434	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	18-UNIMOD:4	ms_run[2]:scan=8669	22.371	3	2199.059	2199.0590	V	K	1110	1128
PSM	RRECPSDECGAGVFMASHFD	435	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=8884	22.682	3	2342.9467	2342.9467	L	R	118	138
PSM	RSHHAASTTTAPTPAA	436	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3699	14.904	3	1575.7754	1575.7754	R	R	1083	1099
PSM	RSRGFGFITFTNPEHASVAM	437	sp|P98179|RBM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	20-UNIMOD:35	ms_run[2]:scan=10457	25.681	3	2240.0797	2240.0797	Q	R	45	65
PSM	RVLHNAQEVEKEPGQ	438	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4698	16.582	3	1732.8856	1732.8856	E	R	366	381
PSM	RYFDGSGGNNHAVEHY	439	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6876	19.793	3	1821.7819	1821.7819	R	R	222	238
PSM	RYTIHSQLEHLQS	440	sp|Q9BWJ5|SF3B5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8018	21.439	3	1610.8165	1610.8165	D	K	4	17
PSM	RHLETGGQKIEADS	441	sp|Q92538|GBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4545	16.363171540533333	3	1539.760164	1539.764134	Q	R	1521	1535
PSM	KFGNADVVNVLSSHHLIVKNS	442	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=10320	25.266108566666666	4	2278.228391	2277.222965	C	R	421	442
PSM	KGFGHGAGLLAHQ	443	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7240	20.349847214933334	3	1291.676662	1291.678554	G	R	287	300
PSM	KRLLIDGDGAGDDR	444	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=6504	19.168574152	3	1499.768967	1499.769219	R	R	12	26
PSM	KKLDSAAKDADE	445	sp|Q14203|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=3546	14.744086377333334	2	1289.647194	1289.646310	E	R	978	990
PSM	KKNILDSKPTAN	446	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4854	16.7925291808	2	1327.746786	1327.745965	V	K	406	418
PSM	KKKEEGVIDSSD	447	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=3846	15.054448921066667	2	1333.673165	1333.672525	K	K	249	261
PSM	KKIYEDGDDDMK	448	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4817	16.741618991733333	2	1455.654472	1455.655160	L	R	196	208
PSM	KKIYEDGDDDMK	449	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4784	16.702754862666666	3	1455.654925	1455.655160	L	R	196	208
PSM	KRAAEEEDEADPK	450	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=3462	14.638947848266668	2	1486.690536	1486.689966	L	R	80	93
PSM	RKGDEVDGVDEVAK	451	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5319	17.442168711733334	3	1515.752964	1515.752900	K	K	208	222
PSM	RKSLSDSESDDSKS	452	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=3431	14.591054084	3	1539.702916	1539.701259	K	K	91	105
PSM	KKLGEWVGLCKID	453	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:4	ms_run[1]:scan=9693	23.828288967466666	3	1544.837830	1544.838485	N	R	83	96
PSM	RKVVGDVAYDEAKE	454	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5898	18.288198632533334	3	1577.802632	1577.804936	G	R	250	264
PSM	KKILGYINTGKQEGA	455	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7601	20.834108848000003	3	1618.904270	1618.904256	F	K	368	383
PSM	RKSPGVAAAVAEDGGLK	456	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7375	20.5386419968	3	1624.889301	1624.889669	K	K	7	24
PSM	KKPWQLQGEVTAQK	457	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7692	20.973276457333334	3	1639.905054	1639.904590	E	R	381	395
PSM	KKIIEDQQESLNKW	458	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8340	21.902555791199998	3	1757.932085	1757.931199	L	K	316	330
PSM	KRLQSIGTENTEENR	459	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4630	16.483379193866668	3	1773.895958	1773.896939	A	R	42	57
PSM	RKTGSYGALAEITASKEGQ	460	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8583	22.242984813333333	3	1966.009244	1966.011969	L	K	441	460
PSM	KKEGKPTIVEEDDPELF	461	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=9574	23.6370901688	3	1972.998001	1972.999338	L	K	142	159
PSM	RKNFQLEEEEQNEAKL	462	sp|Q9Y5A7|NUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8397	21.973036796	3	2003.990972	2003.991233	A	K	166	182
PSM	RKGFNEGLWEIDNNPKV	463	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=10047	24.5492653696	3	2015.022860	2015.022474	K	K	74	91
PSM	KKGESQTDIEITREEDFT	464	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8615	22.2864574888	3	2125.010536	2125.017508	Y	R	248	266
PSM	KKYEDICPSTHNMDVPNIK	465	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	7-UNIMOD:4	ms_run[1]:scan=8188	21.6886655736	4	2288.095005	2288.092938	G	R	67	86
PSM	RKVEKDTMSDQALEALSASLGT	466	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	8-UNIMOD:35	ms_run[1]:scan=10529	25.947370695733333	3	2365.180939	2365.179505	K	R	279	301
PSM	KKPYQLIAQDNETEKPIDSETKM	467	sp|P43003|EAA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	23-UNIMOD:35	ms_run[1]:scan=7730	21.02141154	4	2721.355045	2721.353112	M	-	520	543
PSM	KDRLLASTLVHSV	468	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9504	23.528	3	1437.8304	1437.8304	T	K	394	407
PSM	KDYAFVHFEDRGAAV	469	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9842	24.114	3	1723.8318	1723.8318	L	K	276	291
PSM	KEFHLEYDKLEE	470	sp|Q9NZN8-3|CNOT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9276	23.213	3	1578.7566	1578.7566	A	R	163	175
PSM	KEMITMLHYDLLHHPYEPSGN	471	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=9606	23.689	4	2556.1777	2556.1777	K	K	577	598
PSM	KHAVSEGTKAVT	472	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3560	14.77	3	1226.6619	1226.6619	A	K	109	121
PSM	KHFFLYGEFPGDER	473	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10330	25.299	3	1740.826	1740.8260	G	R	546	560
PSM	KHRATGEGGASDLPEDPDEDAIPIT	474	sp|O15541|R113A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9198	23.11	3	2590.2147	2590.2147	E	-	319	344
PSM	KIFSIIAEGEMHEAIKHEDPCA	475	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=9598	23.676	4	2540.2039	2540.2039	P	K	977	999
PSM	KIRDAYTHPQFVTDVM	476	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	16-UNIMOD:35	ms_run[2]:scan=8766	22.502	3	1935.9513	1935.9513	E	K	431	447
PSM	KIRLLEEQLQHEISN	477	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9968	24.374	3	1849.0058	1849.0058	D	K	681	696
PSM	KIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSA	478	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7033	20.047	5	3517.6723	3517.6723	S	R	252	289
PSM	KKHSQFIGYPITLYLE	479	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10953	27.821	3	1936.0458	1936.0458	V	K	203	219
PSM	KKHSQFIGYPITLYLE	480	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11026	28.162	3	1936.0458	1936.0458	V	K	203	219
PSM	KKMQAHIQDLEEQLDEEEGA	481	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9936	24.31	3	2340.0904	2340.0904	K	R	946	966
PSM	KNFYQEHPDLAR	482	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7244	20.353	3	1516.7423	1516.7423	E	R	56	68
PSM	KRGAGMPGQHGQITQQELDTVV	483	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=9025	22.888	3	2365.1808	2365.1808	S	K	372	394
PSM	KRGFAFVTFDDHDTVD	484	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10441	25.634	3	1868.8693	1868.8693	K	K	144	160
PSM	KRNDHDDDEDEEVIS	485	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5117	17.158	2	1814.7555	1814.7555	F	K	340	355
PSM	KSRPEFMLPVHFYG	486	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10715	26.699	3	1706.8603	1706.8603	E	K	158	172
PSM	KTAWLDGKHVVFG	487	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9613	23.7	3	1456.7827	1456.7827	V	K	158	171
PSM	KTHYPAQQGEYQTHQPVYH	488	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5711	18.01	4	2311.077	2311.0770	Q	K	230	249
PSM	KTRAEAEAAAVHGA	489	sp|Q5T8P6-5|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4751	16.656	2	1380.711	1380.7110	F	R	460	474
PSM	KVFLENVIRDAVTYTEHA	490	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11467	30.015	3	2104.0953	2104.0953	L	K	60	78
PSM	KVHLVGIDIFTGK	491	sp|Q9GZV4|IF5A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10537	25.988	3	1425.8344	1425.8344	A	K	55	68
PSM	KYEIDLDTSDHAHLEHIT	492	sp|P08237-2|PFKAM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9229	23.148	4	2136.0124	2136.0124	A	R	723	741
PSM	RAHQLVMEGYNWCHD	493	sp|P67775|PP2AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=8300	21.837	3	1930.8203	1930.8203	S	R	239	254
PSM	RAHVETAQKTGVFQL	494	sp|Q8N9N7|LRC57_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8904	22.711	3	1683.9057	1683.9057	L	K	7	22
PSM	RDVVNVYEPQLQHHVAQK	495	sp|Q16222-2|UAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7796	21.115	4	2159.1236	2159.1236	L	K	339	357
PSM	RFVHSENQHLVSPEALDFLD	496	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10781	27.009	4	2352.1499	2352.1499	E	K	147	167
PSM	RGLLSSLDHTSIR	497	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9257	23.188	3	1453.8001	1453.8001	H	R	99	112
PSM	RHAEFESLCAQYSADK	498	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:4	ms_run[2]:scan=8441	22.037	3	1910.8581	1910.8581	H	R	1913	1929
PSM	RHNPTVTGHQEQTYLQ	499	sp|Q71RC2-7|LARP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5968	18.397	3	1907.9238	1907.9238	E	K	412	428
PSM	RHPHDIIDDINSGAVECPAS	500	sp|P30050-2|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=8729	22.45	3	2202.0124	2202.0124	G	-	113	133
PSM	RHQGLGGTLPPRTFIN	501	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8882	22.678	3	1762.9591	1762.9591	H	R	283	299
PSM	RHTENEEDKVSSSSF	502	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5827	18.17	3	1750.7758	1750.7758	L	R	322	337
PSM	RIDSHHDNQSAVAELD	503	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6548	19.249	3	1805.8293	1805.8293	G	R	126	142
PSM	RIKPAATSHVEGSGGVSA	504	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4818	16.743	3	1722.9013	1722.9013	R	K	5	23
PSM	RILDWHVANTDK	505	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8781	22.524	2	1466.763	1466.7630	G	K	192	204
PSM	RILTDYGFEGHPFR	506	sp|O75489|NDUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9873	24.182	3	1706.8529	1706.8529	R	K	186	200
PSM	RISQEHLADHFDS	507	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7248	20.357	3	1553.7223	1553.7223	F	R	1261	1274
PSM	RKGLVSGGLYESHVGC	508	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	16-UNIMOD:4	ms_run[2]:scan=7897	21.256	3	1717.857	1717.8570	T	R	164	180
PSM	RKHEDDEPVFEQIENTANPS	509	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10204	24.939	3	2354.0775	2354.0775	K	R	1281	1301
PSM	RKLIQDQQEQIQHL	510	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7974	21.373	3	1775.9642	1775.9642	N	K	711	725
PSM	RKQQGLEENHELFS	511	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7771	21.084	3	1713.8434	1713.8434	E	K	571	585
PSM	RKVSQPIEGHAASFAQF	512	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9056	22.941	3	1871.9642	1871.9642	D	K	188	205
PSM	RLHEDDKEQDIAD	513	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4645	16.501	2	1582.7223	1582.7223	Y	K	1096	1109
PSM	RLHNTIVEINNH	514	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6868	19.783	2	1458.7692	1458.7692	K	K	886	898
PSM	RLHTLEEEKEELAQYQ	515	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9561	23.61	3	2014.996	2014.9960	E	K	199	215
PSM	RLIEQIHPSKDENQHSNASQSLCDII	516	sp|Q9UPN7|PP6R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	23-UNIMOD:4	ms_run[2]:scan=9837	24.102	4	3031.4781	3031.4781	Q	R	194	220
PSM	RLKNEIPNSHILDQY	517	sp|P35520|CBS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9327	23.281	3	1838.9639	1838.9639	W	R	209	224
PSM	RLLHVAVSDVNDDVR	518	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8502	22.117	3	1706.9064	1706.9064	R	R	601	616
PSM	RLNSHMNALHLGSQAN	519	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=6311	18.88	3	1777.8642	1777.8642	Q	R	120	136
PSM	RNKIAGYVTHLM	520	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=8007	21.423	3	1417.75	1417.7500	L	K	47	59
PSM	RQHMADLEGHLQSAQ	521	sp|Q08378-2|GOGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:35	ms_run[2]:scan=5805	18.142	3	1735.806	1735.8060	V	K	912	927
PSM	RSSAAAAAAAAAGQIHHVTQNGGLYK	522	sp|O15270|SPTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9632	23.733	4	2520.2946	2520.2946	V	R	31	57
PSM	RTREGNDLYHEMIESGVINL	523	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=10240	25.035	3	2361.1383	2361.1383	E	K	239	259
PSM	RVAPEEHPVLLTEAPLNPKAN	524	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8914	22.725	4	2294.2383	2294.2383	L	R	95	116
PSM	RVKHEVSGETVVFQGGALG	525	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8939	22.763	3	1969.0381	1969.0381	K	K	1037	1056
PSM	RVREEHQGENLDENLVPVAAAEG	526	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9236	23.155	3	2531.2364	2531.2364	N	R	389	412
PSM	RVREEVPLELVEAHV	527	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10595	26.195	3	1773.9737	1773.9737	S	K	724	739
PSM	RVVDLMAHMASKE	528	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9294	23.233	3	1485.7432	1485.7432	N	-	281	294
PSM	RVVVHKETELAEEGED	529	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5729	18.028	3	1838.901	1838.9010	T	-	990	1006
PSM	RWPTGDNIHAEHQV	530	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7490	20.687	3	1658.7914	1658.7914	H	R	145	159
PSM	RVLSAPPHFHFGQTN	531	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9145	23.047500384533336	3	1707.873146	1706.864123	V	R	30	45
PSM	RLSDQFHDILIR	532	sp|O75340|PDCD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10263	25.107880635466664	3	1513.826988	1511.820861	Y	K	125	137
PSM	RHSPLTQMGPAKD	533	sp|Q9Y2Q9|RT28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	8-UNIMOD:35	ms_run[1]:scan=4051	15.407632136533334	2	1452.706485	1452.714347	L	K	85	98
PSM	KKPTPDKCAADV	534	sp|O94903|PLPHP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	8-UNIMOD:4	ms_run[1]:scan=3805	15.0113346056	2	1328.677378	1328.675836	S	K	254	266
PSM	KKFPGSAALVGAVR	535	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8291	21.824664634133335	3	1399.830626	1399.829969	S	K	626	640
PSM	KKIYEDGDDDMK	536	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	11-UNIMOD:35	ms_run[1]:scan=3716	14.921847641600001	3	1471.648667	1471.650075	L	R	196	208
PSM	RKENQIYSADEK	537	sp|Q5M9Q1|NKAPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4214	15.8065335064	2	1479.730402	1479.731771	L	R	355	367
PSM	MKHYEVEILDAKT	538	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8999	22.852003794399998	3	1575.799011	1575.796680	-	R	1	14
PSM	RKLTELENELNTK	539	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8385	21.96019305493333	3	1586.864859	1586.862785	S	-	1812	1825
PSM	RKENSMDTASQAIK	540	sp|Q9BRV8|SIKE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:35	ms_run[1]:scan=3666	14.869577382133334	3	1593.779765	1593.778070	A	-	194	208
PSM	RKTVTAMDVVYALK	541	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:35	ms_run[1]:scan=9283	23.218819982933333	3	1609.885608	1609.886164	K	R	79	93
PSM	KRLEEEEAAAEKED	542	sp|Q5T280|CI114_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5122	17.1688037288	3	1645.779083	1645.779509	A	R	55	69
PSM	RKSMYEEEINETR	543	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:35	ms_run[1]:scan=5657	17.92686115893333	3	1699.783107	1699.783549	F	R	208	221
PSM	KKAVPKEDIYSGGGGGGS	544	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4926	16.877580651466666	3	1705.862803	1705.863514	V	R	171	189
PSM	RKENSSVEAKDSGLES	545	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4115	15.550981120533333	2	1734.838469	1734.838421	P	K	429	445
PSM	RKLGGSQEDQIKNAID	546	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7336	20.486725530666668	3	1770.921105	1770.922425	G	K	70	86
PSM	KRETGVDLTKDNMALQ	547	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8096	21.568183414933333	3	1817.928070	1817.930547	F	R	291	307
PSM	KKLNYEENKEESLLE	548	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7986	21.393134272	3	1864.937719	1864.941824	M	K	466	481
PSM	RRADLNQGIGEPQSPSR	549	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5837	18.179926377066668	3	1879.960349	1879.961271	L	R	61	78
PSM	RKVENEDMNKDQILLE	550	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	8-UNIMOD:35	ms_run[1]:scan=7623	20.861604492266668	3	1988.982742	1988.983706	G	K	309	325
PSM	KKAKAGLESGAEPGDGDSDTT	551	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4206	15.7807899408	3	2032.954872	2032.954907	D	K	477	498
PSM	RKAAGEPIKEGDNDYFTCIT	552	sp|Q99543|DNJC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	18-UNIMOD:4	ms_run[1]:scan=9185	23.094260922133333	3	2284.077637	2284.079397	K	K	123	143
PSM	KKGVSTLCEEHVEPETTLPAR	553	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	8-UNIMOD:4	ms_run[1]:scan=7520	20.7277906656	4	2380.206460	2380.205660	K	R	71	92
PSM	KAGAHLQGGAK	554	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3329	14.461	2	1036.5778	1036.5778	E	R	65	76
PSM	KCKAEHDQLLLNYA	555	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4	ms_run[2]:scan=9151	23.053	3	1701.8508	1701.8508	G	K	109	123
PSM	KEKVHEYNVLLETLS	556	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10431	25.609	3	1800.9622	1800.9622	H	R	180	195
PSM	KGFGHGAGLLAHQ	557	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7250	20.36	3	1291.6786	1291.6786	G	R	287	300
PSM	KHALHCTILASAGQQ	558	sp|Q9BT78-2|CSN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=6809	19.674	3	1633.8359	1633.8359	L	R	227	242
PSM	KHEDHQVSDGAL	559	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4681	16.559	2	1334.6215	1334.6215	L	R	196	208
PSM	KHGDIKCVLNEGMPIY	560	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:4	ms_run[2]:scan=10098	24.659	3	1872.9226	1872.9226	V	R	296	312
PSM	KHHAAYVNNLNVTEE	561	sp|P04179-3|SODM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7138	20.204	3	1737.8434	1737.8434	S	K	53	68
PSM	KHKELAPYDENWFYT	562	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10428	25.602	3	1939.9105	1939.9105	A	R	41	56
PSM	KHKLDVTSVEDY	563	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8032	21.466	2	1432.7198	1432.7198	T	K	170	182
PSM	KHLEINPDHSIIETL	564	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10115	24.709	3	1757.9312	1757.9312	K	R	632	647
PSM	KHWPFMVVNDAGRP	565	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35	ms_run[2]:scan=9261	23.194	3	1668.8195	1668.8195	M	K	88	102
PSM	KHWPFQVINDGDKP	566	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9761	23.967	3	1679.842	1679.8420	M	K	88	102
PSM	KIKPHLMSQELPEDWD	567	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=9055	22.94	3	1980.9615	1980.9615	G	K	350	366
PSM	KKGDLLNAHYDGYLA	568	sp|Q9Y680-3|FKBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9456	23.466	3	1676.8522	1676.8522	S	K	51	66
PSM	KKLGIHSALLDE	569	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8452	22.048	2	1322.7558	1322.7558	L	K	139	151
PSM	KKTVSSHEVFLQ	570	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6782	19.622	2	1401.7616	1401.7616	F	R	137	149
PSM	KKWCDDYFFIAH	571	sp|P36551|HEM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:4	ms_run[2]:scan=10495	25.816	3	1628.7446	1628.7446	F	R	316	328
PSM	KLQHPLGVTWDK	572	sp|Q8NBF2-2|NHLC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8287	21.817	2	1420.7827	1420.7827	A	K	114	126
PSM	KMHLEKLEEQLS	573	sp|Q96EA4-2|SPDLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=7639	20.888	2	1499.7654	1499.7654	Q	R	88	100
PSM	KMQLPSAAGLHPTGHQSKEELG	574	sp|Q15050|RRS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8400	21.976	4	2315.1692	2315.1692	H	R	198	220
PSM	KNHPWLELSDVH	575	sp|Q9Y2S7|PDIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9701	23.84	3	1473.7365	1473.7365	E	R	223	235
PSM	KNHSGNDERDEEDEE	576	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3347	14.484	3	1801.6987	1801.6987	C	R	293	308
PSM	KRSELEEQQMHLNVGL	577	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35	ms_run[2]:scan=8769	22.507	3	1925.9629	1925.9629	E	R	3190	3206
PSM	KVHSHSAEMEAQLSQALEELGGQ	578	sp|Q9Y6D9|MD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=10588	26.174	4	2494.1758	2494.1758	Q	K	444	467
PSM	RAHQITDESLESTR	579	sp|O00161-2|SNP23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5887	18.262	2	1641.8071	1641.8071	Q	R	12	26
PSM	RDAEDALHNLDR	580	sp|O75494-5|SRS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7765	21.074	3	1423.6804	1423.6804	V	K	62	74
PSM	RDKNWQTPLHIAAAN	581	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8883	22.68	3	1733.8962	1733.8962	A	K	103	118
PSM	RDKQPNAQPQYLHGS	582	sp|Q7L576-3|CYFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5150	17.203	3	1737.8547	1737.8547	Q	K	71	86
PSM	RDKSFILEEHMD	583	sp|Q6NVY1-2|HIBCH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=7584	20.809	3	1534.7086	1534.7086	D	K	255	267
PSM	REKEEFASAHFSPVL	584	sp|Q9Y4R8|TELO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9822	24.073	3	1745.8737	1745.8737	P	R	49	64
PSM	REKNLAHPVIQNFSYETFQQ	585	sp|Q15554-4|TERF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10084	24.628	3	2448.2186	2448.2186	I	K	242	262
PSM	RFHMDSETHDPIDLQT	586	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35	ms_run[2]:scan=8231	21.749	3	1956.8636	1956.8636	V	K	608	624
PSM	RGHYNNVSCAVFHP	587	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:4	ms_run[2]:scan=8056	21.503	3	1656.7579	1656.7579	C	R	246	260
PSM	RGLNSQSSDDHLNK	588	sp|Q96HA1-2|P121A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3916	15.16	3	1569.7495	1569.7495	K	R	109	123
PSM	RHATAEEVEEEERD	589	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4786	16.704	3	1698.7445	1698.7445	K	R	32	46
PSM	RHFEATDILVSKIS	590	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10158	24.823	3	1614.873	1614.8730	G	R	1174	1188
PSM	RHLLPCVIHAAVL	591	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=10167	24.842	3	1497.8602	1497.8602	A	K	734	747
PSM	RHNIICLQNDH	592	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=6888	19.807	2	1418.6837	1418.6837	A	K	76	87
PSM	RHQEGEIFDTEKE	593	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6558	19.262	3	1616.7431	1616.7431	P	K	226	239
PSM	RHVFGQPVKNDQCYEDI	594	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4	ms_run[2]:scan=8444	22.04	3	2103.9796	2103.9796	F	R	13	30
PSM	RHYGGLTGLNKAETAA	595	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7260	20.37	3	1657.8536	1657.8536	E	K	90	106
PSM	RIFHELTQTDKALFN	596	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9827	24.082	3	1831.9581	1831.9581	A	R	463	478
PSM	RINSYGYGDHYIHI	597	sp|Q96EY1-3|DNJA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9595	23.673	3	1706.8165	1706.8165	P	K	242	256
PSM	RIYESHVGISSHEG	598	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5849	18.196	3	1569.7536	1569.7536	L	K	198	212
PSM	RKDVYVQLYLQHLTA	599	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10671	26.512	3	1846.0101	1846.0101	Q	R	33	48
PSM	RKLTALDYHNPAGFNC	600	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:4	ms_run[2]:scan=8956	22.787	3	1875.905	1875.9050	R	K	4	20
PSM	RLADHGSSSGGGWEVK	601	sp|P98175-5|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6339	18.924	3	1641.7859	1641.7859	P	R	32	48
PSM	RLCHDNNEDHQLD	602	sp|Q96PM5-3|ZN363_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:4	ms_run[2]:scan=4154	15.652	3	1664.6961	1664.6961	C	R	41	54
PSM	RLLASTLVHSVK	603	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8616	22.288	3	1322.8034	1322.8034	D	K	396	408
PSM	RMFADDLHNLNK	604	sp|Q4U2R6|RM51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=7706	20.991	3	1488.7143	1488.7143	S	R	101	113
PSM	RMLFDYLADKHGF	605	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35	ms_run[2]:scan=10570	26.108	3	1627.7817	1627.7817	G	R	111	124
PSM	RPLHPVANPHAEIST	606	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6195	18.714	3	1637.8638	1637.8638	Q	K	153	168
PSM	RPMIHELLTEGR	607	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=8118	21.597	3	1466.7664	1466.7664	A	R	695	707
PSM	RRGAPAAATAPAPTAH	608	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3816	15.023	3	1514.8066	1514.8066	E	K	127	143
PSM	RSKVDEAVAVLQAHQA	609	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9585	23.658	3	1720.922	1720.9220	L	K	515	531
PSM	RTALHGVKWPQSNP	610	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7818	21.144	3	1589.8427	1589.8427	T	K	1053	1067
PSM	RTHPCPQCSETFPTAATLEAHK	611	sp|Q66K89|E4F1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=8301	21.839	4	2538.1744	2538.1744	P	R	433	455
PSM	RVKTSEDADELH	612	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3993	15.312	2	1398.6739	1398.6739	I	K	420	432
PSM	RVNIGQGSHPQKV	613	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4877	16.818	3	1418.7742	1418.7742	Y	K	564	577
PSM	RVRVVDNSALGNSPYH	614	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7382	20.547	3	1782.9125	1782.9125	T	R	37	53
PSM	RVSHQVAYGLHELL	615	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9846	24.121	3	1620.8736	1620.8736	S	K	1237	1251
PSM	KHEDHQVSDGAL	616	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4654	16.517810118133333	2	1334.620474	1334.621492	L	R	196	208
PSM	KYIIDKYGNHPAFY	617	sp|Q5SRI9|MANEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9324	23.2776487784	3	1727.867255	1727.867142	V	R	239	253
PSM	KKDLSLEEIQK	618	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7046	20.065076445866666	2	1329.750999	1329.750381	K	K	42	53
PSM	KKMEEVKEANI	619	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:35	ms_run[1]:scan=4497	16.2749305808	2	1333.691085	1333.691152	N	R	441	452
PSM	KKAVISYTEGLK	620	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7133	20.195381685333334	2	1335.776698	1335.776202	Y	K	96	108
PSM	RNPSVIDKQDKD	621	sp|Q9NPL8|TIDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3763	14.966734993066666	3	1413.721884	1413.721206	P	-	274	286
PSM	KKYMEENDQLK	622	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4800	16.720669128	2	1425.714843	1424.696965	A	K	148	159
PSM	KMKGTLIDNQFK	623	sp|Q9H5V9|CX056_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:35	ms_run[1]:scan=6810	19.67491440666667	3	1437.765799	1437.764986	A	-	211	223
PSM	KKLNVTEQEKID	624	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5362	17.493145885066667	3	1443.793622	1443.793309	S	K	80	92
PSM	KKLEEEGEQFVK	625	sp|P22307|NLTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6973	19.955231153866666	3	1462.770036	1462.766760	E	K	442	454
PSM	RKFSAGGDSDPPLK	626	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5486	17.6842712224	3	1473.761454	1473.757592	K	R	287	301
PSM	KKWDLSELPKFE	627	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10626	26.3190624408	3	1518.807645	1518.808230	K	K	120	132
PSM	KKWNLDELPKFE	628	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10438	25.626085318666664	3	1545.819399	1545.819129	K	K	44	56
PSM	RKTVTAMDVVYALK	629	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10352	25.359409986133336	3	1593.890429	1593.891249	K	R	79	93
PSM	RKFQPLFGDFAAEK	630	sp|Q15050|RRS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10155	24.819532352266666	3	1652.868376	1652.867477	K	K	252	266
PSM	RKQLQDIATLADQR	631	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8645	22.337609167999997	3	1654.911475	1654.911467	Q	R	989	1003
PSM	KKSADTLWDIQKDL	632	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10551	26.03889712186667	3	1659.882555	1659.883186	L	K	318	332
PSM	KKKDDETVDSLGPLE	633	sp|Q9UJX2|CDC23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8371	21.942462036800002	3	1672.853762	1672.851946	E	K	128	143
PSM	RKDLPNGDIDEYEK	634	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7101	20.150819501333334	3	1690.814152	1690.816229	R	K	93	107
PSM	KKLYEQILAENEKL	635	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10088	24.635648266133334	3	1717.961731	1717.961437	F	K	933	947
PSM	KRMTGSEFDFEEMK	636	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=7567	20.788683972266664	3	1765.764545	1765.765122	Y	R	422	436
PSM	RKILDDTEDTVVSQR	637	sp|P42696|RBM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7525	20.734886536533335	3	1773.920083	1773.922091	D	K	155	170
PSM	RKLSGLEQPQGALQTR	638	sp|Q6RFH5|WDR74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7235	20.3399537248	3	1780.989118	1780.990780	K	R	358	374
PSM	RKLVILEGELERAEE	639	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9836	24.1009371448	3	1782.983620	1782.983963	A	R	131	146
PSM	KKPKTPSLTVFLLGQSA	640	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10763	26.9229226168	3	1814.066836	1814.066570	S	R	1132	1149
PSM	RKMAQELYMEQKNE	641	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=4785	16.703383804	3	1828.842047	1828.844769	Y	R	761	775
PSM	KKLKTEDSLMPEEEFL	642	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	10-UNIMOD:35	ms_run[1]:scan=9770	23.9803631064	3	1951.981004	1951.981246	S	R	683	699
PSM	RKLTFLYLANDVIQNSK	643	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=11030	28.179676705866665	3	2022.126537	2022.126211	N	R	55	72
PSM	KKPRPPPALGPEETSASAGLP	644	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8492	22.107388352266664	3	2099.136388	2099.137504	K	K	14	35
PSM	KKVKAEDEALLSEEDDPID	645	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8944	22.772269106666666	3	2143.055287	2143.053225	P	R	1767	1786
PSM	KKKVWLDPNETNEIANANS	646	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8584	22.2439703072	3	2170.099964	2170.101846	G	R	19	38
PSM	KKKAAAQLLQSQAQQSGAQQT	647	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5977	18.406808156533334	4	2212.198106	2212.192393	Q	K	397	418
PSM	KKCSVIRDSLYVDGDCTMDI	648	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:4,16-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=9296	23.236445054666667	4	2390.090686	2390.091618	A	R	69	89
PSM	KEWSQHINGASHS	649	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4871	16.812	3	1479.6855	1479.6855	N	R	304	317
PSM	KFASHCLMNHPDLA	650	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=7062	20.092	3	1655.7548	1655.7548	V	K	345	359
PSM	KGHYTEGAELVDSVLDVVR	651	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11252	29.085	3	2086.0695	2086.0695	A	K	103	122
PSM	KHCSQVDSVRGFGG	652	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4	ms_run[2]:scan=6184	18.702	3	1532.7154	1532.7154	S	K	110	124
PSM	KHGDIKCVLNEGMPIY	653	sp|P31689-2|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=9184	23.092	3	1888.9175	1888.9175	V	R	296	312
PSM	KHSEVKAADEDVF	654	sp|Q7Z333-3|SETX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7014	20.014	2	1473.71	1473.7100	P	R	1567	1580
PSM	KHTVDDGLDIR	655	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6576	19.287	2	1267.6521	1267.6521	F	K	904	915
PSM	KHWPFMVVNDAGRP	656	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9963	24.366	3	1652.8246	1652.8246	M	K	88	102
PSM	KIKSDHPGISITDLS	657	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8964	22.797	3	1609.8675	1609.8675	E	K	564	579
PSM	KKHQETMTPAGLSFFQC	658	sp|Q96DV4-2|RM38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=10079	24.619	3	2024.9448	2024.9448	Y	R	121	138
PSM	KKIFGDHPIPQYEVNP	659	sp|Q96CS2|HAUS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9177	23.085	3	1880.9785	1880.9785	L	R	16	32
PSM	KKLHDFQDEIVENSVT	660	sp|Q5VTR2|BRE1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9179	23.087	3	1900.9531	1900.9531	Q	K	856	872
PSM	KKLYTLEEHLSNEMQA	661	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=8174	21.672	3	1948.9564	1948.9564	Q	K	447	463
PSM	KKQLSHPANFGP	662	sp|P82663|RT25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5771	18.086	2	1322.7095	1322.7095	E	R	120	132
PSM	KKVQEFEHVNG	663	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4973	16.969	2	1313.6728	1313.6728	R	R	1504	1515
PSM	KLHELNQKWEAL	664	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9154	23.058	3	1507.8147	1507.8147	A	K	864	876
PSM	KLLQHGINADDK	665	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5286	17.402	3	1350.7256	1350.7256	C	R	865	877
PSM	KNRGFCFLEYEDH	666	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=10058	24.578	3	1713.7569	1713.7569	K	K	189	202
PSM	KNTHCSSLPHYQ	667	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4	ms_run[2]:scan=5053	17.064	3	1470.6674	1470.6674	A	K	817	829
PSM	KQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYES	668	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7471	20.664	4	3508.4464	3508.4464	G	K	773	806
PSM	KRPPSAFFLFCSEH	669	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=10581	26.148	3	1721.8348	1721.8348	P	R	96	110
PSM	KSKGNYDEGFGH	670	sp|A4UGR9-7|XIRP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4881	16.823	3	1337.6	1337.6000	F	K	237	249
PSM	KSTSESFIQHIVSLVHHV	671	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11449	29.936	4	2047.0851	2047.0851	S	K	426	444
PSM	KTHNVHVEIEQ	672	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5165	17.221	2	1332.6786	1332.6786	L	R	590	601
PSM	KVVKTGPSGHNI	673	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4106	15.527	2	1235.6986	1235.6986	Y	R	2592	2604
PSM	KYFLHDDRDDGVDYWA	674	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10292	25.185	3	2013.8857	2013.8857	K	K	672	688
PSM	RAFHNEAQVNPER	675	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4738	16.636	3	1566.7651	1566.7651	L	K	468	481
PSM	RAGMSYYNSPGLHVQHMGTSHGIT	676	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:35	ms_run[2]:scan=7804	21.126	4	2616.1962	2616.1962	T	R	387	411
PSM	RCCHLFSTYVASH	677	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=8462	22.06	3	1636.7239	1636.7239	N	K	167	180
PSM	RDKEVGNLYDMFHT	678	sp|Q9Y3Z3-4|SAMH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=9307	23.249	3	1739.7937	1739.7937	A	R	352	366
PSM	RDTSFEQHVLWHTGG	679	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9448	23.457	3	1768.8281	1768.8281	S	K	1724	1739
PSM	REACANENAHKDF	680	sp|P51114-3|FXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=4213	15.802	2	1560.6739	1560.6739	L	K	53	66
PSM	REESGKPGAHVTV	681	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4463	16.231	3	1365.7001	1365.7001	A	K	99	112
PSM	REHVIDAFRPDVTSSSFQ	682	sp|Q12933-4|TRAF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9890	24.208	3	2090.0181	2090.0181	N	R	415	433
PSM	REQCCYNCGKPGHLA	683	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5036	17.046	3	1848.7818	1848.7818	E	R	77	92
PSM	RFHSPPDKDEAEAPSQ	684	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4749	16.653	3	1809.8282	1809.8282	V	K	148	164
PSM	RGHNTNVGAIVFHP	685	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8811	22.568	3	1517.7851	1517.7851	L	K	269	283
PSM	RGKEAIETQLAEYH	686	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8090	21.552	3	1643.8267	1643.8267	A	K	403	417
PSM	RGVSLTNHHFYDES	687	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7952	21.342	3	1660.7594	1660.7594	P	K	21	35
PSM	RGYPEKIQASLH	688	sp|O95905-2|ECD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6971	19.953	3	1397.7415	1397.7415	I	R	196	208
PSM	RHAATHGPADCSEEVAEV	689	sp|Q96K58|ZN668_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=6179	18.695	3	1934.8541	1934.8541	A	K	39	57
PSM	RHGNQYIQVNEPWK	690	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8777	22.518	3	1767.8805	1767.8805	S	R	713	727
PSM	RHLNDDDVTGSVKSE	691	sp|O75379-2|VAMP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5285	17.401	3	1670.786	1670.7860	K	R	7	22
PSM	RHLSTCDGQNPPK	692	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=3630	14.836	3	1508.7154	1508.7154	K	K	32	45
PSM	RHNEFNPQHSLLVQF	693	sp|Q99717|SMAD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10409	25.54	3	1864.9333	1864.9333	P	R	143	158
PSM	RHSDELTSLLGYFPNK	694	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10930	27.711	3	1875.9479	1875.9479	S	K	419	435
PSM	RIFVNDDRHVMA	695	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=6578	19.29	3	1487.7303	1487.7303	M	K	5	17
PSM	RIGTLEKEHNVFQN	696	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7813	21.138	3	1683.8693	1683.8693	D	K	379	393
PSM	RKAALEAQNALHNM	697	sp|Q92879-5|CELF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=5473	17.671	3	1581.8046	1581.8046	T	K	52	66
PSM	RKITGLCQEEH	698	sp|Q9NVS2-3|RT18A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=4831	16.76	2	1369.6772	1369.6772	P	R	102	113
PSM	RKLQESTQTVQSLHGSS	699	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5557	17.782	3	1884.9654	1884.9654	S	R	459	476
PSM	RLSSFYHHEAGVTALSQDPQ	700	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8731	22.452	3	2242.0767	2242.0767	G	R	116	136
PSM	RMVNHFIAEFK	701	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=8671	22.373	2	1406.7129	1406.7129	N	R	236	247
PSM	RNAHSTAIAGLTFLH	702	sp|Q8NI36|WDR36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10073	24.61	3	1607.8532	1607.8532	M	R	329	344
PSM	RNMSVIAHVDHG	703	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=4903	16.849	3	1350.6463	1350.6463	I	K	20	32
PSM	RNVTKDHIMEIFSTYG	704	sp|Q15287-3|RNPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=10229	24.998	3	1925.9305	1925.9305	T	K	133	149
PSM	RPHPLLVEKGEYCQT	705	sp|Q06587-2|RING1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=7361	20.519	3	1825.9145	1825.9145	F	R	238	253
PSM	RPIRDSSGNLHGYVAEGGA	706	sp|Q8IZ83-3|A16A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7040	20.057	3	1954.9609	1954.9609	S	K	494	513
PSM	RQEAVSMIPPLLLNVRPHH	707	sp|Q08J23-2|NSUN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10797	27.088	4	2206.2157	2206.2157	S	K	125	144
PSM	RQLHDDYFYHDEL	708	sp|Q14257|RCN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9481	23.495	3	1749.7747	1749.7747	G	-	305	318
PSM	RRGHAVPPTLVPLMNGSATPLPTALGLGG	709	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=10859	27.385	4	2865.5647	2865.5647	P	R	179	208
PSM	RSHHAPMSPGSSGGGGQPLA	710	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=4426	16.167	3	1902.8755	1902.8755	Q	R	356	376
PSM	RTIHSYQGQIISHE	711	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6889	19.808	3	1667.838	1667.8380	E	K	406	420
PSM	RVHFEESSKLEDLL	712	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10489	25.795	3	1700.8733	1700.8733	L	R	189	203
PSM	RVLHHMGGMAGLQSMM	713	sp|P61011-2|SRP54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35,9-UNIMOD:35,15-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=4267	15.931	3	1818.7997	1818.7998	P	R	420	436
PSM	RWKNIDDASQMDLFH	714	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=9522	23.557	3	1890.8683	1890.8683	F	R	1075	1090
PSM	RYHEVHYILLDPSCSGSGMPS	715	sp|Q96P11-5|NSUN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=9717	23.866	3	2420.0889	2420.0889	P	R	257	278
PSM	RYPMEHGIVKDWNDME	716	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=8121	21.6	3	2050.8877	2050.8877	I	R	72	88
PSM	KVNHPGSKDQL	717	sp|P80303|NUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3870	15.0834383824	2	1222.650145	1221.646585	P	K	219	230
PSM	RVTSAHKGPDETL	718	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4708	16.595049187733334	3	1409.726503	1409.726292	L	R	298	311
PSM	RLDHDVAAAVSGVYR	719	sp|Q6QNY0|BL1S3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9641	23.745479029600002	3	1628.844687	1627.843053	A	R	119	134
PSM	KKAPKEDVDAAV	720	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4538	16.353663259733334	2	1269.695571	1269.692866	A	K	770	782
PSM	RKGGPGSTLSFVGK	721	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7448	20.634862318133333	2	1389.771739	1389.772848	K	R	105	119
PSM	KRIQEVGEPSKEE	722	sp|Q99442|SEC62_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4069	15.453896215733332	3	1527.789598	1527.789286	K	K	9	22
PSM	RKLDPPGGQFYNSK	723	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7350	20.50478795573333	3	1605.826811	1605.826340	C	R	320	334
PSM	KKKNSIPEPIDPLF	724	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10182	24.888067316266664	3	1624.919948	1624.918844	I	K	617	631
PSM	KKYEDAVRNLTEGL	725	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9927	24.28656098533333	3	1634.853995	1634.862785	D	K	286	300
PSM	KRVSISEGDDKIEY	726	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7756	21.06422389733333	3	1637.827015	1637.826065	E	R	121	135
PSM	KRLCAAAASILGKPAD	727	sp|A6NHG4|DDTL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	4-UNIMOD:4	ms_run[1]:scan=8517	22.138298004	3	1640.902337	1640.903211	E	R	21	37
PSM	RKALEFVTNPDIAAK	728	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8905	22.712235846933332	3	1671.931240	1671.930805	K	K	2730	2745
PSM	RKPVEELTEEEKYV	729	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8924	22.74004191226667	3	1747.899136	1747.899230	Y	R	52	66
PSM	RKALCDPLEEVREAAA	730	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:4	ms_run[1]:scan=9867	24.168422200533332	3	1826.930404	1826.930882	A	K	2011	2027
PSM	KKTKTENPLILIDEVD	731	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10573	26.118338378666667	3	1855.030184	1855.030245	L	K	578	594
PSM	KKIEQELTAAK	732	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5256	17.354544357333335	2	1257.730953	1257.729252	E	K	45	56
PSM	RKLLTEKDAQIAMMQQ	733	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=6654	19.411403549333333	3	1934.991799	1934.991768	N	R	241	257
PSM	KKLKTEDSLMPEEEFL	734	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10397	25.50842155546667	3	1935.986422	1935.986331	S	R	683	699
PSM	KKGRPMVISSGMQSMDTM	735	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	6-UNIMOD:35,12-UNIMOD:35,15-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=4084	15.474914836	3	2046.920209	2046.920654	A	K	148	166
PSM	RRPQVPIKYQQITPVNQS	736	sp|Q9NYL2|M3K20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8346	21.90996403573333	3	2151.191733	2151.191271	V	R	616	634
PSM	KARPEYMLPVHFYG	737	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=10014	24.475	3	1722.8552	1722.8552	E	R	192	206
PSM	KEGAKHFSGLEEAVY	738	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8657	22.356	3	1663.8206	1663.8206	L	R	16	31
PSM	KENGFTQHVYH	739	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5723	18.022	3	1358.6367	1358.6367	L	K	804	815
PSM	KFLSHLVDGVK	740	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8846	22.621	3	1241.7132	1241.7132	A	R	302	313
PSM	KGPLLVSTESHPVKSGIH	741	sp|Q9Y3A4|RRP7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6726	19.525	4	1885.0421	1885.0421	L	K	136	154
PSM	KHSSGCAFLSVK	742	sp|O15392-5|BIRC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4	ms_run[2]:scan=7034	20.048	3	1319.6656	1319.6656	K	K	79	91
PSM	KHVPGGGNVQIQNK	743	sp|P27816-4|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4179	15.719	3	1474.8005	1474.8005	I	K	735	749
PSM	KIAGYVTHLMK	744	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8495	22.11	3	1259.706	1259.7060	N	R	49	60
PSM	KIHPVDKLTIQGL	745	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9604	23.687	3	1460.8715	1460.8715	N	K	717	730
PSM	KIRDLEFCLEEH	746	sp|Q86W92-5|LIPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:4	ms_run[2]:scan=9792	24.02	3	1587.7715	1587.7715	E	R	133	145
PSM	KIRGIVEESVTGVH	747	sp|O43865-2|SAHH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8042	21.482	3	1522.8467	1522.8467	K	R	200	214
PSM	KKAVDQHNAEAQDIFG	748	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7873	21.222	3	1769.8697	1769.8697	R	K	520	536
PSM	KKGVQLQTHPNVD	749	sp|P48444-2|COPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5078	17.103	3	1462.7892	1462.7892	D	K	234	247
PSM	KKHSQFIGYPITLFVE	750	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11226	28.976	3	1906.0353	1906.0353	V	K	208	224
PSM	KKITDGLHALQEASN	751	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8493	22.109	3	1623.858	1623.8580	V	K	353	368
PSM	KKLIQESDQHL	752	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5858	18.21	2	1337.7303	1337.7303	S	K	1013	1024
PSM	KKLMHQAALLGQALQDS	753	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35	ms_run[2]:scan=8969	22.805	3	1866.9986	1866.9986	P	R	29	46
PSM	KKLYGAQFHPEVGLTENG	754	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8946	22.774	3	1987.0163	1987.0163	S	K	83	101
PSM	KKSAEFLLHML	755	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35	ms_run[2]:scan=9532	23.572	2	1331.7271	1331.7271	P	K	85	96
PSM	KLQLHESQKDY	756	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5764	18.07	3	1387.7096	1387.7096	E	K	255	266
PSM	KRFATSEELLSHL	757	sp|Q9H7S9|ZN703_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10230	25	3	1529.8202	1529.8202	D	R	469	482
PSM	KRVLIAAHGNSL	758	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6513	19.191	3	1277.7568	1277.7568	G	R	179	191
PSM	KTEWLDGKHVVFG	759	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9548	23.593	3	1514.7882	1514.7882	A	K	118	131
PSM	KTHTDSIKDNSSF	760	sp|O60573-2|IF4E2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5313	17.434	3	1478.7001	1478.7001	Y	R	215	228
PSM	KTQIKLCEACPMHSLH	761	sp|O60343-2|TBCD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7880	21.232	4	1951.943	1951.9430	A	K	447	463
PSM	KVKDAYLVHLIQ	762	sp|Q9Y6V7-2|DDX49_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9774	23.987	3	1425.8344	1425.8344	E	R	122	134
PSM	KYFHPPAHLQA	763	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7603	20.836	2	1307.6775	1307.6775	C	K	167	178
PSM	RAHSPALGVHSFSGVQ	764	sp|Q9H1A4|APC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8041	21.481	3	1648.8434	1648.8434	S	R	352	368
PSM	RAINEAYKEDYH	765	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5585	17.829	3	1507.7056	1507.7056	I	K	439	451
PSM	RAQHEDQVEQYK	766	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4012	15.347	3	1529.7223	1529.7223	L	K	150	162
PSM	RAVFVDLEPTVIDEVRTGTY	767	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11259	29.115	3	2279.1798	2279.1798	P	R	29	49
PSM	RDAESIHQYLLQR	768	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8837	22.606	3	1627.8431	1627.8431	K	K	820	833
PSM	RDKEVGNLYDMFHT	769	sp|Q9Y3Z3-4|SAMH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10517	25.901	3	1723.7988	1723.7988	A	R	352	366
PSM	RDNTSVYHISGK	770	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5303	17.423	2	1375.6844	1375.6844	C	K	191	203
PSM	REHFQSYDLDHME	771	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=7303	20.44	3	1721.7104	1721.7104	L	K	104	117
PSM	REHFQSYDLDHME	772	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8648	22.342	3	1705.7155	1705.7155	L	K	104	117
PSM	REHNSILETALAK	773	sp|Q08378-2|GOGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8878	22.673	3	1480.7998	1480.7998	L	R	1132	1145
PSM	REHPFLVKGGEDL	774	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8555	22.207	3	1495.7783	1495.7783	E	R	3746	3759
PSM	REKLHAVNAEECNVLQG	775	sp|O75521-2|ECI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=7685	20.962	3	1965.9691	1965.9691	E	R	322	339
PSM	RELCHTQSSHASL	776	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4	ms_run[2]:scan=4634	16.487	3	1524.7103	1524.7103	S	R	456	469
PSM	RESMFGYHGHGPSPFL	777	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35	ms_run[2]:scan=9584	23.657	3	1833.8257	1833.8257	S	R	195	211
PSM	RETAQAIKGMHI	778	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7798	21.118	3	1353.7187	1353.7187	T	R	30	42
PSM	REVPEYLHHVN	779	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6572	19.281	3	1391.6946	1391.6946	E	K	212	223
PSM	RFHWEQDQIAHM	780	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=8405	21.983	3	1612.7205	1612.7205	K	K	327	339
PSM	RFIKTPEYLHIDQ	781	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9496	23.516	3	1658.878	1658.8780	F	R	543	556
PSM	RFQSSHHPTDITSLDQYVE	782	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9878	24.19	3	2259.0556	2259.0556	L	R	511	530
PSM	RFSQWLDDHPSEKD	783	sp|Q9UP83-3|COG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8814	22.573	3	1758.7962	1758.7962	T	R	804	818
PSM	RGEHVALANWQNHASL	784	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9241	23.163	3	1801.8972	1801.8972	K	R	466	482
PSM	RGITGVEDKESWHG	785	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7304	20.442	3	1569.7536	1569.7536	G	K	246	260
PSM	RHDSGLDSMKDEEYEQMV	786	sp|P25963|IKBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=7069	20.105	3	2199.9049	2199.9049	D	K	29	47
PSM	RHPYLPINSAAIKAECTA	787	sp|Q13330-3|MTA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:4	ms_run[2]:scan=9138	23.039	3	2011.0309	2011.0309	A	R	480	498
PSM	RHSIQHVPGDIEQTSQE	788	sp|Q8TEU7-6|RPGF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6454	19.091	3	1959.9399	1959.9399	N	K	642	659
PSM	RHSVIQNGKENSTIPDQ	789	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5377	17.51	3	1921.9606	1921.9606	D	R	439	456
PSM	RIHNLTAYLQTLH	790	sp|Q9H270|VPS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10224	24.985	3	1578.8631	1578.8631	Q	R	432	445
PSM	RISSSQQHPHL	791	sp|P21359-2|NF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4863	16.802	3	1288.6636	1288.6636	Q	R	2562	2573
PSM	RKDYINAYSHTMSEYG	792	sp|Q9P2W9|STX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=7625	20.864	3	1949.8578	1949.8578	H	R	71	87
PSM	RKETSGTQGIEGHL	793	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6187	18.705	3	1511.7692	1511.7692	P	K	351	365
PSM	RKISSDLDGHPVP	794	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7128	20.19	3	1419.747	1419.7470	L	K	101	114
PSM	RKLTDIINNDHENV	795	sp|Q8N335|GPD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8757	22.489	3	1679.8591	1679.8591	G	K	50	64
PSM	RKYTLFSASSEGQNHS	796	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7633	20.877	3	1810.8598	1810.8598	R	R	319	335
PSM	RLGHAEQKDEMVP	797	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=4821	16.746	2	1524.7355	1524.7355	G	R	361	374
PSM	RLHDIETENQKL	798	sp|Q13948-9|CASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6736	19.54	3	1494.7791	1494.7791	Q	R	81	93
PSM	RLSEHATAPTRGSA	799	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3874	15.088	2	1452.7433	1452.7433	A	R	30	44
PSM	RLSSVVTQHDSK	800	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4619	16.472	3	1355.7157	1355.7157	Y	K	135	147
PSM	RLVNHFVEEFK	801	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9196	23.108	3	1416.7514	1416.7514	N	R	236	247
PSM	RNHDHQEIAVPVANL	802	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9305	23.246	3	1711.8754	1711.8754	A	K	87	102
PSM	RNHDHQEIAVPVANL	803	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9314	23.26	2	1711.8754	1711.8754	A	K	87	102
PSM	RNHEGDEDDSHV	804	sp|Q9UNE7-2|CHIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3530	14.73	3	1408.5603	1408.5603	Q	R	110	122
PSM	RPHEGPGGGMGSGH	805	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35	ms_run[2]:scan=3289	14.412	3	1347.5738	1347.5738	H	R	768	782
PSM	RPHSIDGRVVEP	806	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6359	18.957	3	1360.7211	1360.7211	A	K	82	94
PSM	RPKCGFCHVGEEENEA	807	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5618	17.875	3	1917.8098	1917.8098	T	R	175	191
PSM	RQKVDNFVSTHLD	808	sp|Q96IK1|BOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8062	21.517	3	1557.79	1557.7900	L	K	86	99
PSM	RQSLSHMLSAKLEEE	809	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=8190	21.691	3	1772.8727	1772.8727	C	K	636	651
PSM	RRDQMEGSPNSSESFEHIA	810	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35	ms_run[2]:scan=7437	20.62	3	2191.9553	2191.9553	M	R	529	548
PSM	RREPWLLPSQHNDII	811	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10351	25.358	3	1872.9959	1872.9959	G	R	683	698
PSM	RSKTFPACDGSHN	812	sp|Q8N5K1|CISD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:4	ms_run[2]:scan=3915	15.159	3	1475.6576	1475.6576	W	K	103	116
PSM	RSNDLFPVHHLDNNEFCPGDFVVDK	813	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:4	ms_run[2]:scan=10696	26.614	4	2970.3719	2970.3719	I	R	569	594
PSM	RTADGIVSHLK	814	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6549	19.25	2	1195.6673	1195.6673	P	K	119	130
PSM	RTLFGLHLSQK	815	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9459	23.469	3	1298.7459	1298.7459	V	R	378	389
PSM	RTLPHGAGHLAFSQ	816	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7570	20.793	3	1490.7742	1490.7742	T	R	398	412
PSM	RTLVVHEKADDLG	817	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6096	18.592	3	1451.7732	1451.7732	G	K	116	129
PSM	RTPGLHGDCDDDKY	818	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4	ms_run[2]:scan=5425	17.591	3	1647.6947	1647.6947	D	R	222	236
PSM	RTYEEGLKHEANNPQL	819	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7578	20.801	3	1897.9282	1897.9282	K	K	93	109
PSM	RVHQVTPQTHFIS	820	sp|Q9GZP4-2|PITH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7083	20.129	3	1548.8161	1548.8161	H	-	198	211
PSM	RVKDDIESLHD	821	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6567	19.273	3	1325.6575	1325.6575	Q	K	611	622
PSM	RVRPDYTAQNLDHG	822	sp|P82930|RT34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6073	18.565	3	1640.8019	1640.8019	T	K	99	113
PSM	RVTSAHKGPDETL	823	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4623	16.475	3	1409.7263	1409.7263	L	R	298	311
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPH	824	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4703	16.5876034152	4	3250.363243	3249.380434	K	K	60	97
PSM	KKSAEFLLHML	825	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10586	26.16381296693333	3	1315.731769	1315.732229	P	K	85	96
PSM	RLHQIKQEEGMDLIN	826	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:35	ms_run[1]:scan=7177	20.26233961333333	3	1839.948991	1838.930882	S	R	84	99
PSM	RCLALATHDNPLR	827	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4	ms_run[1]:scan=7727	21.017967864533333	3	1535.777243	1535.799080	L	R	559	572
PSM	RLVFHTQLAHGSPTG	828	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8021	21.44285259626667	3	1619.836197	1619.853224	P	R	57	72
PSM	KKIAPYVAHNFS	829	sp|P11498|PYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7008	20.004347510666665	3	1374.751873	1373.745571	L	K	588	600
PSM	KHNFLQAHNGQGL	830	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7413	20.587341589333334	3	1463.748651	1462.742945	S	R	1602	1615
PSM	RKEGTSVLEHTSDGFPEN	831	sp|Q8TED0|UTP15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7749	21.053788479466668	3	2002.941992	2001.939198	R	K	496	514
PSM	KIWHYTGSILH	832	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9141	23.043698329599998	3	1354.722001	1353.719356	Y	K	388	399
PSM	KKAATALKDVV	833	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6199	18.716714333600002	2	1142.702682	1142.702309	W	K	66	77
PSM	KKLMSDNGVRVQ	834	sp|Q96I99|SUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	4-UNIMOD:35	ms_run[1]:scan=3914	15.157977851733333	3	1389.739590	1389.739834	S	R	46	58
PSM	RKALDDMISTLK	835	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9404	23.3900001176	3	1389.764653	1389.764985	Y	K	127	139
PSM	KKQKTEDEVLTS	836	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4449	16.199889417866665	2	1404.747169	1404.746024	A	K	134	146
PSM	KKNAAIAVLEELK	837	sp|O95793|STAU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10262	25.105597088000003	3	1425.855966	1425.855515	S	K	238	251
PSM	RKYTELQLEAAK	838	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7120	20.17759442906667	3	1448.797740	1448.798728	R	R	836	848
PSM	RKVSSAEGAAKEEP	839	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3690	14.894681220533332	3	1457.750841	1457.747421	K	K	4	18
PSM	KRLLLQLEATKNS	840	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8694	22.40747539866667	3	1512.899828	1512.898777	A	K	175	188
PSM	RKQALEQYEEVK	841	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6223	18.7533662248	2	1519.798909	1519.799457	E	K	510	522
PSM	RKQEESVQKQEAM	842	sp|Q9NVI7|ATD3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:35	ms_run[1]:scan=3362	14.504090036533334	3	1605.779051	1605.778070	L	R	205	218
PSM	KKLEELELDEQQR	843	sp|Q02750|MP2K1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7634	20.879216783733334	3	1656.870395	1656.868265	Q	K	35	48
PSM	RKGEFETGFEKGGQT	844	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6537	19.229583846666667	3	1669.805901	1669.805999	A	R	186	201
PSM	RKDLDNAEEKADALN	845	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5967	18.396601996266668	3	1700.835180	1700.832942	L	K	871	886
PSM	KRAAEDDEDDDVDTK	846	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3566	14.776607026666666	3	1720.738406	1720.738767	G	K	89	104
PSM	RKIEQVDKEDEITE	847	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5842	18.186409602933335	3	1730.867735	1730.868659	K	K	443	457
PSM	RKTLYNNQPIDFLK	848	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9804	24.043208338933333	3	1748.956343	1748.957354	G	K	296	310
PSM	RRESATADAGYAILEK	849	sp|P98175|RBM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8244	21.764817150933332	3	1749.899959	1749.900962	E	K	684	700
PSM	KKKAEGTVFTEEDFQ	850	sp|Q86WX3|AROS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8497	22.111821197066668	3	1755.869789	1755.867930	K	K	113	128
PSM	RKPELWSDDFTDFVK	851	sp|Q13188|STK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10855	27.363018113866666	3	1881.926551	1881.926114	F	K	242	257
PSM	KKKPCSETSQIEDTPSS	852	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	5-UNIMOD:4	ms_run[1]:scan=4379	16.09577774	3	1920.909931	1920.909872	S	K	63	80
PSM	RKVENEDMNKDQILLE	853	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	8-UNIMOD:35	ms_run[1]:scan=7609	20.842427585333333	3	1988.982742	1988.983706	G	K	309	325
PSM	KKPRPPPALGPEETSASAGLP	854	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8736	22.459656262933333	3	2099.136388	2099.137504	K	K	14	35
PSM	KMKGTLIDNQFK	855	sp|Q9H5V9|CX056_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:35	ms_run[1]:scan=6805	19.6664872672	2	1437.764975	1437.764986	A	-	211	223
PSM	RKEDLFGRPSQGLYSSSASSG	856	sp|O95071|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8672	22.374721504	3	2228.083615	2228.082174	A	K	2062	2083
PSM	KARAHGLEVEPSALEQGF	857	sp|Q9BSH5|HDHD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9905	24.239	3	1937.9959	1937.9959	T	R	32	50
PSM	KEHELLEQQK	858	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4481	16.257	3	1280.6725	1280.6725	L	R	173	183
PSM	KEMITMLHYDLLHHPYEPSGN	859	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=10138	24.775	3	2540.1828	2540.1828	K	K	577	598
PSM	KFHFGDSLCTH	860	sp|O75439|MPPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=8590	22.254	3	1347.603	1347.6030	A	K	257	268
PSM	KFYEEVHDLER	861	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8282	21.811	3	1463.7045	1463.7045	A	K	53	64
PSM	KGDSPLHSIRWL	862	sp|Q14527-2|HLTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10401	25.518	3	1407.7623	1407.7623	T	R	419	431
PSM	KGKITFADFH	863	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8544	22.193	2	1162.6135	1162.6135	E	R	468	478
PSM	KGLDYLHSEK	864	sp|Q9P289-2|STK26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6474	19.115	2	1188.6139	1188.6139	L	K	53	63
PSM	KHHPEDVEPAL	865	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6338	18.923	2	1270.6306	1270.6306	T	R	85	96
PSM	KHPSKPDPSGECNPDL	866	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4	ms_run[2]:scan=5148	17.201	3	1776.8101	1776.8101	T	R	121	137
PSM	KHQTNISELK	867	sp|Q9Y2J2-3|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4580	16.411	2	1196.6513	1196.6513	M	R	549	559
PSM	KIAGYVTHLMK	868	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=6811	19.676	3	1275.7009	1275.7009	N	R	49	60
PSM	KIAHLAGVKDQLT	869	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7358	20.514	3	1392.8089	1392.8089	S	K	1563	1576
PSM	KIHLVNLTGLK	870	sp|O00411|RPOM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9465	23.477	3	1234.7761	1234.7761	L	K	842	853
PSM	KIHQHILPQGQGMLSGIG	871	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:35	ms_run[2]:scan=8682	22.391	3	1929.0255	1929.0255	G	R	239	257
PSM	KIISKIENHEGV	872	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6452	19.087	2	1365.7616	1365.7616	I	R	251	263
PSM	KIKGEHPGLSIGDVA	873	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8264	21.792	3	1519.8358	1519.8358	P	K	112	127
PSM	KIRDAYTHPQFVTDVM	874	sp|P61221|ABCE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9820	24.071	3	1919.9564	1919.9564	E	K	431	447
PSM	KKDIHFMPCSGLTGANL	875	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=9933	24.304	3	1887.9335	1887.9335	P	K	253	270
PSM	KKFGQYAGHVVPTILE	876	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9768	23.978	3	1785.9778	1785.9778	R	K	353	369
PSM	KKHSQFIGYPITLFVE	877	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11143	28.64	3	1906.0353	1906.0353	V	K	208	224
PSM	KKVTHAVVTVPAYFNDAQ	878	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9202	23.116	3	1987.0527	1987.0527	G	R	163	181
PSM	KLCTSYSHSSTRDG	879	sp|O95249|GOSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=3992	15.311	3	1597.7155	1597.7155	S	R	32	46
PSM	KLHSLIGLGIKN	880	sp|Q76FK4-4|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9089	22.979	3	1291.7976	1291.7976	H	R	347	359
PSM	KLNGHQLENHAL	881	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6360	18.958	3	1372.7211	1372.7211	M	K	138	150
PSM	KMLQHEPDRAFYGL	882	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9550	23.596	3	1703.8454	1703.8454	Y	K	283	297
PSM	KNREQDHASDAYTALLSSVLQ	883	sp|Q07864|DPOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11184	28.803	4	2345.1612	2345.1612	K	R	176	197
PSM	KNTHATTHNAYDLEVIDIF	884	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11002	28.056	3	2201.0753	2201.0753	V	K	819	838
PSM	KPGFYHGHVSYLDFA	885	sp|Q7LGA3-3|HS2ST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10232	25.007	3	1736.8311	1736.8311	M	K	135	150
PSM	KPIRNLNGHSIGQY	886	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7085	20.133	3	1595.8532	1595.8532	V	R	300	314
PSM	KPRGYAFIEYEHE	887	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8887	22.686	3	1637.7838	1637.7838	G	R	142	155
PSM	KRHLANMMGEDPETFTQEDID	888	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=8289	21.82	3	2508.0897	2508.0897	G	R	85	106
PSM	KSGAHVDFYDK	889	sp|P35270|SPRE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5925	18.335	3	1265.6041	1265.6041	F	-	251	262
PSM	KSHVEKLDNQVS	890	sp|Q9Y2D8-2|ADIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4104	15.518	2	1382.7154	1382.7154	L	K	350	362
PSM	KSTLRDQINSDH	891	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4857	16.795	3	1412.7008	1412.7008	K	R	30	42
PSM	KSVGKIEHSFW	892	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8909	22.718	3	1316.6877	1316.6877	I	R	374	385
PSM	KSYSFHQSQH	893	sp|Q8NEY8-5|PPHLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4281	15.953	2	1247.5683	1247.5683	S	R	112	122
PSM	KTFNLEKQNHTP	894	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5788	18.126	3	1455.747	1455.7470	N	R	5	17
PSM	KTKQQHQEQQALQQSTTA	895	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4279	15.95	3	2082.0454	2082.0454	D	K	485	503
PSM	KTQIKLCEACPMHSLH	896	sp|O60343-2|TBCD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=6463	19.101	4	1967.938	1967.9380	A	K	447	463
PSM	KVHAYIISSLK	897	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8271	21.798	3	1257.7445	1257.7445	A	K	305	316
PSM	KVKLLHGGVAVSS	898	sp|Q9UBF8-2|PI4KB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6844	19.732	2	1293.7769	1293.7769	E	R	58	71
PSM	KVRAWGPGLHGGIVG	899	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8870	22.66	3	1502.847	1502.8470	Q	R	382	397
PSM	KWVPEITHHCP	900	sp|P60953-1|CDC42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=7662	20.925	3	1402.6816	1402.6816	E	K	96	107
PSM	KYHNVGLSKCEI	901	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=6987	19.975	3	1446.7289	1446.7289	K	K	224	236
PSM	KYHSDDYIKFL	902	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10211	24.956	3	1427.7085	1427.7085	T	R	66	77
PSM	KYNHPQGFFSH	903	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7534	20.744	3	1360.6313	1360.6313	F	R	672	683
PSM	RAIQGGTSHHLGQNFS	904	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5819	18.159	3	1708.8394	1708.8394	G	K	1234	1250
PSM	RALEHFTDLYDIK	905	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10076	24.614	3	1619.8308	1619.8308	Q	R	625	638
PSM	RAWPHDTIGSLK	906	sp|Q9BVT8|TMUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8046	21.485	3	1379.731	1379.7310	A	R	118	130
PSM	RCHQGPIKPYQQG	907	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=4447	16.197	3	1567.7678	1567.7678	R	R	20	33
PSM	RCKELGITALHI	908	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=9811	24.057	3	1409.7813	1409.7813	Q	K	84	96
PSM	RDLAQYDAAHHEEF	909	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7983	21.388	3	1700.7543	1700.7543	T	K	163	177
PSM	REDSARPGAHA	910	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3334	14.467	3	1165.5588	1165.5588	S	K	85	96
PSM	RELHLEGNFLH	911	sp|Q8TCA0|LRC20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9234	23.153	3	1363.6997	1363.6997	L	R	77	88
PSM	RETAQAIKGMHI	912	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=5218	17.3	3	1369.7136	1369.7136	T	R	30	42
PSM	RFEGNFVHGEKNG	913	sp|Q8WTS6|SETD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6037	18.49	3	1489.7062	1489.7062	D	R	35	48
PSM	RFHMDSETHDPIDLQT	914	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9318	23.267	3	1940.8687	1940.8687	V	K	608	624
PSM	RGHLSRPEAQSLSPYTTSAN	915	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7481	20.677	4	2171.0719	2171.0719	S	R	250	270
PSM	RGKQMEDGHTLFDYEV	916	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35	ms_run[2]:scan=9781	23.999	3	1939.8734	1939.8734	Y	R	48	64
PSM	RHEMPPHIYAITDTAY	917	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=9152	23.055	3	1929.9043	1929.9043	K	R	143	159
PSM	RHLQLAIRNDEELN	918	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8278	21.806	4	1719.9016	1719.9016	P	K	82	96
PSM	RHVDNIMFENHTVAD	919	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8539	22.187	3	1796.8264	1796.8264	Y	R	221	236
PSM	RIAIVNHDKC	920	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=4582	16.413	2	1224.6397	1224.6397	T	K	7	17
PSM	RIAVHHNSVEDVPEE	921	sp|Q9UKY1|ZHX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6176	18.692	3	1729.8384	1729.8384	K	K	195	210
PSM	RIHFPLATYAPVISAE	922	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11020	28.138	3	1783.9621	1783.9621	P	K	229	245
PSM	RIHVLEAQDLIAKD	923	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9646	23.755	3	1619.8995	1619.8995	L	R	650	664
PSM	RILQEHEQIK	924	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5089	17.124	3	1292.7201	1292.7201	E	K	589	599
PSM	RIQHVVEAVRQE	925	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5810	18.149	3	1462.8005	1462.8005	E	K	1556	1568
PSM	RITHQIVDRPGQQTSVIG	926	sp|O00541-2|PESC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7352	20.507	3	2004.0865	2004.0865	S	R	367	385
PSM	RKEPVDEDLYPEHY	927	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8361	21.927	3	1788.8319	1788.8319	P	R	624	638
PSM	RKLDPELHLDI	928	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9955	24.35	3	1347.751	1347.7510	L	K	185	196
PSM	RLDNLTCHLLK	929	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4	ms_run[2]:scan=9097	22.988	3	1381.75	1381.7500	D	K	3302	3313
PSM	RLHDEKEETAGSYDS	930	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4156	15.655	3	1735.7649	1735.7649	K	R	188	203
PSM	RLNVDFALIHKE	931	sp|P60891-2|PRPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9957	24.353	3	1453.8041	1453.8041	D	R	117	129
PSM	RLQPHPQLSPEIR	932	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7399	20.567	3	1569.874	1569.8740	L	R	406	419
PSM	RMHTTFEHDIQALGTQV	933	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=10120	24.719	3	1998.9582	1998.9582	Q	R	1831	1848
PSM	RNDGALYHNNEEKN	934	sp|Q5W111-2|SPRY7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3953	15.219	3	1672.7554	1672.7554	M	R	64	78
PSM	RNGDDGTHDKGL	935	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3723	14.927	3	1283.5854	1283.5854	E	K	891	903
PSM	RNNPSKPLHVI	936	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6171	18.687	3	1273.7255	1273.7255	D	K	166	177
PSM	RQADVFPDRDHFG	937	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8351	21.917	3	1558.7277	1558.7277	P	R	180	193
PSM	RQFPVTVHFNK	938	sp|Q8IY37|DHX37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8557	22.209	3	1371.7412	1371.7412	S	R	435	446
PSM	RQHLSSVVFIKN	939	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8154	21.645	3	1426.8045	1426.8045	I	R	156	168
PSM	RQHSSQDVHVVL	940	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7127	20.188	3	1403.727	1403.7270	K	K	173	185
PSM	RQKGYEEEIIHF	941	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9767	23.976	3	1547.7732	1547.7732	G	K	938	950
PSM	RQLYVLGHEAMK	942	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=7193	20.291	3	1459.7606	1459.7606	S	R	17	29
PSM	RRPSQNAISFFNVGHS	943	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9883	24.196	3	1815.9129	1815.9129	Q	K	186	202
PSM	RSASASHQADIKEA	944	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3689	14.894	3	1469.7223	1469.7223	R	R	96	110
PSM	RSFFHQHYLGGQEPTPSNI	945	sp|P46379-4|BAG6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9391	23.373	3	2214.0606	2214.0606	L	R	654	673
PSM	RSKEELHQDCLVLATA	946	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=8491	22.105	3	1868.9414	1868.9414	H	K	858	874
PSM	RSMGFIGHYLDQK	947	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=8911	22.722	3	1566.7613	1566.7613	G	R	794	807
PSM	RTHLTEDTPKVNADIE	948	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7393	20.56	3	1837.917	1837.9170	A	K	15	31
PSM	RTLPHFIKDDYGPES	949	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8894	22.696	3	1773.8686	1773.8686	H	R	805	820
PSM	RTVKHFSTEDGIFQGQ	950	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8384	21.96	3	1848.9119	1848.9119	D	R	65	81
PSM	RTVKHPTLLQDPDL	951	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8948	22.776	3	1631.8995	1631.8995	Q	R	128	142
PSM	RVANPKDIIHFF	952	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10688	26.585	3	1455.7987	1455.7987	D	R	388	400
PSM	RVLLQHVHEGYE	953	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7039	20.054	3	1478.763	1478.7630	R	K	537	549
PSM	RVVDLMAHMASKE	954	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=7209	20.313	3	1501.7381	1501.7381	N	-	281	294
PSM	RVVPGYGHAVLR	955	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6941	19.908	3	1322.7571	1322.7571	G	K	340	352
PSM	RVWEDGEHPAK	956	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4706	16.593	3	1322.6367	1322.6367	D	K	29	40
PSM	RYHTSQSGDEMTSLSEYVS	957	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=8783	22.526	3	2191.9328	2191.9328	L	R	456	475
PSM	RYPHLGQKPGGSDFL	958	sp|P56211-2|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9197	23.11	3	1670.8529	1670.8529	A	R	19	34
PSM	RYQDIIHSIHLA	959	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10408	25.535	3	1464.7837	1464.7837	K	R	1020	1032
PSM	KDKADFCIIHYAG	960	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4	ms_run[1]:scan=9360	23.326496384266665	3	1537.743003	1536.739499	L	K	570	583
PSM	KRGFGFVTFDDHD	961	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28		ms_run[1]:scan=10067	24.5980295848	3	1539.7100	1539.7101	K	P	152	165
PSM	KPQNQGGYGVSSSSSSYGSGR	962	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3792	14.996924478399999	3	2090.934749	2088.946074	A	R	298	319
PSM	KDHQNGSMAAVNGHTNSFSPLENNVKP	963	sp|Q9NYP7|ELOV5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:35	ms_run[1]:scan=8378	21.950686863999998	4	2909.335953	2908.352218	L	R	267	294
PSM	RLHLESMLLETGH	964	sp|Q9BW66|CINP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10345	25.33719973466667	3	1534.799448	1534.792597	S	R	197	210
PSM	KAKGHSLSDGLEEVQ	965	sp|O75431|MTX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7261	20.3709179632	3	1596.811775	1596.810750	V	K	93	108
PSM	KSVGKIEHSFW	966	sp|Q16531|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8906	22.713492151466667	3	1316.688172	1316.687721	I	R	1063	1074
PSM	KKPAAATVTK	967	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3308	14.433509492	2	1013.623669	1013.623330	A	K	159	169
PSM	KKLEDNPKSL	968	sp|Q05639|EF1A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4690	16.5692555728	2	1170.661928	1170.660838	G	K	385	395
PSM	KKLLADQAEAR	969	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4435	16.1808331144	3	1241.708279	1241.709185	R	R	152	163
PSM	KRLDYITAEIK	970	sp|O15212|PFD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8472	22.074344613599997	3	1348.772499	1348.771451	G	R	78	89
PSM	KRNEIDAEPPAK	971	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4081	15.470377818666666	3	1366.721605	1366.720478	P	R	20	32
PSM	KEKYGINTDPPK	972	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5522	17.7340895776	3	1388.731213	1388.729980	L	-	114	126
PSM	RKLVSAVVEYGGK	973	sp|Q9NRW7|VPS45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7396	20.562929512533334	3	1404.814337	1404.808899	Y	R	420	433
PSM	RKEAADPLASKLN	974	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6436	19.06814753946667	3	1411.777657	1411.778327	Q	K	702	715
PSM	RKMVNDAEPDTK	975	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35	ms_run[1]:scan=3424	14.5815776536	3	1418.682935	1418.682378	K	K	115	127
PSM	KKYMEENDQLK	976	sp|P51572|BAP31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:35	ms_run[1]:scan=3809	15.0155116384	3	1440.692982	1440.691880	A	K	148	159
PSM	KKFAEQDAKEEAN	977	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3674	14.8793521704	3	1506.734162	1506.731437	F	K	414	427
PSM	KRDSVLTSKNQIE	978	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5423	17.587655087466665	3	1516.821539	1516.820920	E	R	32	45
PSM	RKLIVAYVDDLDR	979	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9845	24.119274681866667	3	1574.877774	1574.878041	R	R	1068	1081
PSM	RKQPPKEPSEVPTP	980	sp|P17096-2|HMGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5742	18.0432459928	3	1588.858043	1588.857306	P	K	30	44
PSM	RKGVAINFVKNDDI	981	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8988	22.83729574053333	3	1589.855773	1587.873290	G	R	373	387
PSM	RKLEAMTNSKQSIA	982	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:35	ms_run[1]:scan=4282	15.958774138133332	3	1591.836022	1591.835191	A	K	372	386
PSM	RKGVAINMVTEEDK	983	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:35	ms_run[1]:scan=5306	17.426664468800002	3	1604.818647	1604.819206	G	R	368	382
PSM	RKESYSVYVYKVL	984	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10000	24.448762046666666	3	1632.887797	1632.887543	S	K	34	47
PSM	KKEGDKSQSAEIWE	985	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7147	20.217035701066667	2	1633.797459	1633.794765	G	K	342	356
PSM	KKLGEMWSEQSAKD	986	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7425	20.604729145866667	3	1635.794967	1635.792657	A	K	127	141
PSM	RKIAAQLLQQEQKN	987	sp|Q5VUJ6|LRCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7124	20.183971337333332	3	1666.948033	1666.947852	L	R	474	488
PSM	RKVLGDLIFNQPDR	988	sp|Q8WVC6|DCAKD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9915	24.261715292	3	1669.926339	1669.926389	N	R	66	80
PSM	RKDYTSGAMLTGELK	989	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:35	ms_run[1]:scan=7459	20.649603905333333	3	1684.845752	1684.845421	I	K	417	432
PSM	RKLPSDVNEGKTVFI	990	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8929	22.7465564736	3	1701.942191	1701.941370	K	R	325	340
PSM	RKVLISDSLDPCCR	991	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=8373	21.944555512266668	3	1717.861529	1717.860360	L	K	7	21
PSM	KKKPFVYTQGQAVLN	992	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7836	21.17366081546667	3	1719.969290	1719.967191	G	R	161	176
PSM	RKVVGCSCVVVKDYG	993	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=6890	19.80890297386667	3	1724.867334	1724.870196	P	K	101	116
PSM	KKKNPEVPVNFAEFS	994	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9812	24.058898063733334	3	1732.914583	1732.914821	H	K	28	43
PSM	KRAESMLQQADKLGC	995	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=6002	18.439547363466666	3	1749.850146	1749.850189	L	R	335	350
PSM	KKLEDGPKFL	996	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7930	21.308599410133336	2	1173.675833	1173.675760	G	K	385	395
PSM	KKADFSTKDIYQDLN	997	sp|P43246|MSH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9306	23.247815827466663	3	1784.894283	1784.894479	R	R	228	243
PSM	KKKSGPPAPEEEEEEE	998	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3987	15.299005697866667	3	1811.843365	1811.842503	S	R	1316	1332
PSM	RKTLTTVQGIADDYDK	999	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8569	22.224729245333332	3	1822.938814	1822.942492	G	K	41	57
PSM	RKDVEVTKEEFVLAAQ	1000	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9222	23.14085397386667	3	1860.995716	1860.994528	T	K	244	260
PSM	RKNEGVIEFVSYSDMK	1001	sp|Q08170|SRSF4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:35	ms_run[1]:scan=9407	23.394393958933332	3	1916.929035	1916.930213	G	R	139	155
PSM	KKVCSTNDLKELLIFN	1002	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:4	ms_run[1]:scan=10738	26.8032899832	3	1921.035403	1921.034284	L	K	253	269
PSM	RKGTDIMYTGTLDCWR	1003	sp|P05141|ADT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:4	ms_run[1]:scan=9993	24.431893245066664	3	1971.926967	1971.929502	G	K	244	260
PSM	KRLEQKGAEADQIIEYL	1004	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10509	25.8693879568	3	2003.064101	2003.068755	L	K	9	26
PSM	RKTSDFNTFLAQEGCTKG	1005	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:4	ms_run[1]:scan=9190	23.100147935733332	3	2058.979060	2058.979289	R	K	197	215
PSM	RKYLDEGETDEDKMEEY	1006	sp|Q9HCE5|MET14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:35	ms_run[1]:scan=6847	19.7398638272	3	2164.910663	2164.910660	K	K	64	81
PSM	RRQQQEEDEQETAALLEEAR	1007	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9533	23.57368435653333	4	2428.158809	2428.157858	R	K	184	204
PSM	KARPEYMLPVHFYG	1008	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10391	25.49	3	1706.8603	1706.8603	E	R	192	206
PSM	KCGGAGHIASDCKFQ	1009	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=5191	17.265	3	1634.7293	1634.7293	T	R	281	296
PSM	KCHLLVEHETQ	1010	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=5390	17.539	3	1392.682	1392.6820	E	K	887	898
PSM	KCQFAHGFHEL	1011	sp|P47974|TISD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=8218	21.731	3	1372.6346	1372.6346	E	R	173	184
PSM	KDKLESEMEDAYHEHQANLL	1012	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=8439	22.035	4	2415.1013	2415.1013	A	R	516	536
PSM	KDKNNHCGIATAASYPNV	1013	sp|O60911|CATL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4	ms_run[2]:scan=7669	20.935	3	1958.9269	1958.9269	A	-	317	335
PSM	KEHNGHITGIDWAP	1014	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9297	23.237	3	1573.7637	1573.7637	L	K	49	63
PSM	KEKDVQFEHGY	1015	sp|Q92544|TM9S4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6162	18.679	3	1378.6517	1378.6517	K	R	157	168
PSM	KEKNLLHVTDTGVGMT	1016	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:35	ms_run[2]:scan=7743	21.045	3	1757.8982	1757.8982	D	R	140	156
PSM	KEKPGALWHIYAA	1017	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9687	23.82	3	1482.7983	1482.7983	G	K	1607	1620
PSM	KEKTHVADFAPEVAWVT	1018	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10549	26.034	3	1926.984	1926.9840	E	R	1089	1106
PSM	KERPTYPELMQHPFFTLHES	1019	sp|P52564-2|MP2K6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=10094	24.651	4	2502.2002	2502.2002	S	K	244	264
PSM	KEYHPDKNPNAGD	1020	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3549	14.747	3	1483.6692	1483.6692	A	K	33	46
PSM	KFENAFLSHVVSQHQALLGTIRADG	1021	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10970	27.902	4	2737.43	2737.4300	T	K	456	481
PSM	KFLPSELRDEH	1022	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7888	21.245	3	1369.699	1369.6990	Y	-	2531	2542
PSM	KGKTHTYYQVLIDA	1023	sp|Q9Y2S7|PDIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9541	23.584	3	1635.8621	1635.8621	V	R	127	141
PSM	KHFEANNGKLPDN	1024	sp|Q9P2J5-3|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4978	16.982	3	1482.7215	1482.7215	R	K	266	279
PSM	KHGEEGVEAEK	1025	sp|Q9H993|ARMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3412	14.568	3	1211.5782	1211.5782	E	K	46	57
PSM	KHHGIPFYVAAPSSSCDL	1026	sp|Q9BV20|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:4	ms_run[2]:scan=9958	24.355	3	1984.9465	1984.9465	A	R	270	288
PSM	KHIHITQATETTTT	1027	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4864	16.803	3	1580.8158	1580.8158	T	R	242	256
PSM	KHKDLQQQLVDA	1028	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7517	20.724	2	1421.7627	1421.7627	F	K	328	340
PSM	KHTTDLDASKI	1029	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5725	18.024	3	1227.6459	1227.6459	M	R	139	150
PSM	KIHNAITVHMN	1030	sp|Q8N3R9-2|MPP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=4578	16.409	3	1292.6659	1292.6659	F	K	130	141
PSM	KIISKIENHEGV	1031	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6459	19.098	3	1365.7616	1365.7616	I	R	251	263
PSM	KKCYEMASHL	1032	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=6326	18.902	3	1265.5897	1265.5897	N	R	126	136
PSM	KKHEAIETDIAAYEE	1033	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8662	22.361	3	1745.8472	1745.8472	T	R	449	464
PSM	KKHSQFIGYPITLFVE	1034	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11060	28.305	3	1906.0353	1906.0353	V	K	208	224
PSM	KKIHAVGAPSVCSSCGQSYY	1035	sp|Q6DD87|ZN787_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7697	20.98	3	2198.0249	2198.0249	H	R	336	356
PSM	KKLYVSNLGIGHT	1036	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8227	21.743	3	1428.8089	1428.8089	L	R	80	93
PSM	KKNYVHFAATQVQN	1037	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6852	19.76	3	1646.8529	1646.8529	E	R	333	347
PSM	KKVSYSHIQS	1038	sp|P27816-4|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4026	15.365	2	1175.6299	1175.6299	S	K	717	727
PSM	KLHQLAMQQSHFPMTHGNTGFSGIESSSPEV	1039	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=9186	23.096	4	3413.5769	3413.5769	T	K	210	241
PSM	KLKGEMMDLQHGSLFL	1040	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=10383	25.458	3	1861.943	1861.9430	D	R	57	73
PSM	KLQHPLGVTWDK	1041	sp|Q8NBF2-2|NHLC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8284	21.814	3	1420.7827	1420.7827	A	K	114	126
PSM	KLRENVFQEHQTL	1042	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8350	21.916	3	1640.8635	1640.8635	H	K	57	70
PSM	KLVYVHTNGPK	1043	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5233	17.317	3	1254.7085	1254.7085	D	K	34	45
PSM	KMRHGFSGIPITETGTMGS	1044	sp|P20839-2|IMDH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=8432	22.022	3	2037.9612	2037.9612	A	K	109	128
PSM	KNKGDSHLNVQVSNF	1045	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8304	21.844	3	1685.8485	1685.8485	K	K	246	261
PSM	KPHLITHGFSS	1046	sp|Q96G21|IMP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6721	19.518	3	1222.6459	1222.6459	A	R	183	194
PSM	KQCHECIEHI	1047	sp|Q9H3G5|CPVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=5354	17.481	2	1352.5965	1352.5965	Q	R	269	279
PSM	KQYHPVVHPLDL	1048	sp|Q96IY1-2|NSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9046	22.927	3	1444.7827	1444.7827	L	K	149	161
PSM	KRDAESIHQYLLQ	1049	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8804	22.559	2	1599.8369	1599.8369	L	R	819	832
PSM	KRVHLMNPMVPGLTGS	1050	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=9126	23.023	3	1751.9175	1751.9175	S	K	206	222
PSM	KSDIASHFSNK	1051	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5310	17.432	3	1232.6149	1232.6149	W	R	797	808
PSM	KSSLHLLSHET	1052	sp|O95684-2|CEP43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6667	19.43	3	1250.6619	1250.6619	S	K	194	205
PSM	KTGPNLHGLFGR	1053	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9054	22.94	3	1295.7099	1295.7099	H	K	28	40
PSM	KTKWFVPWGPNHCD	1054	sp|Q5T9L3|WLS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4	ms_run[2]:scan=10295	25.195	3	1770.83	1770.8300	H	K	59	73
PSM	KVKQFDFLFH	1055	sp|Q96H35|RBM18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10506	25.858	3	1307.7026	1307.7026	G	K	50	60
PSM	KVVLDDKDYFLF	1056	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11144	28.642	2	1500.7864	1500.7864	T	R	80	92
PSM	KWKPGSLASHV	1057	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7682	20.958	3	1208.6666	1208.6666	P	K	186	197
PSM	KYHIGDEVKC	1058	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=5713	18.011	3	1247.5969	1247.5969	K	R	496	506
PSM	KYHSDEYIKFL	1059	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10053	24.569	3	1441.7242	1441.7242	T	R	37	48
PSM	KYHTVNGHNCEV	1060	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=4079	15.468	3	1456.6517	1456.6517	Q	R	166	178
PSM	RALGLAHVAIKCS	1061	sp|Q6P3X3|TTC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=7878	21.23	3	1394.7816	1394.7816	Q	K	763	776
PSM	RATNVTYQAHHVS	1062	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4180	15.72	3	1482.7328	1482.7328	Q	R	24	37
PSM	RCFSQSSHLIQHQ	1063	sp|P17026|ZNF22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=6023	18.473	3	1626.7685	1626.7685	G	R	146	159
PSM	RDCYFETHSVEDAGR	1064	sp|Q8N0Z6|TTC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=7559	20.779	3	1840.7799	1840.7799	F	K	27	42
PSM	RDVKDTILHDNL	1065	sp|Q14344-2|GNA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9072	22.958	3	1437.7576	1437.7576	F	K	265	277
PSM	REAYVELVHHI	1066	sp|Q96SZ6-5|CK5P1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9200	23.113	3	1364.7201	1364.7201	S	R	405	416
PSM	REKLTPEQLHSM	1067	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:35	ms_run[2]:scan=5448	17.629	3	1483.7453	1483.7453	T	R	27	39
PSM	RETQETLALTQGKLHEVGHE	1068	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8236	21.755	4	2275.1557	2275.1557	L	R	55	75
PSM	RFALTVVRHGET	1069	sp|Q9NQ88|TIGAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7911	21.276	3	1384.7575	1384.7575	A	R	3	15
PSM	RFNISSHNQSPK	1070	sp|Q9H1A4|APC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5033	17.044	3	1413.7113	1413.7113	Q	R	368	380
PSM	RFPPYHVGQTFDR	1071	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9226	23.144	3	1618.8005	1618.8005	R	R	236	249
PSM	RGHAGNPRDPTDEGIFIS	1072	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8652	22.348	3	1937.9344	1937.9344	A	K	1039	1057
PSM	RGKTILISAHGNSS	1073	sp|P07738|PMGE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5309	17.431	3	1439.7845	1439.7845	L	R	179	193
PSM	RHEMPPHIYAITDTAY	1074	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9474	23.488	3	1913.9094	1913.9094	K	R	143	159
PSM	RHEVLLISAEQDK	1075	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7887	21.243	3	1536.826	1536.8260	A	R	245	258
PSM	RHLWVGNLPENVREE	1076	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9389	23.37	3	1846.9438	1846.9438	T	K	6	21
PSM	RHNVFGLDLKDE	1077	sp|Q13206|DDX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9670	23.797	3	1441.7314	1441.7314	K	K	640	652
PSM	RHQIVEVAGDDKYG	1078	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6656	19.415	3	1585.7849	1585.7849	A	R	69	83
PSM	RHVAVTNMNEHSS	1079	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4035	15.378	3	1480.6841	1480.6841	N	R	190	203
PSM	RIAEGEHPKDI	1080	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4860	16.8	3	1263.6571	1263.6571	V	R	680	691
PSM	RIGPKEDFFHCL	1081	sp|Q96PM5-3|ZN363_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4	ms_run[2]:scan=10181	24.886	3	1517.7449	1517.7449	C	K	109	121
PSM	RIGPKEDFFHCL	1082	sp|Q96PM5-3|ZN363_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4	ms_run[2]:scan=10201	24.932	3	1517.7449	1517.7449	C	K	109	121
PSM	RIHQESELHSYLS	1083	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7842	21.181	3	1597.7849	1597.7849	R	R	82	95
PSM	RIIDKNGIHDLDNISFP	1084	sp|P49721|PSB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10593	26.19	3	1966.0272	1966.0272	V	K	181	198
PSM	RIYPTFLHLHG	1085	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9998	24.445	3	1352.7353	1352.7353	I	K	217	228
PSM	RKCMLDAALATLNTHG	1086	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,4-UNIMOD:35	ms_run[2]:scan=9412	23.401	3	1786.8818	1786.8818	V	K	1273	1289
PSM	RKFLDTSHYSTAGSSSV	1087	sp|Q96A65-2|EXOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7790	21.108	3	1841.8908	1841.8908	P	R	239	256
PSM	RKGGELASAVHAYT	1088	sp|Q96CW5-2|GCP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7899	21.259	3	1458.7579	1458.7579	G	K	391	405
PSM	RKNGGLGHMNIALLSDLT	1089	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35	ms_run[2]:scan=10340	25.323	3	1925.0153	1925.0153	P	K	130	148
PSM	RKSNFAEALAAH	1090	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7531	20.741	3	1313.684	1313.6840	L	K	30	42
PSM	RLHISQLQHENSIL	1091	sp|Q14203-3|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9375	23.349	3	1686.9166	1686.9166	M	K	1059	1073
PSM	RLKDLGVLGSFIH	1092	sp|Q96AX1|VP33A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10876	27.466	3	1453.8405	1453.8405	Q	R	124	137
PSM	RLLHDLQIGEK	1093	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8338	21.9	3	1320.7514	1320.7514	L	K	145	156
PSM	RLNSHMNALHLGSQAN	1094	sp|P11413|G6PD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7930	21.309	3	1761.8693	1761.8693	Q	R	120	136
PSM	RNALAHVGAKE	1095	sp|Q96KN1|LRAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4278	15.949	3	1164.6364	1164.6364	V	R	183	194
PSM	RPCHETTVDIFH	1096	sp|Q8WV92|MITD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=8169	21.665	3	1510.6987	1510.6987	L	K	231	243
PSM	RPEPPKHPESI	1097	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5373	17.505	3	1285.6779	1285.6779	L	K	1130	1141
PSM	RPLDKHEGALETLL	1098	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10045	24.545	3	1590.873	1590.8730	G	R	56	70
PSM	RQLLYDAIKHQ	1099	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8261	21.789	3	1383.7623	1383.7623	G	K	751	762
PSM	RQSPFHGNHAAINQCQAPVP	1100	sp|Q6P1L5|F117B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:4	ms_run[2]:scan=7637	20.882	3	2228.0658	2228.0658	E	K	305	325
PSM	RQVLGHTLDVFK	1101	sp|O95985-3|TOP3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9479	23.493	3	1411.7936	1411.7936	Y	R	579	591
PSM	RSLGTADVHFER	1102	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7424	20.602	3	1386.7004	1386.7004	G	K	144	156
PSM	RSNAIFGMGVLAEHGGHPAQEHFP	1103	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=9847	24.122	4	2574.2186	2574.2186	V	K	916	940
PSM	RSPPLHEHPLY	1104	sp|Q9BZE1|RM37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6887	19.806	3	1344.6939	1344.6939	Y	K	89	100
PSM	RSSIHNFMTHPEF	1105	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=8240	21.761	3	1617.7358	1617.7358	S	R	1102	1115
PSM	RSSIHNFMTHPEF	1106	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9518	23.55	3	1601.7409	1601.7409	S	R	1102	1115
PSM	RTENAQKAGHFD	1107	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3752	14.956	3	1372.6484	1372.6484	N	K	188	200
PSM	RTKENDAHLVEVNLNNI	1108	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9949	24.338	4	1978.0232	1978.0232	K	K	192	209
PSM	RVHNNIVYNEYISH	1109	sp|O60870-2|KIN17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8340	21.903	3	1756.8645	1756.8645	K	R	88	102
PSM	RVKLLLQVQHAS	1110	sp|P12235|ADT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8370	21.94	3	1390.8409	1390.8409	E	K	31	43
PSM	RVTSAHKGPDETL	1111	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4646	16.503	2	1409.7263	1409.7263	L	R	298	311
PSM	RYPMEHGIVKDWNDME	1112	sp|P61163|ACTZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:35	ms_run[2]:scan=9026	22.89	3	2034.8928	2034.8928	I	R	72	88
PSM	KHWPFMVVNDAGRP	1113	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:35	ms_run[1]:scan=9316	23.263659341599997	3	1668.819282	1668.819481	M	K	88	102
PSM	RDKEVGNLYDMFHT	1114	sp|Q9Y3Z3|SAMH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:35	ms_run[1]:scan=9290	23.228192909333334	3	1739.789078	1739.793720	A	R	352	366
PSM	RSKNVGMPIAMLLHTDGAHE	1115	sp|P13995|MTDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=9028	22.892689045066668	4	2208.077183	2208.077957	G	R	201	221
PSM	KHVSDWLDETNKGT	1116	sp|Q96SI9|STRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8242	21.762908834666668	3	1630.783066	1628.779450	L	K	43	57
PSM	RIHVELSEKGEATQ	1117	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6633	19.376993321866667	3	1596.827211	1595.826734	H	K	362	376
PSM	RPMYGRDSAYQSITHY	1118	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35	ms_run[1]:scan=8195	21.698376573866664	3	1960.892371	1959.889745	E	R	152	168
PSM	KHSSGCAFLSVK	1119	sp|O15392|BIRC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4	ms_run[1]:scan=7021	20.03123276026667	3	1319.667399	1319.665606	K	K	79	91
PSM	RKEGTSVLEHTSDGFPEN	1120	sp|Q8TED0|UTP15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7719	21.007476254933334	3	2002.941992	2001.939198	R	K	496	514
PSM	RIIDKNGIHDLDNISFP	1121	sp|P49721|PSB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10582	26.14981976	3	1966.026137	1966.027225	V	K	181	198
PSM	KRVTIMPKDIQLA	1122	sp|Q16695|H31T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:35	ms_run[1]:scan=8337	21.898124610666667	3	1527.881818	1527.880684	A	R	116	129
PSM	KKYGLKPPTL	1123	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8026	21.45604631253333	2	1143.703641	1143.701580	A	-	599	609
PSM	KKIADEDALR	1124	sp|O75150|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4729	16.623384417333334	3	1157.640679	1157.640437	S	R	719	729
PSM	RKSSTPEEVK	1125	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3428	14.586693880533334	2	1159.619223	1159.619701	V	K	21	31
PSM	KKLEDGPKFL	1126	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7909	21.273501711999998	3	1173.676362	1173.675760	G	K	385	395
PSM	KKAQGPKGGGNAV	1127	sp|Q9Y237|PIN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3358	14.499621409066666	3	1210.679224	1210.678219	D	K	26	39
PSM	KKVTLGDTLTR	1128	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6347	18.935156603200003	3	1230.729089	1230.729586	V	R	969	980
PSM	KKIEQELTAAK	1129	sp|Q9H444|CHM4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5263	17.364698383733334	3	1257.731058	1257.729252	E	K	45	56
PSM	RQKIVELAHSGA	1130	sp|P26367|PAX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5794	18.131932953333333	3	1307.726117	1307.730983	T	R	26	38
PSM	KKIEDLEKEVV	1131	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8547	22.19834995333333	3	1328.755510	1328.755132	E	R	270	281
PSM	RKPSDGSPDTKPS	1132	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3297	14.421265770933333	3	1370.682604	1370.679007	S	R	206	219
PSM	KKLEDVKNSPTF	1133	sp|P55327|TPD52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6665	19.426076500799997	3	1404.761832	1404.761280	T	K	163	175
PSM	RKALDDMISTLK	1134	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:35	ms_run[1]:scan=7051	20.073526311733335	3	1405.760008	1405.759900	Y	K	127	139
PSM	RKQLTEDVAKLE	1135	sp|Q8N6M0|OTU6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7421	20.59858310666667	3	1428.793566	1428.793643	R	K	45	57
PSM	RKNPSIAVPIVLK	1136	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9298	23.2379553304	3	1433.908556	1433.908219	L	R	685	698
PSM	RKLAAAEGLEPKY	1137	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7491	20.6891555688	3	1444.803661	1444.803814	A	R	102	115
PSM	KKLIAAQTGTRWN	1138	sp|Q9BZL1|UBL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6689	19.4647303824	3	1485.842019	1485.841596	L	K	28	41
PSM	RKLQEALEFETK	1139	sp|Q9UI36|DACH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8307	21.848602064799998	3	1490.807930	1490.809293	K	R	690	702
PSM	KRVTIMPKDIQLA	1140	sp|Q16695|H31T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9195	23.106183251733334	3	1511.884908	1511.885769	A	R	116	129
PSM	RKLAVNFGVSKPSE	1141	sp|Q8IZH2|XRN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8001	21.415675626133336	3	1530.851362	1530.851827	S	-	1693	1707
PSM	KKGSEVESVKEFLA	1142	sp|P22694|KAPCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9372	23.345188124533333	3	1549.835715	1549.835174	A	K	8	22
PSM	RKSGVGNIFIKNLD	1143	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9405	23.392294442933334	3	1559.879660	1559.878376	L	K	94	108
PSM	KKPFTPVKYFSID	1144	sp|Q9Y285|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9879	24.191553423733335	3	1568.860514	1568.860266	Q	R	342	355
PSM	MKHYEVEILDAKT	1145	sp|Q9NZ01|TECR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:35	ms_run[1]:scan=8608	22.276492996266665	3	1591.805966	1591.791595	-	R	1	14
PSM	KKVVKITSEIPQTE	1146	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7161	20.2361648992	3	1598.921766	1598.924323	E	R	88	102
PSM	KKIADDKYNDTFW	1147	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9400	23.3834689392	3	1642.800310	1642.799122	I	K	473	486
PSM	KKKELVNNLGEIYQ	1148	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8591	22.256024497333332	3	1674.929968	1674.930471	S	K	327	341
PSM	RGKQGLFPNNYVTKI	1149	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9637	23.739791630933333	3	1733.956168	1733.957689	L	-	1094	1109
PSM	KKIIEDQQESLNKW	1150	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8312	21.8558331936	3	1757.932085	1757.931199	L	K	316	330
PSM	RKYEQEQEKGQEDL	1151	sp|P46199|IF2M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4807	16.729429472533333	3	1778.841783	1778.843506	W	K	447	461
PSM	KKENVKISDEGIAYLV	1152	sp|P35249|RFC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10044	24.5435279928	3	1804.992779	1804.993465	A	K	216	232
PSM	RKVCGDSDKGFVVINQ	1153	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:4	ms_run[1]:scan=7788	21.10628826773333	3	1820.919346	1820.920317	K	K	279	295
PSM	RRAIESMEQQLSELK	1154	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:35	ms_run[1]:scan=7659	20.92234149973333	3	1832.942155	1832.941447	K	K	1023	1038
PSM	KKKEPEPNFQLLDNPA	1155	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9658	23.774597733333334	3	1866.984054	1866.983963	E	R	867	883
PSM	KKIRLESEEEGVPSTAI	1156	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8327	21.883641564266668	3	1885.016232	1885.015657	M	R	33	50
PSM	KRPNKPLFTALVTQCQ	1157	sp|Q8NCW5|NNRE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	15-UNIMOD:4	ms_run[1]:scan=9684	23.8157868784	3	1900.034077	1900.035287	P	K	144	160
PSM	RQLYVLGHEAMK	1158	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8161	21.652842817066666	3	1445.775538	1443.765654	S	R	57	69
PSM	KKTKVEPYSLTAQQSSLI	1159	sp|Q96T88|UHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9319	23.268219909600003	3	2020.119956	2020.120457	S	R	667	685
PSM	KKRDQEQVELEGESSAPP	1160	sp|Q9BW61|DDA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6485	19.130272089333335	3	2025.995782	2025.996713	A	R	70	88
PSM	KRYEMLQDNVEGYR	1161	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:35	ms_run[1]:scan=7429	20.607981113066668	3	1816.855622	1815.857383	S	R	723	737
PSM	KAKADWWTNTAHYN	1162	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8815	22.574	3	1704.8009	1704.8009	V	R	744	758
PSM	KDGFLHETLLDR	1163	sp|Q14331|FRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9610	23.695	3	1442.7518	1442.7518	R	R	236	248
PSM	KDGHIKITDFGLC	1164	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:4	ms_run[2]:scan=10007	24.461	3	1502.7551	1502.7551	D	K	222	235
PSM	KEGVHGGLINK	1165	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4401	16.132	3	1150.6459	1150.6459	G	K	116	127
PSM	KEISGHTSGIK	1166	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3615	14.821	3	1155.6248	1155.6248	P	K	137	148
PSM	KEKGSSNHNLLAAP	1167	sp|P83436|COG7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6321	18.894	3	1464.7685	1464.7685	L	R	554	568
PSM	KGKEGSALSHV	1168	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4562	16.386	3	1111.5986	1111.5986	C	R	152	163
PSM	KHDTKLLILALE	1169	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10636	26.362	3	1392.8341	1392.8341	Y	R	833	845
PSM	KHFVGMLPEKDC	1170	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6140	18.657	3	1475.6901	1475.6901	F	R	52	64
PSM	KHHNQPYCGIAPYI	1171	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=9329	23.284	3	1696.8144	1696.8144	E	R	32	46
PSM	KHIVENAVQKEL	1172	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7187	20.282	2	1406.7882	1406.7882	L	R	479	491
PSM	KHKPGSTPEPIAAEV	1173	sp|P50748|KNTC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6886	19.805	3	1559.8308	1559.8308	A	R	1029	1044
PSM	KHLFWFPAEAFH	1174	sp|O60279|SUSD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10941	27.76	3	1528.7616	1528.7616	Q	K	291	303
PSM	KHLSHPPSFTTV	1175	sp|Q8TEA1|NSUN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7386	20.551	3	1349.7092	1349.7092	L	R	44	56
PSM	KHQASISELK	1176	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4793	16.711	3	1139.6299	1139.6299	L	R	643	653
PSM	KHTNYTMEHI	1177	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=4956	16.934	2	1288.587	1288.5870	N	R	333	343
PSM	KHWPFMVVNDAGRP	1178	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=9517	23.549	3	1668.8195	1668.8195	M	K	88	102
PSM	KHWPFQVINDGDKP	1179	sp|P0DMV9|HS71B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9754	23.956	2	1679.842	1679.8420	M	K	88	102
PSM	KILLDHEKEW	1180	sp|P54136-2|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8499	22.114	3	1309.703	1309.7030	T	K	491	501
PSM	KIPVHPNDHVN	1181	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4574	16.406	3	1268.6626	1268.6626	S	K	129	140
PSM	KKCGAETQHEGLEL	1182	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=6999	19.991	3	1598.7723	1598.7723	E	R	126	140
PSM	KKFPFCDGAHT	1183	sp|Q9NZ45|CISD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=7242	20.351	3	1306.6128	1306.6128	S	K	78	89
PSM	KKLDEAVAEAHLG	1184	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7722	21.013	3	1379.7409	1379.7409	P	K	360	373
PSM	KKLMHQAALLGQALQDS	1185	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=8977	22.818	3	1866.9986	1866.9986	P	R	29	46
PSM	KKPEVASWVHFDNL	1186	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10559	26.073	3	1668.8624	1668.8624	T	K	674	688
PSM	KKQDPPVTHDL	1187	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5201	17.277	3	1276.6776	1276.6776	R	R	58	69
PSM	KLADIIHHWNAN	1188	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9934	24.305	3	1430.7419	1430.7419	R	R	12	24
PSM	KLGIHEDSQNR	1189	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4089	15.485	3	1295.6582	1295.6582	I	K	446	457
PSM	KLHDMLGPHML	1190	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7081	20.125	2	1322.6475	1322.6475	K	R	945	956
PSM	KLKQFVFDLHSG	1191	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9855	24.138	3	1417.7718	1417.7718	G	K	343	355
PSM	KLLHSENYVTK	1192	sp|Q9Y376|CAB39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5511	17.717	3	1330.7245	1330.7245	E	R	216	227
PSM	KLRNEYGPVLHMPTS	1193	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:35	ms_run[2]:scan=7373	20.537	3	1756.893	1756.8930	I	K	47	62
PSM	KNIKLGIHEDSQN	1194	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5720	18.018	3	1494.7791	1494.7791	S	R	443	456
PSM	KNSKHEELMLGDPCL	1195	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=8942	22.767	3	1785.839	1785.8390	N	K	647	662
PSM	KNVRDQFNSHIQLV	1196	sp|Q8ND24-2|RN214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9277	23.214	3	1696.9009	1696.9009	K	R	254	268
PSM	KPFHPSANNFPIPLLHMH	1197	sp|O60318-2|GANP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:35	ms_run[2]:scan=10291	25.182	4	2112.0727	2112.0727	I	R	554	572
PSM	KPVHHGVNQL	1198	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4211	15.794	2	1127.62	1127.6200	G	K	83	93
PSM	KQINDIRNHVNF	1199	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8066	21.521	3	1496.7848	1496.7848	V	-	730	742
PSM	KQVHPDTGISS	1200	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4134	15.611	2	1167.5884	1167.5884	L	K	47	58
PSM	KRAGLNEMVEYITHS	1201	sp|Q14738-3|2A5D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10680	26.548	3	1746.8723	1746.8723	V	R	39	54
PSM	KSHGKDEECVLEAEN	1202	sp|Q9UHQ4|BAP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4	ms_run[2]:scan=5648	17.917	3	1743.7734	1743.7734	L	K	163	178
PSM	KSKSAASEQHVF	1203	sp|Q92620-2|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5024	17.034	3	1317.6677	1317.6677	C	K	28	40
PSM	KSLHHPNIVGY	1204	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6902	19.828	2	1263.6724	1263.6724	L	R	90	101
PSM	KSTLHNWMSEFK	1205	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=8516	22.137	3	1522.7238	1522.7238	P	R	238	250
PSM	KTCHSFIINEKMNG	1206	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=7865	21.211	3	1677.7967	1677.7967	W	K	740	754
PSM	KTHLSLSHNPEQ	1207	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5021	17.031	3	1389.7001	1389.7001	A	K	866	878
PSM	KVHEPVRIAYD	1208	sp|Q8IX01-4|SUGP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6947	19.917	2	1325.7092	1325.7092	P	R	924	935
PSM	KVIYPGLPSHPQHELVK	1209	sp|P32929-2|CGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8256	21.782	4	1941.0836	1941.0836	E	R	244	261
PSM	KYEYHWADGTNIK	1210	sp|Q7L9L4|MOB1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8330	21.887	3	1623.7682	1623.7682	P	K	92	105
PSM	KYHTINGHNAEV	1211	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4874	16.815	3	1381.6739	1381.6739	Q	R	173	185
PSM	KYHVMANHNSLPIL	1212	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=9124	23.022	3	1651.8504	1651.8504	M	K	136	150
PSM	KYPHYFPLLK	1213	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9972	24.383	3	1304.7281	1304.7281	L	K	220	230
PSM	RAAHLEEFHYQT	1214	sp|Q3B7T1-3|EDRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7801	21.123	3	1500.711	1500.7110	N	K	762	774
PSM	RCKEMCHPGECPFNCNQ	1215	sp|Q6ZNB6|NFXL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,5-UNIMOD:35,6-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5638	17.901	3	2238.8486	2238.8486	H	K	778	795
PSM	RDHAVVVGVYRPPP	1216	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7943	21.329	3	1560.8525	1560.8525	E	K	304	318
PSM	RDPLLHSFGHL	1217	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9773	23.984	3	1290.6833	1290.6833	E	K	36	47
PSM	RDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSL	1218	sp|Q9H7S9|ZN703_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,20-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=8970	22.806	4	3430.4514	3430.4514	C	K	377	410
PSM	RDTLYEAVREVLHGNQ	1219	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11131	28.591	3	1898.9599	1898.9599	S	R	7	23
PSM	REAVKHIGYDDSS	1220	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4772	16.689	3	1475.7005	1475.7005	V	K	21	34
PSM	REHVEAIKIGLT	1221	sp|O95229|ZWINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8623	22.297	3	1364.7776	1364.7776	Y	K	104	116
PSM	REKLSLNLDH	1222	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7714	21.001	3	1223.6622	1223.6622	L	K	205	215
PSM	REQQHFLQDCHEL	1223	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:4	ms_run[2]:scan=8239	21.759	3	1738.7846	1738.7846	N	K	1278	1291
PSM	RFHEICSNLVKT	1224	sp|Q15041-2|AR6P1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=7890	21.246	3	1502.7664	1502.7664	Q	R	75	87
PSM	RFIQVHPITK	1225	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7409	20.581	3	1237.7295	1237.7295	N	K	498	508
PSM	RFKPSSLPHPLEGS	1226	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8469	22.07	3	1550.8205	1550.8205	R	R	294	308
PSM	RGAGAESSHPVRNAQSNALQE	1227	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4815	16.738	3	2178.0526	2178.0526	G	R	2425	2446
PSM	RGHLLYVALSPGQH	1228	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9155	23.059	3	1546.8368	1546.8368	G	R	848	862
PSM	RGKQMEDGHTLFDYEV	1229	sp|Q96T88|UHRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9981	24.402	3	1923.8785	1923.8785	Y	R	48	64
PSM	RHISVLAETIK	1230	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7905	21.266	3	1265.7456	1265.7456	E	K	482	493
PSM	RHLAFIDQLIEDK	1231	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10779	26.999	3	1596.8624	1596.8624	Q	K	626	639
PSM	RHLQVIFGHLAAS	1232	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9525	23.563	3	1447.8048	1447.8048	L	R	1645	1658
PSM	RHPAPEDPDWIK	1233	sp|Q9UKN8|TF3C4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7713	21	3	1459.7208	1459.7208	A	R	796	808
PSM	RHPSHSTTPSGPGDEVA	1234	sp|P53365-3|ARFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4237	15.872	3	1730.7972	1730.7972	G	R	31	48
PSM	RHQAQIDHYLGLAN	1235	sp|Q9NQC3-3|RTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9098	22.99	3	1634.8277	1634.8277	E	K	164	178
PSM	RHQEDEKATVLNDLSSL	1236	sp|Q66GS9|CP135_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10575	26.125	3	1953.9756	1953.9756	L	R	961	978
PSM	RHRGQAAQPEPSTGFTATPPAPDSPQEPLVL	1237	sp|Q9BVT8|TMUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10264	25.109	4	3251.6323	3251.6323	L	R	75	106
PSM	RHTIVDILTMKSQE	1238	sp|Q8WWK9-6|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35	ms_run[2]:scan=10042	24.539	3	1685.8771	1685.8771	M	K	450	464
PSM	RHYTGPGDQTVNPQNGFVRN	1239	sp|Q9UHI6|DDX20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7590	20.818	4	2256.0784	2256.0784	I	K	614	634
PSM	RIVLHPDTEHS	1240	sp|Q9NW13-2|RBM28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5318	17.441	3	1302.668	1302.6680	V	K	224	235
PSM	RKADGVHTVEPTEAGDY	1241	sp|Q13445|TMED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6591	19.308	3	1843.8701	1843.8701	S	K	87	104
PSM	RKDLVDYITTHY	1242	sp|O75439|MPPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10587	26.168	3	1522.778	1522.7780	S	K	223	235
PSM	RKDQSQVTWHEIA	1243	sp|Q6IA86-4|ELP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8043	21.483	3	1596.8009	1596.8009	K	R	420	433
PSM	RKGEIAASIATHM	1244	sp|O75880|SCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:35	ms_run[2]:scan=5765	18.073	3	1399.7242	1399.7242	K	R	282	295
PSM	RKGTGLGYGHPGLASSEEAEG	1245	sp|P78332-2|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6834	19.709	3	2071.9923	2071.9923	W	R	543	564
PSM	RKILEEENSLAEYHS	1246	sp|Q15650|TRIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8151	21.642	3	1816.8955	1816.8955	G	R	333	348
PSM	RKLESVAEEHEILT	1247	sp|Q8TCG1|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7965	21.362	3	1652.8733	1652.8733	N	K	715	729
PSM	RKQLEALMAEHQ	1248	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=5523	17.736	3	1468.7456	1468.7456	R	R	841	853
PSM	RKVMSQNFTNCHT	1249	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=4420	16.158	3	1637.7402	1637.7402	H	K	63	76
PSM	RLGHAEQKDEMVP	1250	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=4809	16.731	3	1524.7355	1524.7355	G	R	361	374
PSM	RLKDLPFIVSH	1251	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9990	24.424	3	1323.7663	1323.7663	E	R	902	913
PSM	RLKEQSIFGDH	1252	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7754	21.061	3	1328.6837	1328.6837	R	R	250	261
PSM	RLKLEPHEGLLL	1253	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9999	24.447	3	1416.8453	1416.8453	E	R	512	524
PSM	RLRDGDSTSTLEEHSEG	1254	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5256	17.355	3	1887.8559	1887.8559	N	K	1713	1730
PSM	RMHIEKDETPLSTPTA	1255	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7694	20.976	3	1824.904	1824.9040	K	R	518	534
PSM	RMLHDYIGDKDF	1256	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=8745	22.474	3	1524.7031	1524.7031	I	K	366	378
PSM	RMNTNPSRGPYHF	1257	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=6835	19.711	2	1591.7314	1591.7314	K	R	61	74
PSM	RMNTNPSRGPYHF	1258	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7617	20.852	3	1575.7365	1575.7365	K	R	61	74
PSM	RPKNDLGHPFCNNL	1259	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:4	ms_run[2]:scan=8275	21.803	3	1680.8155	1680.8155	I	R	930	944
PSM	RQGHDSLEHDEL	1260	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5867	18.224	3	1434.6488	1434.6488	H	R	208	220
PSM	RQHNYTEAFESLQK	1261	sp|Q9UL63|MKLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8806	22.562	3	1749.8434	1749.8434	F	K	185	199
PSM	RQQSDHDAERL	1262	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4057	15.426	3	1353.6385	1353.6385	Q	R	2406	2417
PSM	RQRLQALDTGWNELH	1263	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9649	23.76	3	1835.9391	1835.9391	L	K	1128	1143
PSM	RRLESIATTLVSH	1264	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9033	22.902	3	1481.8314	1481.8314	S	K	266	279
PSM	RSHISDQSPLSSK	1265	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4947	16.915	3	1440.7321	1440.7321	E	R	344	357
PSM	RSKCEELSGLHGQLQEA	1266	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=7849	21.19	4	1940.9374	1940.9374	V	R	497	514
PSM	RSKEEAEALYHS	1267	sp|P35908|K22E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5368	17.498	3	1418.679	1418.6790	Q	K	362	374
PSM	RSLHDALCVVK	1268	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=7966	21.363	3	1296.6972	1296.6972	E	R	390	401
PSM	RSSPTDKHTLV	1269	sp|P20020-6|AT2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4624	16.476	3	1239.6571	1239.6571	A	K	767	778
PSM	RSVHYCPATK	1270	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=3760	14.965	3	1217.5975	1217.5975	V	K	143	153
PSM	RVGHSTAHDEIIPMSI	1271	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35	ms_run[2]:scan=8610	22.279	3	1777.8781	1777.8781	D	R	158	174
PSM	RVHNATLILSEGLK	1272	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9083	22.972	3	1549.894	1549.8940	R	R	410	424
PSM	RVHPALDTYIKE	1273	sp|Q9Y6I9|TX264_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8216	21.727	3	1440.7725	1440.7725	R	R	150	162
PSM	RVKDLESLFH	1274	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9979	24.398	3	1242.6721	1242.6721	G	R	148	158
PSM	RVKGVTSISADTH	1275	sp|O95470|SGPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5051	17.062	3	1369.7314	1369.7314	F	K	340	353
PSM	RVKPIIDLVH	1276	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9080	22.969	3	1188.7343	1188.7343	Q	K	453	463
PSM	RVKVDPSHDAS	1277	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3620	14.827	3	1209.6102	1209.6102	F	K	667	678
PSM	RVLATEDRSDHLIQTDTVNLH	1278	sp|P51151|RAB9A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8569	22.225	4	2432.2408	2432.2408	R	R	171	192
PSM	RVVDLMAHMASKE	1279	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=6722	19.519	3	1501.7381	1501.7381	N	-	281	294
PSM	RVYYVDHVEK	1280	sp|Q96J02-3|ITCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5794	18.132	3	1306.667	1306.6670	G	R	190	200
PSM	RYDDSRDHFCELDDE	1281	sp|Q86YB8|ERO1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:4	ms_run[2]:scan=8134	21.617	3	1970.7701	1970.7701	A	R	156	171
PSM	RYGFNSHGLSVVEH	1282	sp|Q02127|PYRD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8646	22.34	3	1600.7746	1600.7746	N	R	145	159
PSM	RYTEHKDIPLGI	1283	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8822	22.584	3	1440.7725	1440.7725	G	R	255	267
PSM	RKPGINVASDWSIHL	1284	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=10462	25.694939131733335	3	1693.9142	1691.9102	L	R	929	944
PSM	RIHVLEAQDLIAKD	1285	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9616	23.704650117866667	3	1619.898719	1619.899505	L	R	650	664
PSM	KHFEANNGKLPDN	1286	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5278	17.381389818666666	3	1483.707967	1482.721541	R	K	957	970
PSM	RFSQGSHLAAH	1287	sp|Q9BWE0|REPI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4355	16.0628006168	3	1210.603176	1209.600303	R	R	439	450
PSM	RHLNDDDVTGSVKSE	1288	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5255	17.353390009866665	3	1670.785839	1670.785991	K	R	7	22
PSM	KEKEQLINLQNFLTTQSPSV	1289	sp|Q5TAP6|UT14C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=10621	26.30166836	3	2316.2347	2316.2320	K	R	551	571
PSM	KEYHPDKNPNAGD	1290	sp|O60884|DNJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3542	14.740632288	3	1483.669058	1483.669171	A	K	33	46
PSM	KKDPQGLGLHFY	1291	sp|O75694|NU155_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9559	23.6072947704	3	1401.750688	1401.740485	E	K	939	951
PSM	RHFNDPNADAYFTK	1292	sp|Q58A45|PAN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8087	21.547749789333334	3	1695.767680	1694.780118	S	R	581	595
PSM	KGKEGSALSHV	1293	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4553	16.373984289066666	3	1111.598867	1111.598572	C	R	152	163
PSM	RVPHTQAVVLNSKD	1294	sp|Q9UBF8|PI4KB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5747	18.0489708432	3	1564.868776	1562.852889	V	K	380	394
PSM	KAVTKYTSAK	1295	sp|P06899|H2B1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3527	14.725371932533333	3	1095.629120	1095.628809	T	-	117	127
PSM	KKLEDGPKFL	1296	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8140	21.626182931466666	3	1173.676362	1173.675760	G	K	385	395
PSM	KMKEALLSIGK	1297	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35	ms_run[1]:scan=7259	20.36756379786667	3	1232.714844	1232.716245	K	-	128	139
PSM	KKKVDDDLGTIESLEEA	1298	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9977	24.3959479408	3	1888.956821	1888.962953	T	K	1377	1394
PSM	RVLEKLGVTVR	1299	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7816	21.141227572533335	3	1268.793620	1268.792855	V	-	384	395
PSM	RKLEEEEDGKL	1300	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5391	17.541434786933333	3	1344.689342	1344.688509	K	K	163	174
PSM	KRNEFLGELQK	1301	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8128	21.606947316533333	3	1360.746816	1360.746299	A	K	326	337
PSM	RKLLEGEEERL	1302	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7691	20.97231392346667	3	1370.753124	1370.751778	Y	R	377	388
PSM	RKLEQCNTELK	1303	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	6-UNIMOD:4	ms_run[1]:scan=4245	15.884830892	3	1417.735891	1417.734748	F	K	967	978
PSM	RKSDGIYIINLK	1304	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9472	23.486239423466667	3	1418.823947	1418.824549	K	R	41	53
PSM	KKQKASQNLVVLA	1305	sp|Q9H3U1|UN45A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7442	20.62661427866667	3	1425.865961	1425.866748	E	R	170	183
PSM	RKLIVDSVKELDS	1306	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8768	22.505779067200002	3	1500.851693	1500.851158	K	K	322	335
PSM	KKAPVKLESIASVF	1307	sp|Q9UKJ3|GPTC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10236	25.02112705333333	3	1515.902210	1515.902465	A	K	306	320
PSM	RKPLQVKDESSAAT	1308	sp|Q8WWK9|CKAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4157	15.656744952	3	1528.822465	1528.820920	F	K	192	206
PSM	KRVCEEIAIIPSK	1309	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:4	ms_run[1]:scan=8238	21.757123426933333	3	1541.858262	1541.859949	N	K	32	45
PSM	RKSGVGNVFIKNLD	1310	sp|Q13310|PABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8937	22.759494316799998	3	1545.862668	1545.862726	L	K	94	108
PSM	RKLIVAYVDDLDR	1311	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9828	24.0835455568	3	1574.877774	1574.878041	R	R	1068	1081
PSM	RKYAALYQPLFDK	1312	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9762	23.9681234096	3	1611.877010	1611.877313	E	R	93	106
PSM	RKYAVLYQPLFDK	1313	sp|P55209|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10010	24.4664369088	3	1639.907314	1639.908613	E	R	104	117
PSM	KKALAAAGYDVEKNNS	1314	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5461	17.66011724026667	3	1677.868648	1677.868599	L	R	66	82
PSM	KKALAAAGYDVEKNNS	1315	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5781	18.108076650666664	2	1678.853123	1677.868599	L	R	66	82
PSM	RKAFLDNGPKTINQI	1316	sp|P78344|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8867	22.6569133904	3	1713.951020	1713.952603	P	R	312	327
PSM	KKAFSGYLGTDQSKW	1317	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9221	23.1401685528	3	1714.870317	1714.867871	G	K	185	200
PSM	RKESEFDDEPKFMS	1318	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8723	22.445388034133334	3	1743.776817	1743.777401	G	K	441	455
PSM	RKGTDVPKWISIMTE	1319	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:35	ms_run[1]:scan=9725	23.888328219733335	3	1775.921909	1775.924006	K	R	205	220
PSM	RKMAQELYMEQKNE	1320	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35	ms_run[1]:scan=5808	18.145770187999997	3	1812.848724	1812.849854	Y	R	761	775
PSM	KKNANKPLLDEIVPVY	1321	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10594	26.1927526232	3	1840.045139	1840.045835	A	R	468	484
PSM	KKCVSELEEEKQQLV	1322	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:4	ms_run[1]:scan=7945	21.3314450568	3	1845.944958	1845.950614	L	K	1962	1977
PSM	RKETPSATKQATSISSET	1323	sp|P52701|MSH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4812	16.7341275064	3	1920.975573	1920.975249	S	K	316	334
PSM	RKFDAKGNEIEPNFSAT	1324	sp|Q7Z6K5|ARPIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8165	21.659830254666666	3	1922.946583	1922.948640	R	R	72	89
PSM	RRIMPEDIIINCSKDA	1325	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4	ms_run[1]:scan=9903	24.234238370666667	3	1929.973217	1929.976452	K	K	375	391
PSM	KKPDREEIQMSNMGSNT	1326	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=3698	14.903021119733333	3	1995.901345	1995.898990	D	K	881	898
PSM	KKKPAPLPPSSSPGPPSQDS	1327	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4943	16.9051637944	3	2001.053334	2001.053105	P	R	380	400
PSM	KRMQEIEEMEKESGPGQ	1328	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=4063	15.437604699733333	3	2037.918775	2036.914306	E	K	284	301
PSM	KRSEAEEAITSFNGHKPPGSSEPITV	1329	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9498	23.518299258666666	4	2767.369564	2767.377687	D	K	156	182
PSM	RKSSGGKGGSYSQAACSDSAQGSDVSLTA	1330	sp|P01889|HLAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	16-UNIMOD:4	ms_run[1]:scan=6596	19.313135368266668	4	2818.278795	2818.278778	R	-	334	363
PSM	KAFHPTYEEKL	1331	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7472	20.665	3	1361.698	1361.6980	G	K	100	111
PSM	KAHDGGIYAISWSPDSTHLLSASGDKTS	1332	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10468	25.722	4	2900.3941	2900.3941	S	K	91	119
PSM	KAMGIMNSFVNDIFE	1333	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=11224	28.969	2	1746.7957	1746.7957	S	R	58	73
PSM	KAVAHHTTAAFI	1334	sp|P43686-2|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6622	19.364	3	1265.6881	1265.6881	A	R	186	198
PSM	KDAQHYGGWEH	1335	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5644	17.914	3	1326.5741	1326.5741	L	R	558	569
PSM	KDKMMNGGHYTYSEN	1336	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=4633	16.486	3	1789.74	1789.7400	A	R	130	145
PSM	KDKVDHIIDICFL	1337	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4	ms_run[2]:scan=10956	27.833	3	1614.844	1614.8440	F	K	327	340
PSM	KEHYVDLKD	1338	sp|P22392-2|NDKB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5501	17.7	2	1145.5717	1145.5717	L	R	49	58
PSM	KEKLHAEAISLL	1339	sp|Q9H270|VPS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9451	23.461	3	1350.7871	1350.7871	V	K	643	655
PSM	KEVHKSGYLAGD	1340	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4468	16.239	2	1302.6568	1302.6568	N	K	139	151
PSM	KFFPHVLEKE	1341	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8464	22.062	3	1272.6867	1272.6867	E	K	102	112
PSM	KFQSQPYRGGFHEDQWE	1342	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8861	22.645	3	2137.9606	2137.9606	E	K	20	37
PSM	KGFGYKGSTFH	1343	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6660	19.419	3	1227.6037	1227.6037	E	R	86	97
PSM	KGGHFYSAKPEIL	1344	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8404	21.982	3	1445.7667	1445.7667	Q	R	161	174
PSM	KHANAKPFEVPFL	1345	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10618	26.291	3	1496.814	1496.8140	L	K	205	218
PSM	KHFTILDAPGH	1346	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8252	21.776	3	1234.6459	1234.6459	K	K	152	163
PSM	KHFVGMLPEKDC	1347	sp|P60981-2|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=7760	21.068	3	1459.6952	1459.6952	F	R	52	64
PSM	KHGIKTVSQIISLQTL	1348	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10494	25.811	3	1765.0462	1765.0462	N	K	120	136
PSM	KHIAFTPESQR	1349	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5524	17.738	3	1312.6888	1312.6888	E	R	546	557
PSM	KHILQFVAIK	1350	sp|Q9BW91-2|NUDT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9211	23.127	3	1195.7441	1195.7441	G	R	144	154
PSM	KHKDAAIYLVTSLAS	1351	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10394	25.501	3	1615.8934	1615.8934	W	K	369	384
PSM	KHLQTGENHTSVDP	1352	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4117	15.562	2	1561.7485	1561.7485	A	R	189	203
PSM	KHNNCMASHLTPAVYA	1353	sp|P12532|KCRU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4	ms_run[2]:scan=8047	21.487	3	1812.84	1812.8400	R	R	58	74
PSM	KHSAENNWIEEATK	1354	sp|Q4LDG9-2|DNAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8500	22.115	3	1655.7903	1655.7903	E	R	42	56
PSM	KHVAHVLNDETQ	1355	sp|Q99633|PRP18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4272	15.938	3	1389.7001	1389.7001	S	R	300	312
PSM	KIKAPGFAHLAGLD	1356	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10024	24.494	3	1436.814	1436.8140	C	K	423	437
PSM	KIVRASNGDAWVEAHG	1357	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7246	20.355	3	1708.8645	1708.8645	F	K	143	159
PSM	KKALLALNHGLD	1358	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8230	21.748	3	1291.7612	1291.7612	A	K	580	592
PSM	KKELSDIAH	1359	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4477	16.254	2	1039.5662	1039.5662	Q	R	13	22
PSM	KKHLVVPGDTITTDTGFM	1360	sp|Q13868-3|EXOS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10016	24.48	3	1959.0135	1959.0135	T	R	23	41
PSM	KKIEHDVVM	1361	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=3789	14.993	2	1113.5852	1113.5852	R	K	59	68
PSM	KKIHTEPQLSAALEYV	1362	sp|P47897|SYQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10308	25.233	3	1825.9938	1825.9938	S	R	79	95
PSM	KKQELEEICHDLEA	1363	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=9290	23.228	3	1740.8352	1740.8352	A	R	909	923
PSM	KKSAEFLLHML	1364	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10592	26.188	3	1315.7322	1315.7322	P	K	85	96
PSM	KKTTHFVEGGDAGN	1365	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3956	15.223	3	1459.7056	1459.7056	K	R	222	236
PSM	KKYAELLEEH	1366	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7468	20.66	3	1258.6558	1258.6558	C	R	194	204
PSM	KLDPHNHVLYSN	1367	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6392	19.005	2	1435.7208	1435.7208	I	R	32	44
PSM	KLGIHEDSTNR	1368	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4194	15.748	3	1268.6473	1268.6473	L	R	438	449
PSM	KLHDMLGPHML	1369	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=8550	22.201	3	1306.6526	1306.6526	K	R	945	956
PSM	KLKNHPDYEEYINLEGT	1370	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9857	24.142	3	2062.0007	2062.0007	N	R	296	313
PSM	KLKPEGLHQLLAGFED	1371	sp|Q9BY32-3|ITPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10782	27.014	3	1793.9676	1793.9676	E	K	53	69
PSM	KLLHHVTEE	1372	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4392	16.118	2	1104.5928	1104.5928	E	K	136	145
PSM	KMLTNHTFIK	1373	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=5823	18.166	3	1247.6696	1247.6696	L	R	361	371
PSM	KMVHFLTHYAD	1374	sp|Q96A33-2|CCD47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=7605	20.838	3	1376.6547	1376.6547	T	K	316	327
PSM	KQKGHFFVEDQIYCE	1375	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=9394	23.377	3	1926.8934	1926.8934	L	K	294	309
PSM	KRGHVFEESQVAGTPMFVV	1376	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10423	25.586	3	2117.0728	2117.0728	R	K	766	785
PSM	KRIEPADAHVLQ	1377	sp|Q9GZZ1-2|NAA50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6248	18.79	3	1375.7572	1375.7572	Y	K	52	64
PSM	KRILDEIEEHNI	1378	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9833	24.095	3	1507.7995	1507.7995	K	K	197	209
PSM	KRMQGSLEAHVNGF	1379	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=7519	20.727	3	1588.778	1588.7780	Q	R	674	688
PSM	KRTGQPMIHIYLD	1380	sp|Q01844-2|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9555	23.601	3	1570.829	1570.8290	N	K	318	331
PSM	KSLGHGLINK	1381	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5121	17.168	3	1065.6295	1065.6295	N	K	416	426
PSM	KSPFEQHIKNN	1382	sp|Q92520|FAM3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5321	17.444	3	1340.6837	1340.6837	T	K	193	204
PSM	KTKFGYHIIMVEG	1383	sp|Q9Y237|PIN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=8978	22.819	3	1537.7963	1537.7963	V	R	117	130
PSM	KVKALDEEVH	1384	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4982	16.985	3	1166.6295	1166.6295	G	K	65	75
PSM	KVKEDPDGEHA	1385	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3432	14.592	3	1223.5782	1223.5782	L	R	143	154
PSM	KVKSHVYSLEGQDC	1386	sp|Q9NXE4-5|NSMA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=6034	18.486	3	1648.7879	1648.7879	F	K	137	151
PSM	KYGKAGEVFIH	1387	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7144	20.213	3	1247.6663	1247.6663	E	K	96	107
PSM	RAGVHIKLPNLG	1388	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9371	23.343	3	1273.7619	1273.7619	L	K	292	304
PSM	RAHIAQLCEKAGLLQ	1389	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=8648	22.342	3	1706.925	1706.9250	D	R	610	625
PSM	RAIEALHGHEL	1390	sp|Q96PK6-3|RBM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7281	20.398	3	1244.6626	1244.6626	L	R	50	61
PSM	RAILQNHTDFKD	1391	sp|Q86X55-2|CARM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6600	19.321	3	1456.7423	1456.7423	Q	K	174	186
PSM	RANGHLLLNSEKMS	1392	sp|Q9P2J5-3|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=5710	18.009	3	1584.8042	1584.8042	V	K	14	28
PSM	RAQDIIGHHQSED	1393	sp|Q5T200-2|ZC3HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4742	16.641	3	1504.7019	1504.7019	M	R	933	946
PSM	RARPSPGHCLPEDEDPEE	1394	sp|Q9BWH6-2|RPAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=6076	18.569	3	2089.9123	2089.9123	K	R	76	94
PSM	RDAPQDFHPDRV	1395	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6655	19.414	3	1451.6906	1451.6906	I	K	664	676
PSM	RDAVTYTEHAK	1396	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3990	15.308	3	1289.6364	1289.6364	I	R	68	79
PSM	RDEHFDFIQSHI	1397	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10297	25.2	3	1542.7215	1542.7215	Y	R	260	272
PSM	RDKLGDHQSPATPAF	1398	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7597	20.828	3	1638.8114	1638.8114	L	K	1259	1274
PSM	RDQVLHEHIQ	1399	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5262	17.362	3	1273.6527	1273.6527	L	R	1295	1305
PSM	REIEHVMYHDW	1400	sp|P82930|RT34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=8107	21.584	3	1529.6721	1529.6721	A	R	129	140
PSM	REKELSIHFVPGSC	1401	sp|Q9NZL9-3|MAT2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=9300	23.24	3	1657.8246	1657.8246	G	R	4	18
PSM	RELDFVSHHV	1402	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8155	21.646	3	1237.6204	1237.6204	S	R	87	97
PSM	REQHPTKIPVIIE	1403	sp|Q9GZQ8|MLP3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8746	22.475	3	1558.8831	1558.8831	I	R	24	37
PSM	REVGEHLVSIK	1404	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6808	19.671	3	1265.7092	1265.7092	P	K	1789	1800
PSM	RGEFSDFHGPPK	1405	sp|Q76FK4-4|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7343	20.495	3	1372.6524	1372.6524	R	K	207	219
PSM	RGFGFVTFDDHDPVD	1406	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10835	27.269	3	1722.7638	1722.7638	K	K	153	168
PSM	RGRENYSSYSSFSSPHM	1407	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:35	ms_run[2]:scan=7264	20.374	3	2006.8541	2006.8541	D	K	149	166
PSM	RHAAVLVETIK	1408	sp|O75122|CLAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6854	19.763	3	1235.735	1235.7350	E	K	250	261
PSM	RHDGYGSHGPLLPLPS	1409	sp|Q8WVV9-5|HNRLL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9657	23.772	3	1701.8587	1701.8587	F	R	253	269
PSM	RHEMPPHIYAISESAY	1410	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=8933	22.754	3	1915.8887	1915.8887	K	R	147	163
PSM	RHNAEVAAFHLD	1411	sp|O75063|XYLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8480	22.086	3	1378.6742	1378.6742	D	R	143	155
PSM	RHNTAVSQLTKA	1412	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5103	17.14	3	1324.7211	1324.7211	S	K	512	524
PSM	RHPGSFDVVHV	1413	sp|P22090|RS4Y1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8263	21.791	3	1248.6364	1248.6364	E	K	200	211
PSM	RIIGVINEHK	1414	sp|Q7Z478|DHX29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6274	18.827	3	1177.6931	1177.6931	Q	K	97	107
PSM	RILVAHDIHT	1415	sp|Q96BW5-2|PTER_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6856	19.765	3	1173.6618	1173.6618	D	K	245	255
PSM	RISAEDGLKHEYF	1416	sp|Q9UQ88-8|CD11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9019	22.878	3	1563.7682	1563.7682	R	R	83	96
PSM	RKITGLCQEEH	1417	sp|Q9NVS2-3|RT18A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:4	ms_run[2]:scan=4837	16.773	3	1369.6772	1369.6772	P	R	102	113
PSM	RKNYGVTFPIFH	1418	sp|Q8TED1|GPX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10306	25.229	3	1477.783	1477.7830	A	K	127	139
PSM	RLAGHGPKLGPVT	1419	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6391	19.003	3	1301.7568	1301.7568	E	R	391	404
PSM	RLDWPVRTLSFSHDG	1420	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10522	25.922	3	1784.8958	1784.8958	S	K	264	279
PSM	RLGDLWDYHQH	1421	sp|Q5T440|CAF17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9778	23.994	3	1438.6742	1438.6742	G	R	212	223
PSM	RLGNSHQPEKPLV	1422	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5731	18.03	3	1473.8052	1473.8052	E	R	351	364
PSM	RLSHLLSEKPED	1423	sp|Q969Z0-2|FAKD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7007	20.003	3	1422.7467	1422.7467	I	K	106	118
PSM	RLSIKHPSVNENFCNE	1424	sp|Q9Y263|PLAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=8130	21.611	3	1942.9319	1942.9319	L	K	618	634
PSM	RLTDKHQSIEEA	1425	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4800	16.721	2	1425.7212	1425.7212	A	K	697	709
PSM	RLTPADKAEHM	1426	sp|Q9Y679-3|AUP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=3679	14.883	3	1283.6292	1283.6292	T	K	258	269
PSM	RMHIEKDETPLSTPTA	1427	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=6404	19.018	3	1840.8989	1840.8989	K	R	518	534
PSM	RMKLLQFCENH	1428	sp|Q13111-2|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7857	21.2	3	1490.7122	1490.7122	G	R	556	567
PSM	RNHLTQFSPHF	1429	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9066	22.954	3	1382.6844	1382.6844	L	K	847	858
PSM	RNIIHGSDSVKSAE	1430	sp|P22392-2|NDKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4659	16.531	2	1511.7692	1511.7692	G	K	229	243
PSM	RNKTEDLEATSEHF	1431	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7594	20.823	4	1675.7802	1675.7802	L	K	45	59
PSM	RNYLLSLPHKN	1432	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8755	22.485	3	1353.7517	1353.7517	A	K	261	272
PSM	RPAVIREPHE	1433	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4899	16.845	3	1202.652	1202.6520	R	R	1195	1205
PSM	RPIHESIKTL	1434	sp|Q5VSL9-2|STRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6337	18.921	3	1192.6928	1192.6928	P	K	366	376
PSM	RPMIHELLTEGR	1435	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8851	22.629	2	1450.7715	1450.7715	A	R	695	707
PSM	RQAAAHTDHL	1436	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3747	14.95	3	1118.5581	1118.5581	R	R	453	463
PSM	RQFPVTVHFNK	1437	sp|Q8IY37|DHX37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8548	22.2	3	1371.7412	1371.7412	S	R	435	446
PSM	RQHADHLALNEEIVN	1438	sp|Q9UPN3-5|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8276	21.804	3	1757.8809	1757.8809	H	R	4035	4050
PSM	RQHVNDQKDQLSL	1439	sp|Q9P2M7|CING_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6766	19.597	3	1579.8067	1579.8067	E	R	1087	1100
PSM	RQKENSDQNHPDNQQL	1440	sp|Q9NS87-2|KIF15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3906	15.142	3	1949.894	1949.8940	K	K	1130	1146
PSM	RQKQLLDMHF	1441	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9764	23.971	3	1314.6867	1314.6867	F	K	205	215
PSM	RQLSHLQQHT	1442	sp|Q5T0B9|ZN362_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3923	15.169	3	1246.6531	1246.6531	F	R	293	303
PSM	RQQELTHQEH	1443	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3499	14.701	3	1304.6222	1304.6222	E	R	178	188
PSM	RRLGQHVVGMAPLSVGSLDDEPGGEAET	1444	sp|P43897|EFTS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=9366	23.337	4	2892.4036	2892.4036	G	K	254	282
PSM	RSLENYHFVDEHG	1445	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8077	21.537	3	1601.7223	1601.7223	L	K	91	104
PSM	RTCILGTHHE	1446	sp|O00291-3|HIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=4832	16.761	3	1222.5877	1222.5877	A	K	61	71
PSM	RTFHDLEGNAVK	1447	sp|Q7Z2K6|ERMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6687	19.461	3	1385.7052	1385.7052	T	R	693	705
PSM	RTHNDIIHNENM	1448	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:35	ms_run[2]:scan=4099	15.503	3	1508.679	1508.6790	K	R	547	559
PSM	RTIACPHKGCT	1449	sp|P25490|TYY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=3595	14.804	3	1299.6176	1299.6176	P	K	294	305
PSM	RTKSGNILLH	1450	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5654	17.923	3	1137.6618	1137.6618	Y	K	1010	1020
PSM	RTRNLIAPIFLH	1451	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10317	25.259	3	1449.8569	1449.8569	L	R	101	113
PSM	RTSIHDFLTKDS	1452	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8763	22.499	3	1418.7154	1418.7154	R	R	1743	1755
PSM	RVIHLSLAPK	1453	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7845	21.185	3	1132.7081	1132.7081	E	R	1820	1830
PSM	RVLSTVHTHSSV	1454	sp|Q13155-2|AIMP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4838	16.776	3	1321.7102	1321.7102	F	K	78	90
PSM	RVREVFGSGTACQVCPVH	1455	sp|O15382-2|BCAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=7903	21.264	3	2057.9887	2057.9887	G	R	239	257
PSM	RVTHELQAMKD	1456	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=3719	14.924	3	1342.6663	1342.6663	L	K	61	72
PSM	RYAAVHVHTNAA	1457	sp|P49593-2|PPM1F_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4678	16.556	3	1308.6687	1308.6687	A	R	103	115
PSM	THQSHAYHMV	1458	sp|P00414|COX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=3683	14.889	2	1225.5298	1225.5298	M	K	2	12
PSM	REVGEHLVSIK	1459	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6797	19.652231050666668	3	1265.710158	1265.709185	P	K	1969	1980
PSM	RLYSLALHPNAFK	1460	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9519	23.55117823866667	3	1528.850842	1528.851433	K	R	1062	1075
PSM	KRPPSAFFLFCSEH	1461	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:4	ms_run[1]:scan=10794	27.071569472533334	3	1722.819539	1721.834797	P	R	96	110
PSM	KKPLFHGDSEIDQLF	1462	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10538	25.99063519066667	3	1773.911944	1772.909735	T	R	200	215
PSM	RSVLLQHQLTHGNE	1463	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6914	19.848788318133334	3	1630.862805	1630.853952	D	K	674	688
PSM	KIHLAQSLH	1464	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6020	18.470392985066667	2	1045.604173	1045.603263	P	K	925	934
PSM	RHAAVLVETIK	1465	sp|O75122|CLAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6842	19.72870800933333	3	1235.735513	1235.735006	E	K	250	261
PSM	RHPAPEDPDWIK	1466	sp|Q9UKN8|TF3C4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7689	20.970012113333333	3	1459.721290	1459.720812	A	R	796	808
PSM	RGHPIPHGGMQGGFGGQS	1467	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:35	ms_run[1]:scan=5153	17.2073703648	3	1791.804472	1791.822335	S	R	884	902
PSM	RFNSSDHIESKGI	1468	sp|Q96HR8|NAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6276	18.828536646933333	3	1489.744164	1488.732105	L	K	255	268
PSM	RELHLEGNFLH	1469	sp|Q8TCA0|LRC20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9200	23.1126727832	3	1363.699250	1363.699683	L	R	77	88
PSM	RGVAMNPVEHPFGGGNHQHIG	1470	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:35	ms_run[1]:scan=7389	20.554183409333334	4	2227.031820	2226.050103	V	K	200	221
PSM	KKVVVSPTK	1471	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3573	14.783755080533332	2	984.633419	984.633167	A	K	62	71
PSM	KKIGVNQPK	1472	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3583	14.793034179466668	2	1010.624314	1010.623664	D	R	222	231
PSM	KPKDMLGPK	1473	sp|P07954|FUMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4277	15.947238953066666	2	1012.574208	1012.573937	V	-	502	511
PSM	KKILIEDWK	1474	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8513	22.13282101813333	3	1171.697197	1171.696495	L	K	141	150
PSM	KKELGLEKDD	1475	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4471	16.244707726399998	2	1173.627007	1173.624118	I	K	404	414
PSM	KKLEDGPKFL	1476	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=12266	32.9371220312	2	1173.675251	1173.675760	G	K	385	395
PSM	KKCDLISIPK	1477	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4	ms_run[1]:scan=7793	21.111406831733333	3	1200.690314	1200.690030	N	K	418	428
PSM	RMHEATSAETK	1478	sp|Q96RU2|UBP28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:35	ms_run[1]:scan=3255	14.309197573333334	3	1277.603567	1275.587750	N	R	125	136
PSM	RKDQEALEAVK	1479	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4916	16.865289094666668	3	1285.699008	1285.699014	Y	R	445	456
PSM	KGFGHGAGLLAHQ	1480	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7270	20.380194945066666	3	1291.676662	1291.678554	G	R	287	300
PSM	KEQIKWSLLR	1481	sp|P61923|COPZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9538	23.581234341066665	3	1299.766204	1299.766306	A	-	168	178
PSM	KKYDEAIKCY	1482	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=6029	18.480513895199998	3	1316.644349	1316.643474	D	R	94	104
PSM	RKLDAEDVIGSR	1483	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7744	21.04689904426667	3	1357.731085	1357.731377	K	R	2891	2903
PSM	RKVGFALDLPPR	1484	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9299	23.2390615296	3	1367.803893	1367.803754	G	R	217	229
PSM	RKVGFALDLPPR	1485	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10248	25.063024493866667	3	1367.803987	1367.803754	G	R	217	229
PSM	KFQQHIQAQQK	1486	sp|Q7L7X3|TAOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3910	15.146817013600002	3	1382.756690	1382.741882	K	K	535	546
PSM	KKTPANEKVEIQ	1487	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4376	16.092400811733334	3	1383.772785	1383.772179	G	K	373	385
PSM	KKCSESIPKDSL	1488	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:4	ms_run[1]:scan=5665	17.933525722666666	3	1390.712772	1390.712616	C	R	22	34
PSM	KRESQSVEEALK	1489	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5412	17.568694792	3	1402.743161	1402.741607	R	K	277	289
PSM	KKVKTDTVLILC	1490	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=8689	22.401633725333333	3	1416.836819	1416.837422	S	R	143	155
PSM	KKTEKEESTEVL	1491	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4927	16.878551624533333	3	1419.744324	1419.745690	G	K	249	261
PSM	KRETYTEDFIK	1492	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7894	21.251980870933334	3	1428.725118	1428.724895	S	K	65	76
PSM	RKQQTLEAEEAK	1493	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3852	15.061896751733334	2	1429.753500	1429.752506	R	R	237	249
PSM	RRPPAAPSRPTII	1494	sp|P50570|DYN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7222	20.325395606666667	3	1430.845447	1430.847016	S	R	849	862
PSM	KKYPDRVPVIVE	1495	sp|O95166|GBRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8216	21.727382010666666	3	1441.827592	1441.829300	R	K	23	35
PSM	RKIAFAITAIKGVG	1496	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9888	24.204198978666668	3	1443.892791	1443.892569	R	R	24	38
PSM	KKLNVTEQEKID	1497	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5801	18.13944322213333	3	1444.778044	1443.793309	S	K	80	92
PSM	RKQSEGLTKEYD	1498	sp|P51572|BAP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4529	16.34205095946667	3	1452.723280	1452.720872	M	R	213	225
PSM	RKLEEDDQAKDI	1499	sp|O95619|YETS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5243	17.330565184266668	3	1458.732054	1458.731437	I	-	216	228
PSM	KRASEDTTSGSPPK	1500	sp|Q9BZZ5|API5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3301	14.425096822133334	3	1459.727675	1459.726686	Q	K	454	468
PSM	RKDLDQAKEEVF	1501	sp|Q6ZRS2|SRCAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7575	20.798100617600003	3	1476.756462	1476.757257	A	R	2343	2355
PSM	KRPEKPVPPPPPIA	1502	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6562	19.267571089333334	3	1521.903244	1521.903134	P	K	411	425
PSM	KKMQAGEEVTELR	1503	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:35	ms_run[1]:scan=5435	17.6046197824	3	1533.789442	1533.782092	Y	R	823	836
PSM	RKEDWNEIDPIK	1504	sp|Q10471|GALT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9058	22.94259270026667	3	1541.786720	1541.783807	G	K	41	53
PSM	KKITIKNDPSLPEP	1505	sp|O43776|SYNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7767	21.077950948799998	3	1578.898901	1578.898108	A	K	99	113
PSM	KKKDTAASGYGTQNI	1506	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5344	17.4694621568	3	1580.815853	1580.815835	E	R	19	34
PSM	KKKTIVTDVFQGSM	1507	sp|Q53GS9|SNUT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:35	ms_run[1]:scan=8576	22.232985077333336	3	1596.855554	1596.854529	K	R	340	354
PSM	KRPLLAFACDDKDG	1508	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:4	ms_run[1]:scan=8728	22.44935023093333	3	1604.797930	1604.798077	P	K	318	332
PSM	RKGVAINMVTEEDK	1509	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:35	ms_run[1]:scan=7154	20.2269356352	3	1604.821350	1604.819206	G	R	368	382
PSM	RKGVAINFVTEEDK	1510	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8316	21.86428767973333	3	1604.852643	1604.852221	G	R	369	383
PSM	RRGPPPPPTASEPTR	1511	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4503	16.281597128799998	3	1614.861038	1614.859037	D	R	1080	1095
PSM	KRAATLAQELEKFN	1512	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9886	24.201776184266667	3	1617.893466	1617.883855	S	R	384	398
PSM	KKPWQLQGEVTAQK	1513	sp|O00566|MPP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7334	20.48433388373333	3	1642.897689	1639.904590	E	R	381	395
PSM	RKESYSIYVYKVL	1514	sp|P33778|H2B1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10244	25.049078764266667	3	1646.905516	1646.903193	S	K	34	47
PSM	KRMAGTAFDFENMK	1515	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=7474	20.667655579999998	3	1676.765013	1676.765063	Y	R	422	436
PSM	KKMMTKEELEEEQ	1516	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=3817	15.024209504266667	3	1683.771283	1683.769539	Y	R	154	167
PSM	KRMTGSEFDFEEMK	1517	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:35	ms_run[1]:scan=8966	22.801287706933334	3	1749.769404	1749.770207	Y	R	422	436
PSM	RRPDQQLQGEGKIID	1518	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7052	20.0745765304	3	1751.926517	1751.927845	G	R	111	126
PSM	RKIEEVRDAMENEM	1519	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=4530	16.3443366216	3	1780.807561	1780.808384	D	R	466	480
PSM	RAGHFEPLHGAAAVPPLIPSSQH	1520	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9562	23.612198775733336	4	2389.247855	2388.245097	S	K	1210	1233
PSM	RRAIESMEQQLSELK	1521	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10054	24.571413337066666	3	1816.944589	1816.946532	K	K	1023	1038
PSM	RKDDFYYLSQEDKE	1522	sp|Q9HBM0|VEZA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8819	22.579716083999998	3	1834.836462	1834.837358	F	R	557	571
PSM	KKKIPDPDSDDVSEVDA	1523	sp|P51532|SMCA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6540	19.233071351466666	3	1856.901207	1856.900353	E	R	687	704
PSM	KLRPPGAEKPSWLEEQ	1524	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8913	22.72449440293333	3	1863.984988	1863.984297	I	-	326	342
PSM	RKNEGVIEFVSYSDMK	1525	sp|Q08170|SRSF4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10033	24.513792692	3	1900.933623	1900.935298	G	R	139	155
PSM	KKAPKEDVDAAV	1526	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4522	16.320851029866667	2	1269.695571	1269.692866	A	K	770	782
PSM	RRDCLADVDTKPAYQNL	1527	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4	ms_run[1]:scan=8910	22.719825863466667	3	2033.993844	2033.995273	F	R	71	88
PSM	KKGEDVLGSVR	1528	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5775	18.095433021333335	2	1186.666700	1186.666986	G	R	108	119
PSM	RKNTDKNYLNFVSPLPDIVGQ	1529	sp|Q9Y2X9|ZN281_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10998	28.038336160266667	3	2417.271860	2417.270309	S	K	472	493
PSM	KKLSSQLEEERS	1530	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4822	16.7478109272	2	1432.753953	1432.752172	Q	R	162	174
PSM	KAFVDFLSDEIKEE	1531	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11074	28.362	3	1668.8247	1668.8247	D	R	80	94
PSM	KAKDPFAHLP	1532	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8364	21.931	3	1122.6186	1122.6186	P	K	275	285
PSM	KAKSHLEVPLEENVN	1533	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8106	21.582	3	1705.8999	1705.8999	E	R	119	134
PSM	KDKMMNGGHYTYSEN	1534	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=3929	15.182	3	1805.7349	1805.7349	A	R	130	145
PSM	KDPKNQGLFH	1535	sp|Q9BTC0-1|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5677	17.946	3	1182.6146	1182.6146	L	R	733	743
PSM	KDRTGFAVIHDAA	1536	sp|P42773|CDN2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7711	20.998	3	1399.7208	1399.7208	L	R	66	79
PSM	KDVKHMNSAGVLATL	1537	sp|O95861-3|BPNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9317	23.266	3	1582.8501	1582.8501	H	R	219	234
PSM	KEHEEHVCSILASLL	1538	sp|Q8WYA6-3|CTBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:4	ms_run[2]:scan=11141	28.633	3	1763.8876	1763.8876	E	R	149	164
PSM	KEHEVTIFVR	1539	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7892	21.248	3	1256.6877	1256.6877	L	R	108	118
PSM	KEHFAQFGHV	1540	sp|Q9GZT3|SLIRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7650	20.909	3	1198.5883	1198.5883	L	R	36	46
PSM	KEHHNGNFTDPSSVNE	1541	sp|Q96GC9|VMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5418	17.577	3	1810.7871	1810.7871	N	K	17	33
PSM	KEKGIGTLHL	1542	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8283	21.813	3	1094.6448	1094.6448	F	K	346	356
PSM	KEKLFNEHIEALT	1543	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9220	23.139	3	1570.8355	1570.8355	E	K	921	934
PSM	KERYSDFVVHEIG	1544	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9452	23.462	3	1577.7838	1577.7838	L	K	131	144
PSM	KFAHGNAELHEWEE	1545	sp|Q8IWR0-2|Z3H7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8087	21.548	3	1695.7641	1695.7641	C	R	118	132
PSM	KFGLIDHLHYS	1546	sp|Q6NSI4-3|RADX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9756	23.961	3	1328.6877	1328.6877	K	R	367	378
PSM	KFHNELNAHI	1547	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7470	20.663	3	1221.6255	1221.6255	E	K	274	284
PSM	KFIHVSHLNANI	1548	sp|Q16795|NDUA9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8773	22.513	3	1391.7674	1391.7674	E	K	163	175
PSM	KFSVTHHYLVQESTD	1549	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8085	21.546	3	1789.8635	1789.8635	F	K	27	42
PSM	KGSPHPGVGVPTYYNHPEALK	1550	sp|Q6PJG2|MDEAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8014	21.433	4	2247.1437	2247.1437	T	R	146	167
PSM	KHFIECSLDCH	1551	sp|Q15542-2|TAF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7078	20.12	3	1444.6228	1444.6228	L	R	222	233
PSM	KHIVENAVQKEL	1552	sp|O00410-2|IPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7211	20.315	3	1406.7882	1406.7882	L	R	479	491
PSM	KHKASVEDADTQS	1553	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3468	14.651	2	1414.6688	1414.6688	A	K	295	308
PSM	KHLEFMNQLK	1554	sp|Q07866-8|KLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=6724	19.521	3	1302.6754	1302.6754	K	K	146	156
PSM	KHLEINPDHPIVETL	1555	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9692	23.828	3	1753.9363	1753.9363	K	R	624	639
PSM	KHNNCMASHLTPAVYA	1556	sp|P12532|KCRU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=6898	19.821	3	1828.8349	1828.8349	R	R	58	74
PSM	KHSQHYQIPDDFVADV	1557	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10215	24.963	3	1897.8959	1897.8959	K	R	1013	1029
PSM	KHTLTQIKDAV	1558	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6988	19.975	3	1252.7139	1252.7139	N	R	336	347
PSM	KHVEDLLTKL	1559	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9614	23.702	3	1194.6972	1194.6972	Q	K	252	262
PSM	KHVLFPLKSEFVIL	1560	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11006	28.075	3	1668.9967	1668.9967	I	R	265	279
PSM	KHYASEEIKE	1561	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4290	15.97	3	1232.6037	1232.6037	R	K	1968	1978
PSM	KHYYDGTIFH	1562	sp|Q13356|PPIL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8167	21.662	3	1279.5986	1279.5986	K	R	313	323
PSM	KIASKYDHQAEEDL	1563	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6545	19.245	3	1645.7948	1645.7948	N	R	19	33
PSM	KIIKQIISHSS	1564	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6237	18.775	3	1252.7503	1252.7503	K	K	762	773
PSM	KIKSEHPGLSIGDTA	1565	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6964	19.945	3	1551.8257	1551.8257	P	K	112	127
PSM	KILHDFYIEKE	1566	sp|Q9H6T3-3|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8903	22.71	3	1433.7555	1433.7555	V	K	437	448
PSM	KIRIDAMHGVVGPYV	1567	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=9316	23.264	3	1669.8974	1669.8974	L	K	22	37
PSM	KIYHPNVDKLG	1568	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6645	19.401	3	1282.7034	1282.7034	T	R	74	85
PSM	KKAAGHPGDPESQQ	1569	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3354	14.494	3	1448.7008	1448.7008	A	R	1170	1184
PSM	KKFSAHYDAVEAEL	1570	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8876	22.669	3	1606.7991	1606.7991	D	K	47	61
PSM	KKIEISQHA	1571	sp|P61513|RL37A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4223	15.842	2	1052.5978	1052.5978	V	K	27	36
PSM	KKIGILHENFQTL	1572	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9547	23.59	3	1539.8773	1539.8773	D	K	331	344
PSM	KKLIYFQLH	1573	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9333	23.288	3	1188.7019	1188.7019	S	R	365	374
PSM	KKNDHDGDGFISP	1574	sp|Q9Y680-3|FKBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6769	19.601	3	1428.6634	1428.6634	F	K	198	211
PSM	KKYPYWPHQPIENL	1575	sp|O75947-2|ATP5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9831	24.091	3	1811.9359	1811.9359	K	-	124	138
PSM	KLFHTAPNVPHYA	1576	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8180	21.679	3	1493.7779	1493.7779	H	K	298	311
PSM	KLHDLLGPHML	1577	sp|Q8TDI0|CHD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:35	ms_run[2]:scan=9146	23.048	3	1288.6962	1288.6962	K	R	919	930
PSM	KLHDMLGPHML	1578	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9507	23.532	3	1290.6577	1290.6577	K	R	945	956
PSM	KLHEDLCEK	1579	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=4323	16.017	2	1170.5703	1170.5703	T	R	361	370
PSM	KLHIVNCGGGH	1580	sp|Q9NNW5|WDR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=5022	17.032	3	1190.5979	1190.5979	E	R	647	658
PSM	KLHLNQNGDHNT	1581	sp|Q86X83-2|COMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4112	15.544	3	1389.6749	1389.6749	I	K	151	163
PSM	KLIEKNYFLH	1582	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8873	22.664	3	1303.7289	1303.7289	E	K	567	577
PSM	KLKALDESHNQNL	1583	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6480	19.124	3	1508.7947	1508.7947	Q	K	898	911
PSM	KLKDHMLIPVSMSELE	1584	sp|O94760-2|DDAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=10389	25.483	3	1884.9689	1884.9689	E	K	148	164
PSM	KLKHYGPGWVSMANAG	1585	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=7668	20.934	3	1730.8563	1730.8563	F	K	129	145
PSM	KLLTKNGHVY	1586	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5392	17.542	3	1171.6713	1171.6713	L	K	63	73
PSM	KLVIKNQQFH	1587	sp|Q15233|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6149	18.664	3	1253.7244	1253.7244	E	K	239	249
PSM	KLVLIRHGESAWNLEN	1588	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9735	23.908	3	1878.0112	1878.0112	Y	R	5	21
PSM	KLYHGLELAK	1589	sp|O75419-2|CDC45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7562	20.783	3	1170.6761	1170.6761	D	K	365	375
PSM	KMLTNHTFIK	1590	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7061	20.09	3	1231.6747	1231.6747	L	R	361	371
PSM	KNPHAPTIHFNY	1591	sp|P36551|HEM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8720	22.44	3	1437.7153	1437.7153	P	R	250	262
PSM	KPEVVKTHL	1592	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5202	17.278	2	1049.6233	1049.6233	E	R	72	81
PSM	KPGSIKPHQ	1593	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3420	14.577	2	990.56106	990.5611	V	K	342	351
PSM	KPKGQNSLALH	1594	sp|P11233|RALA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4476	16.254	3	1191.6724	1191.6724	N	K	5	16
PSM	KPPYEHPKDL	1595	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5447	17.628	3	1222.6346	1222.6346	H	K	530	540
PSM	KQCHECIEHI	1596	sp|Q9H3G5|CPVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=5342	17.468	3	1352.5965	1352.5965	Q	R	269	279
PSM	KQGLLDKHG	1597	sp|O60832-2|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4047	15.396	2	994.55598	994.5560	I	K	394	403
PSM	KQHVSIIEKET	1598	sp|Q16850-2|CP51A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5271	17.373	3	1310.7194	1310.7194	F	K	70	81
PSM	KQTQPERYIHLENLLA	1599	sp|Q2TAY7|SMU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10433	25.613	3	1952.048	1952.0480	L	R	107	123
PSM	KRGQTCVVHYTGMLEDG	1600	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=7305	20.444	3	1965.9037	1965.9037	P	K	18	35
PSM	KRIMLFTNEDNPHGNDSA	1601	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=7860	21.205	3	2073.9538	2073.9538	H	K	123	141
PSM	KRNLLYVADSYNH	1602	sp|Q8NBF2-2|NHLC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8656	22.354	3	1591.8107	1591.8107	K	K	126	139
PSM	KSCGKDGFHI	1603	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=6602	19.326	3	1147.5444	1147.5444	V	R	78	88
PSM	KSDIASHFSNK	1604	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5311	17.432	2	1232.6149	1232.6149	W	R	797	808
PSM	KSHHANSPTAGAA	1605	sp|Q15555-2|MARE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3345	14.481	3	1247.6007	1247.6007	K	K	194	207
PSM	KSLLIKHFDP	1606	sp|Q8IXH7-4|NELFD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8508	22.124	3	1196.6917	1196.6917	L	R	111	121
PSM	KTKHMLPSGF	1607	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7897	21.256	2	1144.6063	1144.6063	K	R	65	75
PSM	KYIVAYHAAGK	1608	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5736	18.036	3	1219.6713	1219.6713	K	K	229	240
PSM	KYSTHLHLAEDCM	1609	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=6957	19.93	3	1619.7072	1619.7072	S	K	343	356
PSM	RADHLEELLEQH	1610	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9738	23.913	3	1488.7321	1488.7321	K	R	1025	1037
PSM	RAHVFQIDPNTK	1611	sp|Q86YM7-3|HOME1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7371	20.535	3	1424.7524	1424.7524	T	K	10	22
PSM	RALTQTGGPHVKA	1612	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4654	16.518	2	1334.7419	1334.7419	A	R	1283	1296
PSM	RATDLILDHIRE	1613	sp|Q86Y79|PTH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9882	24.194	3	1450.7892	1450.7892	D	R	194	206
PSM	RCKDDEFTHLYTLIV	1614	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4	ms_run[2]:scan=11101	28.47	3	1908.9404	1908.9404	I	R	162	177
PSM	RCLALATHDNPLR	1615	sp|P16615-5|AT2A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4	ms_run[2]:scan=7791	21.109	4	1535.7991	1535.7991	L	R	559	572
PSM	RCVSKYLDIHE	1616	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4	ms_run[2]:scan=8115	21.592	3	1418.6976	1418.6976	D	R	53	64
PSM	RDHMAQHFNGLLEIA	1617	sp|Q9Y5L0-3|TNPO3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=10108	24.693	3	1766.8522	1766.8522	C	R	531	546
PSM	RDKSFILEEHMD	1618	sp|Q6NVY1-2|HIBCH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8890	22.691	3	1518.7137	1518.7137	D	K	255	267
PSM	RDPHSGHFVAL	1619	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7734	21.027	3	1234.6207	1234.6207	A	K	24	35
PSM	RDVCSHFDLNK	1620	sp|O60287|NPA1P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=6827	19.698	3	1389.6459	1389.6459	A	K	166	177
PSM	REHLLTNHL	1621	sp|P10155-3|RO60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7112	20.166	3	1131.6149	1131.6149	V	K	255	264
PSM	REHLNIQDPDK	1622	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5596	17.844	3	1363.6844	1363.6844	Y	R	210	221
PSM	REIISHDTR	1623	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3810	15.016	3	1125.5891	1125.5891	D	R	27	36
PSM	REISYAIKNIHGV	1624	sp|P50570-3|DYN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8768	22.506	3	1498.8256	1498.8256	R	R	386	399
PSM	RENNTHPEWSFTTVR	1625	sp|Q9P289-2|STK26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9160	23.064	3	1872.8867	1872.8867	S	K	239	254
PSM	REQSLHSFHTLFC	1626	sp|Q92800-5|EZH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:4	ms_run[2]:scan=9891	24.209	3	1660.778	1660.7780	Q	R	148	161
PSM	RFVTQIQHIH	1627	sp|Q92833-2|JARD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7299	20.435	3	1277.6993	1277.6993	M	K	568	578
PSM	RGNTSGSHIVNHLV	1628	sp|Q92900-2|RENT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6789	19.633	3	1489.775	1489.7750	G	R	148	162
PSM	RGSNTTSHLHQAVA	1629	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3978	15.281	3	1477.7386	1477.7386	K	K	301	315
PSM	RHIDLYDKDEIE	1630	sp|Q9UJA3-2|MCM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8015	21.435	3	1544.7471	1544.7471	T	R	105	117
PSM	RHLLDELYITK	1631	sp|Q8NEL9-3|DDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9960	24.359	3	1399.7823	1399.7823	E	R	159	170
PSM	RHMQANPEPPK	1632	sp|Q15404-2|RSU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=3536	14.734	3	1319.6405	1319.6405	G	K	195	206
PSM	RHVEDGNVTVQHAALSAL	1633	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9203	23.117	3	1915.9864	1915.9864	D	R	277	295
PSM	RHYPVFENPKQG	1634	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6676	19.442	3	1470.7368	1470.7368	S	K	692	704
PSM	RIAVSNLHKET	1635	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5111	17.15	3	1266.7044	1266.7044	A	K	80	91
PSM	RIKMIASDSH	1636	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5075	17.098	3	1156.6023	1156.6023	L	R	361	371
PSM	RIPHLAIHLQ	1637	sp|Q9ULA0-2|DNPEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9320	23.27	3	1196.7142	1196.7142	L	R	163	173
PSM	RIVKEPTSHDN	1638	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3621	14.827	3	1294.663	1294.6630	V	K	1321	1332
PSM	RKAVDALLTHC	1639	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=7308	20.447	3	1282.6816	1282.6816	V	K	37	48
PSM	RKIQDHQVVINCAIP	1640	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4	ms_run[2]:scan=8624	22.299	3	1789.9621	1789.9621	G	K	51	66
PSM	RKPGYIHSGATTSTM	1641	sp|Q9Y4J8-6|DTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:35	ms_run[2]:scan=4029	15.369	3	1621.7882	1621.7882	A	R	324	339
PSM	RKQQQELHLAL	1642	sp|Q96EU6-2|RRP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8780	22.523	3	1362.7732	1362.7732	E	K	179	190
PSM	RKQSNPLLIHVDT	1643	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8693	22.407	3	1519.8471	1519.8471	S	K	664	677
PSM	RKVACIGAWHPA	1644	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=7757	21.065	3	1364.7136	1364.7136	L	R	249	261
PSM	RKVMSQNFTNCHT	1645	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=5469	17.668	3	1621.7453	1621.7453	H	K	63	76
PSM	RKVVENEIYSESH	1646	sp|Q96I51-2|RCC1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5951	18.373	3	1588.7845	1588.7845	G	R	208	221
PSM	RLEHPVLHVSWNDA	1647	sp|Q8NBJ7-2|SUMF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9582	23.654	3	1671.8481	1671.8481	E	R	51	65
PSM	RLFGNILDKH	1648	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9426	23.428	3	1211.6775	1211.6775	Y	R	1228	1238
PSM	RMFPHHSITESVNYDV	1649	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=8518	22.139	3	1946.8945	1946.8945	T	K	66	82
PSM	RMKEYGEQIDPSTH	1650	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=5375	17.507	3	1705.773	1705.7730	D	R	88	102
PSM	RMVNHFIAEFK	1651	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9354	23.317	3	1390.718	1390.7180	N	R	236	247
PSM	RNIKILEDEPHS	1652	sp|O14497-2|ARI1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7330	20.478	3	1449.7576	1449.7576	H	K	1733	1745
PSM	RNKDPILHVL	1653	sp|Q96S19-3|MTL26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9020	22.881	3	1203.7088	1203.7088	E	R	9	19
PSM	RNMSVIAHVDHG	1654	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=6228	18.763	3	1350.6463	1350.6463	I	K	20	32
PSM	RPAVKQFHDS	1655	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4145	15.636	3	1183.6098	1183.6098	R	K	139	149
PSM	RPEGKDFSIH	1656	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5660	17.929	3	1184.5938	1184.5938	T	R	20	30
PSM	RPFQSIIHAK	1657	sp|Q16539-5|MK14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7400	20.568	3	1195.6826	1195.6826	S	R	57	67
PSM	RPIVNHPHYEDAGL	1658	sp|Q2PZI1|D19L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7453	20.641	3	1616.8059	1616.8059	L	R	568	582
PSM	RQGTHITVVSHS	1659	sp|P11177-3|ODPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4464	16.233	3	1320.6898	1320.6898	E	R	214	226
PSM	RQHLSSVVFIKN	1660	sp|O43324|MCA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8148	21.637	2	1426.8045	1426.8045	I	R	156	168
PSM	RQQANHPYWADTVK	1661	sp|O95985-3|TOP3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7345	20.498	3	1712.8383	1712.8383	L	R	355	369
PSM	RQQPGPSEHIER	1662	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4008	15.342	3	1432.7171	1432.7171	K	R	143	155
PSM	RQVHPFHVYPQPGMQ	1663	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:35	ms_run[2]:scan=7751	21.057	3	1835.889	1835.8890	N	R	106	121
PSM	RRLEFPSGETIVMHNP	1664	sp|Q9Y6Y8-2|S23IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=9060	22.944	3	1897.9469	1897.9469	H	K	381	397
PSM	RRPVHGESDTEQLQDDDIETT	1665	sp|Q9BW27-3|NUP85_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6936	19.893	3	2440.1102	2440.1102	S	K	564	585
PSM	RSPFEHSVEH	1666	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5144	17.198	3	1223.5683	1223.5683	S	K	1687	1697
PSM	RSQHCKPEEGLEA	1667	sp|P43360|MAGA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=4438	16.185	3	1539.71	1539.7100	Q	R	6	19
PSM	RSQLQQFSHIK	1668	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7150	20.223	3	1370.7419	1370.7419	P	K	953	964
PSM	RSTSHKPDEIYGMIE	1669	sp|Q86U44|MTA70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=7457	20.646	3	1777.8305	1777.8305	V	R	508	523
PSM	RVDTCHTPFGK	1670	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4	ms_run[2]:scan=5663	17.932	3	1316.6296	1316.6296	E	R	761	772
PSM	RVQPGHCYHLYNGL	1671	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=8604	22.273	3	1712.8205	1712.8205	G	R	605	619
PSM	RVSVADHSLHLS	1672	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7579	20.804	3	1319.6946	1319.6946	S	K	66	78
PSM	RWATHGEPSPVNSHPQ	1673	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5761	18.067	3	1798.8499	1798.8499	T	R	95	111
PSM	RYEDHTIFHDISL	1674	sp|P82675|RT05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10572	26.116	3	1644.7896	1644.7896	E	R	284	297
PSM	RYEIKDIHVPP	1675	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9707	23.85	3	1365.7405	1365.7405	L	R	174	185
PSM	THQSHAYHMV	1676	sp|P00414|COX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4855	16.793	3	1209.5349	1209.5349	M	K	2	12
PSM	RLVNHFVEEFK	1677	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9328	23.283069806133334	3	1417.735775	1416.751384	N	R	236	247
PSM	KNSKHEELMLGDPCL	1678	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=8922	22.737533958133334	3	1785.837434	1785.838956	N	K	647	662
PSM	KAKHLAAVEE	1679	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4037	15.3803928088	2	1094.610964	1094.608408	T	R	880	890
PSM	RQENLSWQHELHQL	1680	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=9883	24.195986569333336	3	1818.9162	1816.8962	L	R	2939	2953
PSM	RKAVLWQDSFSPHL	1681	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10414	25.560219103199998	3	1682.890474	1682.889275	K	K	9	23
PSM	RNHEGDEDDSHV	1682	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3520	14.720236656800001	3	1408.560277	1408.560349	Q	R	182	194
PSM	RETAQAIKGMHI	1683	sp|P18621|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:35	ms_run[1]:scan=7832	21.1678148688	3	1369.699928	1369.713619	T	R	30	42
PSM	RSHHAPMSPGSSGGGGQPLA	1684	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:35	ms_run[1]:scan=4393	16.1191690456	3	1902.875746	1902.875492	Q	R	356	376
PSM	RSLGTADVHFER	1685	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7398	20.56654166026667	3	1386.701765	1386.700411	G	K	144	156
PSM	RRGEQADHFTQTPLDPGSQVLV	1686	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10012	24.4697409688	3	2451.232323	2450.230235	T	R	74	96
PSM	RNHIILQENAQHAT	1687	sp|Q69YN2|C19L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=5724	18.02296263226667	3	1644.8882	1643.8482	Y	R	208	222
PSM	REPGPGHEHF	1688	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4904	16.851328780533333	3	1162.545410	1161.531555	N	R	1186	1196
PSM	RIIGVINEHK	1689	sp|Q7Z478|DHX29_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6267	18.818074076000002	3	1177.694084	1177.693141	Q	K	97	107
PSM	KLTTHKEELYP	1690	sp|Q9BUK6|MSTO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6574	19.283791826933335	2	1357.715790	1357.724166	G	K	100	111
PSM	RRGPPPPPTASEPTR	1691	sp|O14776|TCRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4548	16.3667548448	4	1614.860321	1614.859037	D	R	1080	1095
PSM	KKPEAPKLS	1692	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4088	15.483163005866666	2	996.597395	996.596781	E	K	442	451
PSM	KKPKVPQST	1693	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3498	14.700334681333334	2	1011.606620	1011.607680	P	-	482	491
PSM	KKISAIIEK	1694	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5350	17.475139280266667	2	1028.659890	1028.659381	W	R	533	542
PSM	KKAFMGPLK	1695	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:35	ms_run[1]:scan=4965	16.944644764	2	1034.594727	1034.594673	E	K	385	394
PSM	RKADIDLTK	1696	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4799	16.71872545093333	3	1058.608893	1058.608408	L	R	46	55
PSM	KKAAGKGDVPT	1697	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3497	14.6996491864	2	1070.607731	1070.608408	E	K	120	131
PSM	KKNDQIKDL	1698	sp|Q9NQ48|LZTL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4898	16.8438954728	2	1100.619206	1100.618973	T	R	280	289
PSM	KAVTKYTSSK	1699	sp|Q96A08|H2B1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3450	14.618599699733332	3	1111.626390	1111.623724	T	-	118	128
PSM	KKGEDVLGSVR	1700	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5733	18.033150485866667	3	1186.666720	1186.666986	G	R	108	119
PSM	KKVQTEVLQK	1701	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4046	15.394921897866668	3	1199.724327	1199.723772	G	R	178	188
PSM	KKEDINLSVR	1702	sp|Q15645|PCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6193	18.710368527466667	3	1200.683534	1200.682636	A	K	34	44
PSM	KKVVNPLFEK	1703	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7141	20.20895447013333	3	1200.722079	1200.723044	A	R	25	35
PSM	KMKEALLSIGK	1704	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8153	21.643974118933333	3	1216.721321	1216.721330	K	-	128	139
PSM	RKQQQILLEK	1705	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5659	17.9282424968	3	1282.773150	1282.772120	L	K	296	306
PSM	RKEGMTAFVEK	1706	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6492	19.140182437333333	3	1294.668897	1294.670357	D	R	272	283
PSM	KKLMIKQGLLD	1707	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:35	ms_run[1]:scan=7820	21.145984012	3	1301.774480	1301.774094	Q	K	389	400
PSM	RKEGMTAFVEK	1708	sp|P30084|ECHM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:35	ms_run[1]:scan=4344	16.0473173376	3	1310.665301	1310.665272	D	R	272	283
PSM	KKSDLEIELLK	1709	sp|Q9H098|F107B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9435	23.440735445333335	3	1314.776709	1314.775868	K	R	76	87
PSM	KKKPTPVLLPQS	1710	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6705	19.484159419466668	2	1334.828464	1334.828572	L	K	533	545
PSM	KKIFEYETQR	1711	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6624	19.366935208266668	3	1340.709021	1340.708851	E	R	36	46
PSM	RKAEAAVVAVAEK	1712	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5590	17.836759891466667	3	1340.778087	1340.777599	K	R	8	21
PSM	KKLLETKPEFL	1713	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9171	23.076987651466666	3	1344.801680	1344.801688	A	K	367	378
PSM	RKLLDLIEDLK	1714	sp|Q96Q89|KI20B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10962	27.86254551973333	3	1354.818216	1354.818401	K	K	574	585
PSM	KKSQTSTNPKAAL	1715	sp|Q5VT52|RPRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4136	15.6161684152	3	1372.768524	1372.767428	W	K	168	181
PSM	RKEVSDLIKEC	1716	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:4	ms_run[1]:scan=7116	20.171000551733336	3	1375.713236	1375.712950	H	R	214	225
PSM	RKADGYNQPDSK	1717	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3484	14.686649389600001	3	1377.663911	1377.663691	K	R	565	577
PSM	KAYNHHIQELQ	1718	sp|Q9P253|VPS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5247	17.337840130666667	2	1379.687656	1379.694598	L	R	810	821
PSM	KKGPGLAVQSGDKT	1719	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4104	15.518404214133334	2	1384.767602	1384.767428	Q	K	152	166
PSM	RRPTLGVQLDDK	1720	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7315	20.45570086213333	3	1396.777366	1396.778662	R	R	325	337
PSM	RKLVEEQNAEKA	1721	sp|Q5F1R6|DJC21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3969	15.258287491466666	3	1413.758832	1413.757592	H	R	221	233
PSM	KKKAVAFSPVTEL	1722	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9108	23.000875821066664	3	1416.834480	1416.834051	L	K	713	726
PSM	KKKAVAFSPVTEL	1723	sp|P17858|PFKAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9118	23.013546538133333	3	1416.834480	1416.834051	L	K	713	726
PSM	RKAEAQIAAKNLD	1724	sp|P00505|AATM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5062	17.076060681866668	3	1426.790350	1426.789226	V	K	81	94
PSM	RKIAELCDDPKE	1725	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=5652	17.920784168	3	1472.730656	1472.729328	A	R	416	428
PSM	KREVENSEDPKF	1726	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5495	17.693531543733332	3	1476.721280	1476.720872	A	R	768	780
PSM	RKNPLPPSVGVVDK	1727	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7084	20.13141359946667	3	1504.872430	1504.872562	D	K	78	92
PSM	KKLEELEKEEEL	1728	sp|Q9BZE4|NOG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8117	21.59464322346667	3	1515.802993	1515.803205	M	R	448	460
PSM	KRVCEEIAIIPSK	1729	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=8219	21.732404841333334	3	1541.858262	1541.859949	N	K	32	45
PSM	KKGKVPVTYLELLS	1730	sp|Q9NR46|SHLB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10499	25.833250656799997	3	1573.946099	1573.944330	N	-	382	396
PSM	RKEIADYLAAGKDE	1731	sp|P53990|IST1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8392	21.96681373786667	3	1577.816219	1577.804936	A	R	37	51
PSM	KKQKEMDEAATAEE	1732	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3873	15.087063317866667	3	1606.751588	1606.750852	E	R	863	877
PSM	RKIDQKAVDSQILP	1733	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8179	21.677746820533333	3	1609.913950	1609.915155	Q	K	246	260
PSM	KKPEWQVERESIS	1734	sp|Q13206|DDX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7704	20.98927013573333	3	1614.835250	1614.836570	L	R	42	55
PSM	KKQKEMDEAATAEE	1735	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:35	ms_run[1]:scan=3492	14.692920256799999	2	1622.743950	1622.745767	E	R	863	877
PSM	RRDPEEPEKTELSE	1736	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5163	17.217344998399998	3	1713.817585	1713.816957	R	R	16	30
PSM	KKGAAVDGGKLDVGNAEV	1737	sp|P51572|BAP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7574	20.797106876266664	3	1726.924207	1726.921363	L	K	158	176
PSM	KKKAGPGSLELCGLPSQ	1738	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4	ms_run[1]:scan=8727	22.448664766666663	3	1768.951173	1768.950555	Q	K	572	589
PSM	KRILELDQFKGQQGQ	1739	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8747	22.4755665504	3	1786.969511	1786.968982	A	K	114	129
PSM	KKKEPEPNFQLLDNPA	1740	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9387	23.367081661866667	3	1866.984054	1866.983963	E	R	867	883
PSM	RRNTLEWCLPVIDAKN	1741	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:4	ms_run[1]:scan=10597	26.203244223733336	3	1984.022540	1984.031265	S	K	434	450
PSM	KKKGEPGPPDADGPLYLPY	1742	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10092	24.645108518666667	3	2041.048286	2041.052043	S	K	632	651
PSM	RKLEDSTRETQSQLETE	1743	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5965	18.394924789066668	3	2048.996609	2048.997441	R	R	1915	1932
PSM	RRAAATQPDAKDTPDEPWAFPA	1744	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9859	24.1471117936	3	2410.166905	2410.166572	A	R	61	83
PSM	KKIKGIQQATTGVSQETSENPGN	1745	sp|P04150|GCR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6068	18.552302892	3	2414.237973	2414.240131	K	K	495	518
PSM	KCNAAFGAHDFH	1746	sp|O75150|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4	ms_run[2]:scan=6461	19.099	3	1373.5935	1373.5935	P	R	985	997
PSM	KDLHFEGMFK	1747	sp|Q9P0I2|EMC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=7769	21.081	3	1266.6067	1266.6067	A	K	244	254
PSM	KEKEILDHLN	1748	sp|Q86SQ0-2|PHLB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6738	19.543	3	1237.6667	1237.6667	M	R	642	652
PSM	KEKQQHIEQLLAE	1749	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8175	21.673	3	1592.8522	1592.8522	L	R	358	371
PSM	KEVHKSGYLSSE	1750	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4422	16.161	3	1362.6779	1362.6779	N	R	139	151
PSM	KFHDIDDVK	1751	sp|Q9H2U2-6|IPYR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5670	17.939	3	1115.5611	1115.5611	S	K	114	123
PSM	KGAVLHHLVN	1752	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5516	17.723	2	1086.6298	1086.6298	K	K	721	731
PSM	KGHTSFVNSCYPAR	1753	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=6167	18.683	3	1622.7624	1622.7624	L	R	148	162
PSM	KGVSKAVEHIN	1754	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3979	15.283	3	1180.6564	1180.6564	G	K	60	71
PSM	KHGGGTESLFFDKV	1755	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9772	23.983	3	1520.7623	1520.7623	S	R	457	471
PSM	KHGHLCPIDTGLIE	1756	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=9070	22.957	3	1588.8032	1588.8032	C	K	79	93
PSM	KHIQHDTIGYLLT	1757	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9382	23.357	3	1537.8253	1537.8253	A	R	535	548
PSM	KHKSSLNSSPWSGLMALGNS	1758	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10771	26.96	3	2100.0422	2100.0422	S	R	10	30
PSM	KHLQHLAEVSAEV	1759	sp|O95229|ZWINT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7689	20.97	3	1459.7783	1459.7783	E	R	162	175
PSM	KHSFDTFSHQ	1760	sp|P51648|AL3A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5929	18.34	3	1232.5574	1232.5574	G	R	413	423
PSM	KHSGPNSADSANDGFVRL	1761	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8491	22.105	3	1870.8922	1870.8922	L	R	98	116
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	1762	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	25-UNIMOD:4	ms_run[2]:scan=10944	27.776	3	2790.3218	2790.3218	L	K	91	118
PSM	KHTNYTMEHI	1763	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6278	18.831	3	1272.5921	1272.5921	N	R	333	343
PSM	KHVLHVQLN	1764	sp|Q13011|ECH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6301	18.867	2	1086.6298	1086.6298	Q	R	65	74
PSM	KIDHLEKETSLL	1765	sp|O15078|CE290_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8740	22.465	3	1424.7875	1424.7875	L	R	739	751
PSM	KIHEDTKEINE	1766	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3998	15.325	3	1354.6729	1354.6729	E	K	343	354
PSM	KIHMPEKTAVEFLS	1767	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9785	24.007	3	1628.8596	1628.8596	A	K	785	799
PSM	KIHQCQHTNEPLF	1768	sp|Q92664-2|TF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=7530	20.74	3	1650.7937	1650.7937	L	K	150	163
PSM	KIIGAGKPWH	1769	sp|Q16527|CSRP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6534	19.225	3	1105.6396	1105.6396	E	K	131	141
PSM	KIKAPGFAHLAGLD	1770	sp|O75306-2|NDUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10051	24.565	2	1436.814	1436.8140	C	K	423	437
PSM	KIRIDAMHGVVGPYV	1771	sp|P36871-3|PGM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10198	24.928	3	1653.9025	1653.9025	L	K	22	37
PSM	KIVHKGDECIL	1772	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4	ms_run[2]:scan=6526	19.213	3	1310.7017	1310.7017	Q	K	474	485
PSM	KIYPSREEYEAHQD	1773	sp|Q06587-2|RING1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5533	17.746	3	1763.8115	1763.8115	S	R	80	94
PSM	KKAALCAVHVI	1774	sp|O43747|AP1G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=7848	21.189	3	1208.7063	1208.7063	R	R	155	166
PSM	KKCYEMASHL	1775	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=4551	16.37	3	1281.5846	1281.5846	N	R	126	136
PSM	KKDLHDANTDLIG	1776	sp|P53985-2|MOT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6611	19.35	3	1438.7416	1438.7416	V	R	223	236
PSM	KKFGTINIVHP	1777	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8389	21.964	3	1252.7292	1252.7292	A	K	116	127
PSM	KKFMDQHPEMDFS	1778	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=7195	20.294	3	1654.712	1654.7120	L	K	314	327
PSM	KKFMDQHPEMDFS	1779	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=7725	21.016	3	1654.712	1654.7120	L	K	314	327
PSM	KKLLEAQSHF	1780	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6820	19.688	3	1199.6663	1199.6663	K	R	2057	2067
PSM	KKLPHPDLPAEE	1781	sp|Q53GS9-2|SNUT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6919	19.859	3	1372.7351	1372.7351	T	K	255	267
PSM	KKWTELDTNQH	1782	sp|Q5VSL9-2|STRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6169	18.685	3	1398.6892	1398.6892	D	R	17	28
PSM	KLDPHNHVLYSN	1783	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6349	18.939	3	1435.7208	1435.7208	I	R	32	44
PSM	KLEHEISHL	1784	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6424	19.052	3	1104.5928	1104.5928	E	K	843	852
PSM	KLHDELEQIRL	1785	sp|Q8WXW3|PIBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10023	24.492	3	1392.7725	1392.7725	N	K	376	387
PSM	KLKDNLGIHY	1786	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8142	21.628	3	1199.6663	1199.6663	E	K	666	676
PSM	KLNENHSGELWKG	1787	sp|Q13418-3|ILK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6954	19.927	3	1510.7528	1510.7528	T	R	64	77
PSM	KLPNLGKHE	1788	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5284	17.399	2	1034.5873	1034.5873	I	K	298	307
PSM	KLRNEYGPVLHMPTS	1789	sp|O43660-2|PLRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9093	22.983	3	1740.8981	1740.8981	I	K	47	62
PSM	KMSGKHDVGAYMLMY	1790	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=8120	21.599	3	1777.7837	1777.7837	T	K	3814	3829
PSM	KQKIHPTSVISGY	1791	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7435	20.617	3	1456.8038	1456.8038	V	R	109	122
PSM	KRDSYLPVGSHNL	1792	sp|Q07864|DPOE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8168	21.663	3	1484.7736	1484.7736	V	K	412	425
PSM	KRGFGFVTFDDHDPVD	1793	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10819	27.194	3	1850.8588	1850.8588	K	K	152	168
PSM	KRLPNNHIGISFIP	1794	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10087	24.634	3	1604.9151	1604.9151	L	R	1775	1789
PSM	KRPAILTYHDVGLNY	1795	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9840	24.109	3	1758.9417	1758.9417	P	K	47	62
PSM	KRPPSAFFLFCSEH	1796	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=10560	26.075	3	1721.8348	1721.8348	P	R	96	110
PSM	KSLLIKHFDP	1797	sp|Q8IXH7-4|NELFD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8539	22.187	2	1196.6917	1196.6917	L	R	111	121
PSM	KSRGVLHQFSGTETN	1798	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6332	18.91	3	1659.8329	1659.8329	Y	K	186	201
PSM	KSSLIHQGIR	1799	sp|Q12834|CDC20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5100	17.137	3	1137.6618	1137.6618	A	-	490	500
PSM	KTVYTGIDHHW	1800	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8020	21.442	3	1355.6622	1355.6622	G	K	156	167
PSM	KVDVLSWVHGSR	1801	sp|Q9UJ14|GGT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10122	24.724	3	1381.7466	1381.7466	E	R	628	640
PSM	KVKFIHDQTSPNP	1802	sp|P53007|TXTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5942	18.357	3	1509.794	1509.7940	I	K	147	160
PSM	KVKVLPTHDAS	1803	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4375	16.09	3	1193.6768	1193.6768	F	K	1536	1547
PSM	KVLGKDHPDVA	1804	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4537	16.352	2	1177.6455	1177.6455	E	K	329	340
PSM	KVQHVIHYQVP	1805	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7652	20.911	3	1346.7459	1346.7459	P	R	600	611
PSM	KVTTHPLAKD	1806	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3737	14.941	3	1108.6241	1108.6241	S	K	122	132
PSM	KYLHPPPHL	1807	sp|Q9NR56-3|MBNL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7111	20.165	2	1100.6131	1100.6131	C	K	67	76
PSM	KYNHIDESEMK	1808	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=3688	14.893	3	1408.6293	1408.6293	E	K	695	706
PSM	RAEHQQDSEDLFK	1809	sp|Q9UH99-3|SUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6607	19.337	2	1601.7434	1601.7434	L	K	363	376
PSM	RAENLLHDHYGG	1810	sp|Q9Y2G5-2|OFUT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6814	19.679	3	1380.6535	1380.6535	D	K	219	231
PSM	RAIHEFLAAQK	1811	sp|Q96IK1|BOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7006	20.001	3	1282.7146	1282.7146	E	K	151	162
PSM	RAPLHPEKVCNTI	1812	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=6453	19.089	3	1533.8086	1533.8086	I	-	494	507
PSM	RAQHVFQHAVPQEG	1813	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6007	18.448	3	1602.8015	1602.8015	Q	K	48	62
PSM	RAVLAVHPDKAAGQPYEQHA	1814	sp|O14976-2|GAK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6690	19.466	4	2157.1079	2157.1079	R	K	1190	1210
PSM	RCYNCGGLDHHA	1815	sp|Q6ZN17-2|LN28B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4533	16.348	3	1458.5881	1458.5881	D	K	58	70
PSM	RDLHTLDSHV	1816	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6271	18.824	3	1191.5996	1191.5996	L	R	3204	3214
PSM	REPSAHDYWWAEHQ	1817	sp|Q9H040-3|SPRTN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9303	23.243	3	1810.7812	1810.7812	N	K	146	160
PSM	RFHMDSETHDPIDLQT	1818	sp|Q9Y2L1-2|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=8274	21.802	4	1956.8636	1956.8636	V	K	608	624
PSM	RFKEDFFQSGEIGGHC	1819	sp|Q5NDL2-2|EOGT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:4	ms_run[2]:scan=9784	24.006	3	1912.8526	1912.8526	D	K	172	188
PSM	RGFGHIGIAVPDVYSACK	1820	sp|Q04760-2|LGUL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:4	ms_run[2]:scan=10252	25.074	3	1945.9833	1945.9833	P	R	108	126
PSM	RGGKICLTDHF	1821	sp|Q9Y3C8|UFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=8407	21.985	3	1302.6503	1302.6503	Y	K	111	122
PSM	RGLDFLHSH	1822	sp|Q00534|CDK6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8879	22.674	3	1080.5465	1080.5465	L	R	131	140
PSM	RGLPGSGKTHVA	1823	sp|P49750-1|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4421	16.16	3	1178.652	1178.6520	M	K	1645	1657
PSM	RGPEGHPLHEVLLEQA	1824	sp|Q9Y375|CIA30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8852	22.631	3	1780.922	1780.9220	W	K	106	122
PSM	RGTHQLYSTSHD	1825	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4182	15.724	3	1400.6433	1400.6433	R	R	251	263
PSM	RHADHSSLTLGSGSSTT	1826	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5470	17.669	3	1712.8078	1712.8078	V	R	2521	2538
PSM	RHDLPLHPAVV	1827	sp|Q9NY93-2|DDX56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8144	21.632	3	1252.704	1252.7040	L	K	435	446
PSM	RHHCPNTPIILVGT	1828	sp|P63000|RAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=8856	22.638	3	1613.846	1613.8460	V	K	102	116
PSM	RHLDHVAALFPGDVD	1829	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9911	24.255	3	1660.8322	1660.8322	Q	R	410	425
PSM	RHSLLQTLYKV	1830	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9926	24.284	3	1356.7878	1356.7878	A	-	577	588
PSM	RHSTGDTKVPFCLQSCV	1831	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=9431	23.434	3	1990.9353	1990.9353	Q	K	272	289
PSM	RHVAVTNMNEHSS	1832	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=3486	14.689	3	1496.679	1496.6790	N	R	190	203
PSM	RHYPVFENPKQG	1833	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6451	19.086	3	1470.7368	1470.7368	S	K	692	704
PSM	RIAQPHHGVPYF	1834	sp|Q15398-1|DLGP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8475	22.078	3	1420.7364	1420.7364	G	R	341	353
PSM	RICNAVSSSHGLDR	1835	sp|Q92794|KAT6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4	ms_run[2]:scan=5277	17.38	3	1570.7634	1570.7634	E	K	31	45
PSM	RIDDIVSGHK	1836	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5886	18.26	3	1138.6095	1138.6095	L	K	480	490
PSM	RIHQDGIHILVNMNGYT	1837	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35	ms_run[2]:scan=9301	23.241	3	1995.9949	1995.9949	D	K	617	634
PSM	RIIHGAGYSEEDK	1838	sp|P29992|GNA11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4615	16.466	3	1473.7212	1473.7212	M	R	60	73
PSM	RIQVWHEEH	1839	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6582	19.295	3	1232.6051	1232.6051	E	R	171	180
PSM	RKILSEGVDHCMV	1840	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=6618	19.36	3	1558.7596	1558.7596	L	K	1506	1519
PSM	RKQLEALMAEHQ	1841	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=5535	17.75	3	1468.7456	1468.7456	R	R	841	853
PSM	RKSLEDVTAEYIH	1842	sp|Q9P0K7-4|RAI14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9542	23.585	3	1559.7944	1559.7944	K	K	636	649
PSM	RKSNFSLEDFQHS	1843	sp|P56937-3|DHB7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9107	22.999	3	1593.7536	1593.7536	A	K	175	188
PSM	RKYFTCDEGHGIFV	1844	sp|Q14203-3|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=9587	23.661	3	1727.809	1727.8090	G	R	59	73
PSM	RLAFHGILLHGLED	1845	sp|P57772-2|SELB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10612	26.271	3	1589.8678	1589.8678	C	R	416	430
PSM	RLDHKFDLMYA	1846	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=9132	23.031	3	1423.6918	1423.6918	A	K	355	366
PSM	RLFLLPHKDQ	1847	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8810	22.566	3	1265.7244	1265.7244	L	R	241	251
PSM	RLHFFMPGFAPLTS	1848	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=10948	27.794	3	1635.8232	1635.8232	P	R	262	276
PSM	RLLSKEGPAHEP	1849	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5254	17.352	2	1332.715	1332.7150	F	K	338	350
PSM	RLPCNHIFHTSCL	1850	sp|Q86TM6-2|SYVN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8958	22.79	3	1653.7868	1653.7868	K	R	253	266
PSM	RLPDHLIKDLFGD	1851	sp|P38571-2|LICH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10957	27.839	3	1537.8253	1537.8253	G	K	162	175
PSM	RLRGIEQAVQSHAVAEEEA	1852	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8860	22.643	3	2092.0661	2092.0661	A	R	513	532
PSM	RLSMYGVDLHHA	1853	sp|O43491|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=7810	21.135	3	1413.6823	1413.6823	K	K	400	412
PSM	RMGHAGAIIAGGKGGA	1854	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=4496	16.273	3	1438.7463	1438.7463	R	K	296	312
PSM	RMSHLEDILGKL	1855	sp|O94901-5|SUN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=10622	26.306	3	1426.7602	1426.7602	V	R	351	363
PSM	RNTGHKIETDLPQI	1856	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8741	22.467	3	1620.8584	1620.8584	F	R	703	717
PSM	RQFAEWICHLH	1857	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=10159	24.824	3	1495.7143	1495.7143	A	K	290	301
PSM	RQLMHSGHPSE	1858	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=3433	14.593	3	1293.5884	1293.5884	A	K	900	911
PSM	RQRIIEESTHCGPQAV	1859	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=6466	19.105	3	1879.9323	1879.9323	K	R	812	828
PSM	RSLHDAIMIVR	1860	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=8260	21.786	3	1325.7238	1325.7238	E	R	183	194
PSM	RSLHDAIMIVR	1861	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9014	22.871	3	1309.7289	1309.7289	E	R	183	194
PSM	RSMEAHNILSK	1862	sp|Q9NP77-2|SSU72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35	ms_run[2]:scan=4696	16.58	3	1300.6558	1300.6558	N	R	18	29
PSM	RSMGFIGHYLDQK	1863	sp|P53396-3|ACLY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9801	24.038	4	1550.7664	1550.7664	G	R	794	807
PSM	RSPTKAPHLQLIEG	1864	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8425	22.013	3	1545.8627	1545.8627	V	K	597	611
PSM	RSSGGSYRDSYDSYATHNE	1865	sp|Q14011|CIRBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6392	19.005	3	2150.889	2150.8890	D	-	154	173
PSM	RSSHSLDYDKD	1866	sp|Q9UK61-2|TASOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4085	15.477	3	1321.5899	1321.5899	Q	R	273	284
PSM	RSSSSGHYVSWVK	1867	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7219	20.323	3	1478.7266	1478.7266	G	R	394	407
PSM	RTHVKGAELVEGCDGILGDNF	1868	sp|P35219|CAH8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:4	ms_run[2]:scan=10335	25.312	4	2286.1063	2286.1063	L	R	254	275
PSM	RTKDDIIEFAH	1869	sp|Q96JJ7-2|TMX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8406	21.984	3	1343.6834	1343.6834	P	R	117	128
PSM	RVHTGFDQHEQ	1870	sp|O96013-2|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4333	16.03	3	1352.6222	1352.6222	H	K	20	31
PSM	RVIAHPSFHNINF	1871	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9536	23.578	3	1550.8106	1550.8106	K	K	1328	1341
PSM	RVPGLHQLTKL	1872	sp|Q8N5L8|RP25L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8960	22.791	3	1260.7666	1260.7666	R	R	77	88
PSM	RVSHYIINSLPNR	1873	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8268	21.795	3	1567.8583	1567.8583	S	R	57	70
PSM	RYGIKPEWMMIH	1874	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=9828	24.084	3	1575.769	1575.7690	Y	R	614	626
PSM	RYTCHVQHEGLP	1875	sp|P01889|HLAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=6151	18.668	3	1495.699	1495.6990	Q	K	280	292
PSM	KIRYESLTD	1876	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=7337	20.48901307546667	2	1123.5865	1123.5868	D	P	58	67
PSM	KNIKLGIHEDSQN	1877	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5909	18.314475506666668	3	1495.766159	1494.779056	S	R	443	456
PSM	RLDNLTCHLLK	1878	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=9066	22.954009215466666	3	1381.749970	1381.750004	D	K	3302	3313
PSM	REPISVKEQH	1879	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4113	15.546277039733333	3	1222.650748	1221.646585	I	K	577	587
PSM	KHHNQPYCGIAPYI	1880	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	8-UNIMOD:4	ms_run[1]:scan=9277	23.213782652266666	3	1696.8135	1696.8139	E	R	32	46
PSM	KYFIKEGDGWVYH	1881	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=9400	23.3834689392	3	1642.8002	1640.7982	T	K	721	734
PSM	KHLEFMNQLK	1882	sp|Q07866|KLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:35	ms_run[1]:scan=6681	19.452130255733334	3	1302.674929	1302.675442	K	K	146	156
PSM	RVHNNIVYNEYISH	1883	sp|O60870|KIN17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8352	21.917330770933333	3	1756.864907	1756.864517	K	R	88	102
PSM	KDRLTIELHPDG	1884	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8254	21.779308723733333	3	1392.733927	1392.736128	L	R	40	52
PSM	KFYEEVHDLER	1885	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8267	21.7942627072	3	1463.703069	1463.704494	A	K	94	105
PSM	KSGIGHEASLK	1886	sp|Q8N954|GPT11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4028	15.367842659466667	3	1125.617101	1125.614222	G	R	133	144
PSM	RHLQLAIRNDEELN	1887	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8594	22.259830475199998	3	1720.885628	1719.901630	P	K	82	96
PSM	KKVAGAATPK	1888	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3285	14.406926202933333	2	969.597503	969.597115	P	K	140	150
PSM	KPKDMLGPK	1889	sp|P07954|FUMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:35	ms_run[1]:scan=3607	14.815292082933333	2	1028.569308	1028.568852	V	-	502	511
PSM	RKSAPATGGVK	1890	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3307	14.4312238856	3	1070.620056	1070.619642	A	K	27	38
PSM	KKTKEAVLLL	1891	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8670	22.371600670400003	3	1141.743648	1141.743445	Y	K	162	172
PSM	KKLQLIKDY	1892	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7681	20.956310376266668	3	1147.696440	1147.696495	D	R	74	83
PSM	KKNPVKFEGGD	1893	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4377	16.093437861866665	3	1217.640797	1217.640437	D	R	611	622
PSM	RKAEIMESIK	1894	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:35	ms_run[1]:scan=4465	16.2342120096	3	1219.659947	1219.659458	Q	R	499	509
PSM	RKASQLVGIEK	1895	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5577	17.819649383199998	3	1227.730438	1227.729920	K	K	181	192
PSM	RVEQVKIHAGP	1896	sp|P54886|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5583	17.827551448	3	1235.698741	1232.698955	L	K	638	649
PSM	RKIVDQIRPD	1897	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5797	18.134918129066666	3	1238.709621	1238.709519	I	R	340	350
PSM	KKTQEEVAALK	1898	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4564	16.389419770133333	3	1243.713004	1243.713602	K	R	952	963
PSM	KRPLENDGPVK	1899	sp|P20585|MSH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4123	15.577689232266666	3	1252.696579	1251.693535	K	K	88	99
PSM	RKIEFPLPDR	1900	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8772	22.511070557066667	3	1269.719541	1269.719356	D	R	329	339
PSM	KKASAISIKLGSS	1901	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7215	20.318510007466667	3	1288.769329	1288.771451	T	K	81	94
PSM	KKMEEVKEANI	1902	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5403	17.554911614399998	3	1317.696927	1317.696237	N	R	441	452
PSM	KKKEVPAVPETL	1903	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7501	20.7017845528	3	1337.792088	1337.791852	E	K	7	19
PSM	RKLLTYEFVKQ	1904	sp|Q9Y5V3|MAGD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8962	22.793897879466666	3	1423.819440	1423.818736	L	K	604	615
PSM	KKAVLFCLSEDK	1905	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=8744	22.471324945066666	3	1436.769686	1436.769737	R	K	33	45
PSM	KKAVLFCLSEDK	1906	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=8720	22.440339784	3	1436.769686	1436.769737	R	K	33	45
PSM	RKLAAAEGLEPKY	1907	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7441	20.625312242933333	3	1444.803661	1444.803814	A	R	102	115
PSM	KKNPAVTQLVDRT	1908	sp|O75976|CBPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7129	20.1911068816	3	1468.836766	1468.836177	Y	R	1016	1029
PSM	KRVVGVLLGSWQK	1909	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9654	23.768289297866666	3	1468.886181	1468.887818	Q	K	33	46
PSM	RKIEFPLPDEKT	1910	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9103	22.993867553066664	3	1471.805863	1471.803479	D	K	349	361
PSM	RKAAALEAMKDYT	1911	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=5049	17.060021077600002	3	1482.749848	1482.750064	T	K	433	446
PSM	RKTLEEQISEIR	1912	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9321	23.272217561066668	3	1500.827944	1500.826006	L	R	605	617
PSM	RKVILDLEEERQ	1913	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8191	21.69239467226667	3	1526.840492	1526.841656	H	R	109	121
PSM	RSILKIDDVVNTR	1914	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9069	22.956223894666667	3	1527.875101	1527.873290	V	-	527	540
PSM	RKVELSESEEDKGG	1915	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4307	15.996319741066666	3	1561.760436	1561.758380	P	K	458	472
PSM	RKIGNVEVPKDAFI	1916	sp|Q8N442|GUF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9826	24.080647822666666	3	1584.899979	1584.898777	L	K	647	661
PSM	RKGVAINMVTEEDK	1917	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7160	20.2338813752	4	1588.821865	1588.824291	G	R	368	382
PSM	KKGRPDPYAYIPLN	1918	sp|Q5JTH9|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9468	23.480674515466667	3	1630.883637	1630.883127	K	R	1244	1258
PSM	KKKPLDGEYFTLQI	1919	sp|P04637|P53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10562	26.079846879733335	3	1678.929385	1678.929408	P	R	319	333
PSM	RRSTQESLTAGGTDLK	1920	sp|Q15345|LRC41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5753	18.056791635733337	3	1718.889956	1718.891125	T	R	324	340
PSM	RKQTIDNSQGAYQEAFDISK	1921	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9037	22.908947109866666	4	2298.124664	2298.124038	D	K	138	158
PSM	RKVQALSEMASEQLK	1922	sp|Q53GS7|GLE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=6565	19.271181507466668	3	1732.911766	1732.914169	E	R	156	171
PSM	KKLEDGPKFL	1923	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8276	21.803623234933333	2	1173.675586	1173.675760	G	K	385	395
PSM	KKKGPPDADGPLYLPY	1924	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9840	24.108730731466668	3	1758.940758	1757.935222	S	K	202	218
PSM	RAIADHLFWSEETKS	1925	sp|Q96GA3|LTV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9562	23.612198775733336	3	1791.924256	1788.879498	H	R	224	239
PSM	RKLVIIESDLERAEE	1926	sp|P09493|TPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9454	23.464060129866667	3	1798.978189	1798.978878	A	R	167	182
PSM	KRLSSSSATLLNSPDRA	1927	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7013	20.012287036266667	3	1801.966759	1801.964625	S	R	197	214
PSM	RKDTEDEDKSESFMQ	1928	sp|Q7L3B6|CD37L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:35	ms_run[1]:scan=4382	16.10005453386667	3	1859.785810	1859.784337	K	K	146	161
PSM	KRQLEEAEEEATRANAS	1929	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6727	19.526031996533334	3	1930.935511	1930.934447	L	R	1883	1900
PSM	RKEMTNEEKNIITNLS	1930	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:35	ms_run[1]:scan=8360	21.92598709386667	3	1934.971834	1934.973141	W	K	283	299
PSM	RKEMTNEEKNIITNLS	1931	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:35	ms_run[1]:scan=8356	21.9209827248	3	1934.971834	1934.973141	W	K	283	299
PSM	KKKEASLQFVVEPSEATN	1932	sp|Q03188|CENPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8961	22.79305408453333	3	2004.051121	2004.052771	S	R	91	109
PSM	KKCLELFTELAEDKENY	1933	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4	ms_run[1]:scan=10661	26.46328391893333	3	2129.036617	2129.035072	V	K	418	435
PSM	KKKASLQSGQEGAGDSPGSQFS	1934	sp|Q12778|FOXO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5694	17.973525517600002	3	2193.066911	2193.066189	A	K	272	294
PSM	KKSVVSLKNEEENENSISQY	1935	sp|P82673|RT35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7982	21.3872611872	4	2324.149229	2324.149585	Y	K	293	313
PSM	RRMEAQALLQDYISTQSAKE	1936	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35	ms_run[1]:scan=10378	25.438861574933334	4	2353.168480	2353.169609	S	-	393	413
PSM	KADKDYHF	1937	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5588	17.833	2	1022.4821	1022.4821	L	K	24	32
PSM	KAEAHHAEL	1938	sp|Q99470|SDF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3848	15.058	2	1004.5039	1004.5039	L	-	203	212
PSM	KAIRGHLENNPALE	1939	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5926	18.336	3	1560.8372	1560.8372	R	K	63	77
PSM	KAKDPFAHLP	1940	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8612	22.282	3	1122.6186	1122.6186	P	K	275	285
PSM	KAKLDHVQFAEF	1941	sp|Q6PCB5-2|RSBNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9471	23.485	3	1431.751	1431.7510	V	K	517	529
PSM	KAKLEEHF	1942	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5555	17.779	2	1000.5342	1000.5342	L	K	738	746
PSM	KCDWLDGKHVVFG	1943	sp|O43447-2|PPIH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=10157	24.822	3	1559.7555	1559.7555	S	K	87	100
PSM	KCTHWAEGGKGALALAQAVQ	1944	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=9622	23.715	3	2095.0633	2095.0633	V	R	784	804
PSM	KCVDDHMHLIPTMTK	1945	sp|Q96C01|F136A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=7458	20.648	3	1840.8634	1840.8634	T	K	113	128
PSM	KDHHFDMINI	1946	sp|Q9P032|NDUF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9959	24.356	3	1268.5972	1268.5972	P	K	97	107
PSM	KDIAAHIK	1947	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3945	15.206	2	894.5287	894.5287	E	K	36	44
PSM	KEEHPFEK	1948	sp|O95166|GBRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3887	15.108	2	1042.5084	1042.5084	Y	R	6	14
PSM	KEFNAEVHR	1949	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4487	16.265	3	1128.5676	1128.5676	S	K	188	197
PSM	KEHYVDLKD	1950	sp|P22392-2|NDKB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5472	17.671	3	1145.5717	1145.5717	L	R	49	58
PSM	KEKGSSNHNLLAAP	1951	sp|P83436|COG7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6380	18.988	3	1464.7685	1464.7685	L	R	554	568
PSM	KEKPYFPIPEEYTFIQNVPLED	1952	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11456	29.968	3	2695.3421	2695.3421	Q	R	443	465
PSM	KEPFFHGHDNYDQLV	1953	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9715	23.864	3	1844.8482	1844.8482	R	R	93	108
PSM	KEVHKSGYLAGD	1954	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4469	16.24	3	1302.6568	1302.6568	N	K	139	151
PSM	KFHTVSGSKCEI	1955	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:4	ms_run[2]:scan=5799	18.138	3	1391.6867	1391.6867	K	K	215	227
PSM	KFIEEHATKLS	1956	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6131	18.647	3	1301.698	1301.6980	S	R	629	640
PSM	KGHYAYDCH	1957	sp|Q16629-3|SRSF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=3901	15.131	3	1149.4662	1149.4662	E	R	112	121
PSM	KGKLNHLCGADFV	1958	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=8471	22.073	3	1457.7449	1457.7449	S	K	242	255
PSM	KGPNKHTLTQI	1959	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5606	17.858	2	1235.6986	1235.6986	I	K	332	343
PSM	KGQRPETLHE	1960	sp|Q5BJF2|SGMR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3803	15.009	3	1193.6153	1193.6153	F	R	130	140
PSM	KHDGITVAVH	1961	sp|O43504|LTOR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5219	17.302	3	1075.5774	1075.5774	Q	K	78	88
PSM	KHIAEEADR	1962	sp|P06753-7|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3487	14.689	3	1067.536	1067.5360	A	K	26	35
PSM	KHIEEDEVRSSADL	1963	sp|Q13277-2|STX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6585	19.298	3	1626.7849	1626.7849	E	R	100	114
PSM	KHKELQQQLVDA	1964	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6519	19.2	3	1435.7783	1435.7783	F	K	163	175
PSM	KHLTDAYFK	1965	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6942	19.909	3	1121.5869	1121.5869	P	K	210	219
PSM	KHNLLLHL	1966	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9096	22.986	2	986.60253	986.6025	A	K	258	266
PSM	KHPMDLSTVK	1967	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:35	ms_run[2]:scan=3948	15.214	3	1170.6067	1170.6067	I	R	353	363
PSM	KHPMDLSTVK	1968	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5534	17.749	3	1154.6118	1154.6118	I	R	353	363
PSM	KHVGKTDPGTVFVMN	1969	sp|Q9NYK5|RM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:35	ms_run[2]:scan=6477	19.119	3	1644.8294	1644.8294	V	K	68	83
PSM	KHYTEAIK	1970	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3787	14.99	2	988.53418	988.5342	M	R	381	389
PSM	KIGLPHSIKLS	1971	sp|Q14498-2|RBM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8968	22.803	3	1191.7339	1191.7339	G	R	111	122
PSM	KIHPLEKVDEEATE	1972	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6930	19.88	3	1636.8308	1636.8308	V	K	136	150
PSM	KIHQETFGKSGC	1973	sp|Q15393-2|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4	ms_run[2]:scan=4446	16.196	3	1390.6663	1390.6663	E	R	101	113
PSM	KIHQHILPQGQGMLSGIG	1974	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9784	24.006	3	1913.0305	1913.0305	G	R	239	257
PSM	KIIEHNIRND	1975	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4185	15.729	3	1250.6731	1250.6731	L	K	569	579
PSM	KIKCSGCHSYQEST	1976	sp|Q9UPT9-2|UBP22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3729	14.934	3	1683.7345	1683.7345	A	K	368	382
PSM	KIKFPLPH	1977	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8536	22.184	2	978.60147	978.6015	S	R	149	157
PSM	KIKVDNHLFN	1978	sp|P78356-2|PI42B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8076	21.536	3	1226.6772	1226.6772	S	K	76	86
PSM	KILHTAWHP	1979	sp|P63151|2ABA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7493	20.692	3	1101.6083	1101.6083	K	K	418	427
PSM	KKFLDAGH	1980	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4673	16.553	2	914.4974	914.4974	A	K	288	296
PSM	KKNCPHIVVGTPG	1981	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4	ms_run[2]:scan=5591	17.837	3	1405.75	1405.7500	L	R	162	175
PSM	KKNISHDTFGTTYG	1982	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6457	19.094	3	1567.7631	1567.7631	K	R	251	265
PSM	KLDHIIKE	1983	sp|O00541-2|PESC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5572	17.807	2	994.58113	994.5811	Y	R	115	123
PSM	KLFSEYHEK	1984	sp|Q9BXW7-2|HDHD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6095	18.591	3	1179.5924	1179.5924	M	R	94	103
PSM	KLHAEAIK	1985	sp|Q9NQ50|RM40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3991	15.31	2	908.54435	908.5444	P	R	156	164
PSM	KLHEDLCEK	1986	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=4322	16.016	3	1170.5703	1170.5703	T	R	361	370
PSM	KLHSYATSIR	1987	sp|P51553-2|IDH3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5367	17.497	3	1174.6459	1174.6459	L	K	340	350
PSM	KLKGEMMDLQHGSLFL	1988	sp|P00338-5|LDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=9735	23.908	3	1877.9379	1877.9379	D	R	57	73
PSM	KLSGLPKH	1989	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4575	16.407	2	878.53379	878.5338	W	R	150	158
PSM	KLSLDELHR	1990	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8040	21.479	3	1109.6193	1109.6193	H	K	45	54
PSM	KNADHLLHL	1991	sp|Q969X6-3|UTP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8133	21.614	3	1059.5825	1059.5825	S	K	377	386
PSM	KNHLEGKAAISN	1992	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3849	15.059	3	1280.6837	1280.6837	R	K	47	59
PSM	KNHPLYALK	1993	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6163	18.679	3	1082.6237	1082.6237	Y	R	605	614
PSM	KNLHSEISGK	1994	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3881	15.1	3	1111.5986	1111.5986	Q	R	931	941
PSM	KNVKHFVLDECD	1995	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:4	ms_run[2]:scan=7446	20.631	3	1502.7188	1502.7188	L	K	187	199
PSM	KQLFLGGVDRH	1996	sp|P12235|ADT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7816	21.141	3	1268.699	1268.6990	Y	K	96	107
PSM	KRGFGFVTFDDHDPVD	1997	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12204	32.7	3	1850.8588	1850.8588	K	K	152	168
PSM	KSAHVTVSGGTPKGEAVLGTH	1998	sp|Q9BXS6-7|NUSAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6057	18.53	3	2032.0702	2032.0702	R	K	280	301
PSM	KSCGKDGFHI	1999	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4	ms_run[2]:scan=6866	19.781	3	1147.5444	1147.5444	V	R	78	88
PSM	KSHLGNVHDQDN	2000	sp|Q8WW12-3|PCNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3572	14.783	3	1362.6276	1362.6276	I	-	44	56
PSM	KSLGHGLINK	2001	sp|Q8NI36|WDR36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5119	17.165	2	1065.6295	1065.6295	N	K	416	426
PSM	KTCHSFIINEKMNG	2002	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4	ms_run[2]:scan=7879	21.231	3	1677.7967	1677.7967	W	K	740	754
PSM	KTHIDVIHY	2003	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7580	20.805	3	1124.5978	1124.5978	Y	R	413	422
PSM	KTKGFHTTIDIGV	2004	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9053	22.937	3	1415.7773	1415.7773	A	K	84	97
PSM	KTKHEEILQNLQ	2005	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7656	20.919	3	1479.8045	1479.8045	T	K	991	1003
PSM	KTKLEQLHIMQEQQ	2006	sp|Q6P3W7|SCYL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=7105	20.157	3	1768.9142	1768.9142	H	K	607	621
PSM	KTQEHFTHNTV	2007	sp|Q08209-5|PP2BA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4414	16.15	3	1340.6473	1340.6473	E	R	176	187
PSM	KVISELNGKNIEDVIAQGIG	2008	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11104	28.483	3	2096.1477	2096.1477	N	K	41	61
PSM	KVKLLHGGVAVSS	2009	sp|Q9UBF8-2|PI4KB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6865	19.78	3	1293.7769	1293.7769	E	R	58	71
PSM	KVLDQKEH	2010	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3409	14.566	2	995.53999	995.5400	E	R	126	134
PSM	KWKWWEEE	2011	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10485	25.783	2	1219.5662	1219.5662	Q	R	202	210
PSM	KWSCPHCEKEGIQWEA	2012	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=8872	22.663	3	2043.8931	2043.8931	G	K	408	424
PSM	KYHPDKNPDNPEAAD	2013	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3853	15.064	3	1709.7645	1709.7645	L	K	41	56
PSM	KYSTHLHLADDCM	2014	sp|Q15833-2|STXB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=6966	19.946	3	1605.6916	1605.6916	N	K	339	352
PSM	RADHEQQIKDLEQ	2015	sp|Q9Y6D9|MD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6197	18.715	3	1608.7856	1608.7856	A	K	218	231
PSM	RALGISHAKD	2016	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4013	15.35	3	1066.5883	1066.5883	G	K	24	34
PSM	RAVAHHTDCTFI	2017	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:4	ms_run[2]:scan=6823	19.691	3	1426.6776	1426.6776	A	R	193	205
PSM	RCKDDEFTHLYTLIV	2018	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=11100	28.465	4	1908.9404	1908.9404	I	R	162	177
PSM	RCRNSIASCADEQPHIGNY	2019	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=8004	21.42	3	2246.9909	2246.9909	A	R	38	57
PSM	RCSNHLQDKIQ	2020	sp|Q9UHR5-2|S30BP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=4480	16.257	3	1397.6834	1397.6834	G	K	110	121
PSM	RCYLLVHQAK	2021	sp|Q08J23-2|NSUN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=6581	19.294	3	1286.6918	1286.6918	K	R	185	195
PSM	RDKDNPNQYHYVA	2022	sp|Q13619-2|CUL4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5790	18.127	3	1618.7488	1618.7488	E	-	647	660
PSM	RDQINSDHRT	2023	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3422	14.58	3	1240.5909	1240.5909	L	R	34	44
PSM	RDQKLPHLE	2024	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6286	18.843	3	1134.6146	1134.6146	E	R	595	604
PSM	REAVLKDHT	2025	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3831	15.039	3	1067.5724	1067.5724	N	K	467	476
PSM	REHCPAGQPVKV	2026	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4	ms_run[2]:scan=4727	16.62	3	1376.6983	1376.6983	Y	R	432	444
PSM	REHLLDQLK	2027	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7791	21.109	3	1150.6459	1150.6459	P	R	944	953
PSM	REHPTVVPSH	2028	sp|Q96S66-4|CLCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4030	15.371	3	1157.5942	1157.5942	A	K	268	278
PSM	RETEELHHD	2029	sp|O60869-2|EDF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3541	14.74	3	1164.516	1164.5160	D	R	63	72
PSM	RETHEIVALK	2030	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5916	18.322	3	1194.6721	1194.6721	N	R	24	34
PSM	REYTINIHK	2031	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6479	19.121	3	1172.6302	1172.6302	T	R	23	32
PSM	RFQAHQQQGNKAE	2032	sp|Q9HCU5|PREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3523	14.722	3	1540.7495	1540.7495	L	K	94	107
PSM	RGHNVGSLFHMADDLG	2033	sp|P11532-16|DMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=9170	23.076	3	1740.8002	1740.8002	S	R	1101	1117
PSM	RHAEFESLCAQYSADK	2034	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:4	ms_run[2]:scan=8433	22.024	4	1910.8581	1910.8581	H	R	1913	1929
PSM	RHFIDEELEKMDCVQQ	2035	sp|Q15047-3|SETB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=8333	21.892	3	2091.9354	2091.9354	L	R	41	57
PSM	RHGDVVVVRPM	2036	sp|Q2VPK5-3|CTU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=5322	17.444	3	1279.6819	1279.6819	E	R	210	221
PSM	RHLNPDTELK	2037	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4967	16.953	3	1221.6466	1221.6466	H	R	183	193
PSM	RHNIEGIFTFVDH	2038	sp|P27540-2|ARNT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10662	26.469	3	1583.7845	1583.7845	S	R	351	364
PSM	RHNLDNLLQQH	2039	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8078	21.537	3	1386.7116	1386.7116	R	K	672	683
PSM	RHSEYNPQHSLLAQF	2040	sp|Q15797|SMAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9899	24.223	3	1825.886	1825.8860	P	R	142	157
PSM	RHTLDELNPQKS	2041	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6103	18.599	3	1436.7372	1436.7372	A	K	386	398
PSM	RIDIIHNLKLD	2042	sp|Q9ULM3|YETS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10325	25.285	3	1348.7827	1348.7827	K	R	300	311
PSM	RILHENTQTDKALYN	2043	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6383	18.994	3	1814.9275	1814.9275	T	R	506	521
PSM	RILMEHIH	2044	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6568	19.276	2	1047.5648	1047.5648	K	K	136	144
PSM	RKAVLWQDSFSPHL	2045	sp|Q14671-4|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10442	25.639	3	1682.8893	1682.8893	K	K	45	59
PSM	RKCMLDAALATLNTHG	2046	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4	ms_run[2]:scan=10486	25.785	3	1770.8869	1770.8869	V	K	1273	1289
PSM	RKEDMAVHV	2047	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=4158	15.658	3	1099.5444	1099.5444	L	R	3997	4006
PSM	RKELLNFYAWQH	2048	sp|Q9Y3A4|RRP7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10451	25.664	3	1603.8259	1603.8259	S	R	235	247
PSM	RKESAQPPAHL	2049	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4801	16.722	3	1232.6626	1232.6626	G	-	264	275
PSM	RKISSDLDGHPVP	2050	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6786	19.628	3	1419.747	1419.7470	L	K	101	114
PSM	RKISSDLDGHPVP	2051	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7395	20.562	3	1419.747	1419.7470	L	K	101	114
PSM	RKLLEPVDHG	2052	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5721	18.02	3	1162.6459	1162.6459	Q	K	315	325
PSM	RKLVLEIIH	2053	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9192	23.102	3	1119.7128	1119.7128	L	R	90	99
PSM	RKLYGLLDPSVFHV	2054	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11045	28.242	3	1642.9195	1642.9195	Y	K	328	342
PSM	RKNLDSTTVAIHDEEIYC	2055	sp|Q16527|CSRP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:4	ms_run[2]:scan=8759	22.491	3	2163.0266	2163.0266	C	K	41	59
PSM	RKQMVIDVLHPG	2056	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:35	ms_run[2]:scan=8073	21.532	3	1407.7657	1407.7657	Q	K	20	32
PSM	RKSDNHSPAVVTTTVSS	2057	sp|O75179-4|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5314	17.436	3	1784.9017	1784.9017	S	K	1040	1057
PSM	RKTNNIFCSNPNH	2058	sp|P29590-14|PML_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=5843	18.188	3	1600.7529	1600.7529	T	R	182	195
PSM	RLEIEHSVPK	2059	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6238	18.778	3	1206.6721	1206.6721	K	K	67	77
PSM	RLFHANEEEEPEK	2060	sp|Q8NEY1-5|NAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5581	17.826	3	1626.7638	1626.7638	T	K	898	911
PSM	RLKTDQHTSYPCSF	2061	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4	ms_run[2]:scan=7469	20.662	3	1738.8097	1738.8097	E	K	53	67
PSM	RLREPLDGDGHESAEPYA	2062	sp|O60930|RNH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7840	21.179	3	2010.9395	2010.9395	K	K	98	116
PSM	RLSMYGVDLHHA	2063	sp|O43491|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8949	22.777	3	1397.6874	1397.6874	K	K	400	412
PSM	RNLVNKHSETFT	2064	sp|Q9UNS2-2|CSN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5490	17.689	3	1444.7423	1444.7423	L	R	256	268
PSM	RNSDSLPHRLSAA	2065	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6155	18.671	3	1422.7328	1422.7328	K	K	757	770
PSM	RPHSIDGRVVEP	2066	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6101	18.596	3	1360.7211	1360.7211	A	K	82	94
PSM	RRLNVWDLS	2067	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10152	24.815	2	1157.6305	1157.6305	D	K	305	314
PSM	RRPSQNAISFFNVGHS	2068	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9895	24.215	4	1815.9129	1815.9129	Q	K	186	202
PSM	RRVALVTFNSAAHN	2069	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7895	21.254	3	1554.8379	1554.8379	V	K	855	869
PSM	RSDPVLHIDLR	2070	sp|Q96CD2-2|COAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9214	23.132	3	1319.731	1319.7310	S	R	5	16
PSM	RSHGIDLDHN	2071	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4848	16.785	3	1162.5479	1162.5479	L	R	214	224
PSM	RSKEGSIWNHQPCFL	2072	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:4	ms_run[2]:scan=10103	24.676	3	1857.8944	1857.8944	E	K	95	110
PSM	RSPNRDFLTHVSA	2073	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7931	21.311	3	1498.7641	1498.7641	L	R	568	581
PSM	RSTSHKPDEIYGMIE	2074	sp|Q86U44|MTA70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9012	22.868	3	1761.8356	1761.8356	V	R	508	523
PSM	RVAWHIDPFGHS	2075	sp|O00754-2|MA2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10213	24.959	3	1420.7	1420.7000	P	R	190	202
PSM	RVMEHFIKLY	2076	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35	ms_run[2]:scan=9207	23.123	3	1350.7118	1350.7118	Q	K	261	271
PSM	RVTHELQAMKD	2077	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5103	17.14	3	1326.6714	1326.6714	L	K	61	72
PSM	RWASEPEHDH	2078	sp|P08574|CY1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4318	16.009	2	1262.5428	1262.5428	L	R	275	285
PSM	RYSDFHDLHE	2079	sp|Q9Y2I1-4|NISCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7263	20.373	3	1317.5738	1317.5738	H	K	49	59
PSM	RHEMPPHIYAISESAY	2080	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9230	23.1488185688	3	1900.892488	1899.893768	K	R	147	163
PSM	KDKADFCIIHYAG	2081	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=9382	23.3572649384	3	1537.743003	1536.739499	L	K	570	583
PSM	KRGFGFVTFDDHDPVD	2082	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=11371	29.597433906666666	3	1850.858210	1850.858763	K	K	152	168
PSM	RKIEEINNGLHNVE	2083	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7029	20.042499465333332	3	1663.856995	1663.864182	R	K	3690	3704
PSM	RHPHDIIDDINSGAVECPAS	2084	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	17-UNIMOD:4	ms_run[1]:scan=9350	23.310309193333335	3	2202.996349	2202.012380	G	-	146	166
PSM	RHPHDIIDDINSGAVECPAS	2085	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	17-UNIMOD:4	ms_run[1]:scan=12217	32.74936918026667	3	2203.016745	2202.012380	G	-	146	166
PSM	REGYAWAEDKEHCEEYG	2086	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4	ms_run[1]:scan=7902	21.262441307466666	3	2127.857550	2127.859233	L	R	181	198
PSM	KSDIASHFSNK	2087	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5330	17.453137252533335	3	1232.616456	1232.614950	W	R	797	808
PSM	RFNSSDHIESKGI	2088	sp|Q96HR8|NAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6281	18.8362801712	3	1489.744164	1488.732105	L	K	255	268
PSM	KDLHFEGMFK	2089	sp|Q9P0I2|EMC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35	ms_run[1]:scan=7746	21.05002403386667	3	1266.606315	1266.606694	A	K	244	254
PSM	RHVYLDEPIKIG	2090	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9218	23.137958205066663	3	1440.777427	1438.793249	E	R	20	32
PSM	KVHVQTINAK	2091	sp|Q9NVX0|HAUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4188	15.735519374133334	3	1136.665830	1136.666592	S	-	226	236
PSM	RETFHLVSK	2092	sp|Q92572|AP3S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6506	19.1721238528	3	1115.602709	1115.608743	I	R	33	42
PSM	KHSFDTFSHQ	2093	sp|P51648|AL3A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5921	18.329200265599997	3	1232.557546	1232.557435	G	R	413	423
PSM	KLKPVHGLIFLF	2094	sp|Q9Y5K5|UCHL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=11062	28.312350845066664	3	1410.875214	1410.875128	E	K	45	57
PSM	RHESKPVNVDEAT	2095	sp|Q8N0T1|RBIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4035	15.377922100266666	3	1480.730592	1480.727020	Q	R	82	95
PSM	KHESVEYKPP	2096	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5149	17.2019389168	3	1213.617693	1212.613888	E	K	772	782
PSM	KDPKNQGLFH	2097	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5660	17.92892813386667	3	1182.614593	1182.614556	L	R	733	743
PSM	KTKLEQLHIMQEQQ	2098	sp|Q6P3W7|SCYL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=7079	20.121177921866668	3	1768.913041	1768.914169	H	K	607	621
PSM	KHLLGAEHGDEP	2099	sp|Q9BV38|WDR18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5099	17.136614383466668	3	1303.642468	1301.636414	N	R	341	353
PSM	RKGPELPLVPVK	2100	sp|Q96DI7|SNR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8833	22.601903458133332	3	1331.829205	1331.828906	K	R	7	19
PSM	KKALPPEK	2101	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3343	14.479777708533334	2	909.565301	909.564753	S	K	674	682
PSM	KKDVTTKL	2102	sp|O94822|LTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3962	15.238816420000001	2	931.570762	931.570232	S	K	74	82
PSM	KKLQDKIE	2103	sp|Q9UNF0|PACN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3925	15.177639944533333	2	1000.592037	1000.591696	L	K	188	196
PSM	KPKDMLGPK	2104	sp|P07954|FUMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:35	ms_run[1]:scan=3585	14.795321511466666	2	1028.569308	1028.568852	V	-	502	511
PSM	KKAAGKGDVPT	2105	sp|P62424|RL7A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3495	14.697441128533335	3	1070.607760	1070.608408	E	K	120	131
PSM	RKVPEVTEK	2106	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3851	15.060942648266666	3	1084.625412	1084.624058	K	K	6	15
PSM	KLKEEVINK	2107	sp|Q96G28|CFA36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4378	16.0944524712	3	1099.656366	1099.660110	E	-	334	343
PSM	RPLPKDQQK	2108	sp|P33552|CKS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3342	14.479011198666665	3	1108.636202	1108.635292	R	-	71	80
PSM	KKEEDRPPL	2109	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4664	16.53807047786667	3	1110.603140	1110.603323	T	R	534	543
PSM	RKAVAEELAK	2110	sp|Q969Z0|FAKD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4303	15.9923511776	3	1113.651075	1113.650607	M	-	622	632
PSM	KKDQYFLDK	2111	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6439	19.070955798133333	3	1183.623522	1183.623724	A	K	105	114
PSM	RKEELAEALK	2112	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6085	18.582296552266666	3	1185.672788	1185.671737	K	K	797	807
PSM	RKSPALDGKVE	2113	sp|Q6PFW1|VIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4498	16.276442909066667	3	1198.668219	1198.666986	A	R	273	284
PSM	KRLDIQEALK	2114	sp|Q96GM5|SMRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7893	21.249412192266668	3	1212.720205	1212.719021	R	R	164	174
PSM	RKTIPIKYPL	2115	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8802	22.555805897333336	3	1227.771437	1227.770329	D	K	838	848
PSM	KKSIPLSIKNL	2116	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9057	22.941761603466666	3	1239.791525	1239.791458	R	K	513	524
PSM	KKVEEEEKLL	2117	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6569	19.276677565066667	3	1243.702689	1243.702368	N	K	1113	1123
PSM	KKCQQAEKIL	2118	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4	ms_run[1]:scan=5031	17.040302465866667	3	1244.691698	1244.691092	L	K	337	347
PSM	KKQLEKETLM	2119	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=4067	15.451754983466666	3	1262.689925	1262.690424	A	R	195	205
PSM	KKPPPSKEELL	2120	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5667	17.936940461866666	3	1264.739933	1264.739088	S	K	535	546
PSM	RDHNEEEGEETGLRDE	2121	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4829	16.7580626104	3	1913.798950	1913.798741	G	K	496	512
PSM	KRANEFLEVGK	2122	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7270	20.380194945066666	3	1289.707102	1289.709185	L	K	13	24
PSM	RKLEVEYEQK	2123	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5467	17.665006605066665	3	1320.703916	1320.703765	L	R	108	118
PSM	RKAEEDAALQAK	2124	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3904	15.140381754933333	3	1328.705226	1328.704828	K	K	63	75
PSM	KRPALEPVRSSL	2125	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7213	20.316254012266665	3	1351.791982	1351.793583	P	R	691	703
PSM	KKQGKQEAADAAL	2126	sp|P55265|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4210	15.7920752288	3	1356.736868	1356.736128	S	R	777	790
PSM	RKPEQIVDFLK	2127	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9780	23.99740278	3	1371.787444	1371.787435	S	K	134	145
PSM	KKIKLTAEAEEL	2128	sp|P35610|SOAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7987	21.394405079733335	3	1371.796916	1371.797331	A	K	50	62
PSM	KRLESLGALTHGD	2129	sp|A3KN83|SBNO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7878	21.229828960533332	3	1395.747005	1395.747027	A	R	1011	1024
PSM	RKSNEMITNLGK	2130	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35	ms_run[1]:scan=4851	16.7894832672	3	1405.735440	1405.734748	K	K	610	622
PSM	KKEPPKPPLNNF	2131	sp|Q9UQR0|SCML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7450	20.637503716799998	3	1407.787466	1407.787435	F	K	161	173
PSM	RKENPSPLFSIK	2132	sp|Q9P1Y6|PHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8801	22.554378706666668	3	1414.791855	1414.793249	Q	K	809	821
PSM	RNHPSFYVFNH	2133	sp|Q8N4V1|MMGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9053	22.936689052000002	3	1416.687365	1416.668717	L	R	85	96
PSM	KLRDMGIVDILH	2134	sp|Q8IUR7|ARMC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:35	ms_run[1]:scan=9619	23.708535556266668	3	1426.786547	1424.780970	D	K	639	651
PSM	RRTDPECTAPIK	2135	sp|Q8N1G2|CMTR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=4342	16.043746584533334	3	1442.730762	1442.729997	K	K	3	15
PSM	KKESDLNGAQIKL	2136	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8027	21.457411092266668	3	1442.810588	1442.809293	A	R	123	136
PSM	KKGKAINIGQLVDV	2137	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9861	24.15264940693333	3	1481.892444	1481.892963	Q	K	628	642
PSM	KKKQDFDEDDIL	2138	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8708	22.424088010933335	3	1492.738457	1492.740939	E	K	48	60
PSM	KKNVIQSVLQAIR	2139	sp|Q7L576|CYFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10868	27.427161178400002	3	1495.919891	1495.919847	K	K	503	516
PSM	KKKEEPSQNDISP	2140	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4159	15.659799348	3	1498.763035	1498.762737	A	K	78	91
PSM	KRSSTLSQLPGDKS	2141	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5506	17.7054897224	2	1502.806651	1502.805270	K	K	591	605
PSM	KRMALLVQELSSH	2142	sp|Q9HD15|SRA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:35	ms_run[1]:scan=8893	22.694467200000002	3	1527.812621	1526.823898	K	R	159	172
PSM	KHEKEDGAISTIVL	2143	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9278	23.214580463733334	3	1538.830104	1538.830422	F	R	364	378
PSM	KKLKDVLLQVDDE	2144	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9416	23.407294167466667	3	1541.871348	1541.866474	E	R	1842	1855
PSM	KKEKEPDYVLLSE	2145	sp|Q9NUL3|STAU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8836	22.605026295733335	3	1576.837659	1576.834839	A	R	319	332
PSM	KKAKPAMPQDSVPSP	2146	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6312	18.881907042399998	3	1579.840935	1579.839213	A	R	468	483
PSM	KKEKEPEYTLLTE	2147	sp|O95793|STAU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8595	22.260763899466667	3	1606.845551	1606.845404	A	R	298	311
PSM	KKEKEPEYTLLTE	2148	sp|O95793|STAU1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8602	22.2702390704	3	1606.845551	1606.845404	A	R	298	311
PSM	KKDFINFISDKEW	2149	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10803	27.1145213136	3	1668.851608	1668.851158	T	K	120	133
PSM	RKSMSVYCTPNKPS	2150	sp|P16615|AT2A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=4336	16.034480034933335	3	1669.795685	1669.791612	D	R	491	505
PSM	KKTQEKDDDMLFAL	2151	sp|O60784|TOM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=9682	23.8140057264	3	1696.834600	1696.834188	R	-	479	493
PSM	KHTTSIFDDFAHYE	2152	sp|Q9BYJ9|YTHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10648	26.405620382666665	3	1709.769022	1709.768550	Y	K	527	541
PSM	KKISSIQSIVPALEIANAHR	2153	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10379	25.441561653333334	5	2174.253392	2174.253536	E	K	249	269
PSM	RRLGAPQQPGPGPPPSR	2154	sp|Q96CX2|KCD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5170	17.2294969704	3	1766.965058	1766.965234	V	R	127	144
PSM	KFYISDLWKMLQLE	2155	sp|Q6P4H8-2|ACKMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=4993	16.9982716496	3	1828.917523	1828.943344	A	K	140	154
PSM	RRLLELGPKPEVAQQT	2156	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8485	22.094367130933332	3	1834.042055	1834.042481	A	R	1126	1142
PSM	RRDVTQLDPNKSLLEV	2157	sp|Q9UNN5|FAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9838	24.104412092799997	3	1882.026835	1882.027225	P	K	621	637
PSM	KKVKTDTVLILC	2158	sp|Q9HB71|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=8706	22.421950272	2	1416.836581	1416.837422	S	R	143	155
PSM	KKKSPVPVETL	2159	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6841	19.72642016533333	2	1224.748295	1224.744174	K	K	578	589
PSM	RKTEELEEESFPERS	2160	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7443	20.627693437866665	3	1864.878943	1864.880286	Q	K	485	500
PSM	RKKGLEMDPIDCTPPEYILPGS	2161	sp|O75153|CLU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:4	ms_run[1]:scan=10606	26.239929231466665	3	2515.242561	2515.245082	K	R	173	195
PSM	KTVETRDGQVINETSQHHDDLE	2162	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6643	19.39750568186667	4	2551.179127	2550.194637	I	-	445	467
PSM	KAAEEVRHL	2163	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4398	16.128	2	1051.5774	1051.5774	E	K	8	17
PSM	KAHTPQVH	2164	sp|Q8TCC3-3|RM30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3425	14.583	2	916.4879	916.4879	E	K	93	101
PSM	KANGTTVHVGIHPSKVVIT	2165	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7828	21.162	3	1957.1109	1957.1109	E	R	89	108
PSM	KCTKEEHLCTQ	2166	sp|P06753-7|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3609	14.817	3	1432.6439	1432.6439	L	R	135	146
PSM	KCVHLEALKN	2167	sp|P83436|COG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4	ms_run[2]:scan=5641	17.909	2	1210.6492	1210.6492	E	R	173	183
PSM	KEAEKELHE	2168	sp|Q14141-2|SEPT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3576	14.786	2	1111.551	1111.5510	L	K	358	367
PSM	KEHDQLIEK	2169	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4141	15.631	3	1138.5982	1138.5982	L	R	331	340
PSM	KEHPVKQELE	2170	sp|Q13901|C1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3897	15.126	3	1235.651	1235.6510	P	R	79	89
PSM	KEHVIEALR	2171	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5864	18.221	3	1093.6244	1093.6244	N	R	145	154
PSM	KEKELLIHE	2172	sp|Q96BN8|OTUL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6414	19.037	3	1137.6394	1137.6394	E	R	64	73
PSM	KEKLTGLH	2173	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4222	15.841	2	924.53927	924.5393	V	K	1339	1347
PSM	KELSNHNERVEE	2174	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3711	14.916	3	1482.7063	1482.7063	L	R	1065	1077
PSM	KEPNSLHGGVRGFD	2175	sp|Q96C23|GALM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6744	19.554	3	1511.7481	1511.7481	N	K	101	115
PSM	KEQGKEEHGSGAADANQAEGHESNFIAQLASQ	2176	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9798	24.03	4	3337.5196	3337.5196	E	K	5056	5088
PSM	KERGQLQEAIEHY	2177	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8206	21.716	3	1599.8005	1599.8005	Y	R	90	103
PSM	KFAHPSKSCQVENG	2178	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:4	ms_run[2]:scan=3842	15.05	3	1587.7464	1587.7464	C	R	35	49
PSM	KFETVHQIH	2179	sp|Q00013-2|EM55_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5298	17.417	3	1137.5931	1137.5931	T	K	332	341
PSM	KFGLSVGHHLG	2180	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8112	21.589	3	1150.6247	1150.6247	K	K	213	224
PSM	KFHPIQGH	2181	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4431	16.177	2	962.50863	962.5086	V	R	159	167
PSM	KFKEEVNHYSNEIN	2182	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6980	19.965	3	1749.8322	1749.8322	L	K	864	878
PSM	KGFAFISFHR	2183	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10131	24.748	3	1208.6455	1208.6455	S	R	280	290
PSM	KGIKQDLIH	2184	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5985	18.415	3	1050.6186	1050.6186	T	R	28	37
PSM	KGKITFADFH	2185	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8549	22.2	3	1162.6135	1162.6135	E	R	468	478
PSM	KGTQSLNPHNDYCQHFVDTGH	2186	sp|Q9HCE5|MET14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:4	ms_run[2]:scan=7624	20.863	5	2454.0771	2454.0771	L	R	108	129
PSM	KHDELLAEHI	2187	sp|Q68E01-4|INT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8201	21.707	3	1203.6248	1203.6248	M	K	395	405
PSM	KHEFQAETK	2188	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3671	14.876	3	1116.5564	1116.5564	S	K	34	43
PSM	KHETWSGHVISS	2189	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6452	19.087	2	1366.663	1366.6630	T	-	136	148
PSM	KHFFINICH	2190	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=9099	22.99	3	1214.6019	1214.6019	K	R	512	521
PSM	KHIFNAIKIT	2191	sp|Q9UJ41|RABX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8559	22.212	3	1183.7077	1183.7077	S	K	296	306
PSM	KHIQALAIR	2192	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6133	18.649	2	1048.6505	1048.6505	Q	R	884	893
PSM	KHLVSAGYVHVN	2193	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6750	19.562	3	1322.7095	1322.7095	K	R	345	357
PSM	KHLYQIEKPC	2194	sp|O00443|P3C2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=6334	18.916	3	1314.6754	1314.6754	N	K	532	542
PSM	KHPAKPDPSGECNPDL	2195	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:4	ms_run[2]:scan=5158	17.212	3	1760.8152	1760.8152	T	R	155	171
PSM	KHVDSIINK	2196	sp|Q3KQU3-4|MA7D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4448	16.199	2	1052.5978	1052.5978	P	R	260	269
PSM	KHVLEGHD	2197	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3574	14.785	2	933.46683	933.4668	V	R	198	206
PSM	KHVVFIAQR	2198	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5962	18.391	3	1096.6505	1096.6505	G	R	90	99
PSM	KIGEHMEEHGI	2199	sp|Q16881-7|TRXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35	ms_run[2]:scan=4640	16.495	3	1294.5976	1294.5976	N	K	197	208
PSM	KIHLDNLDK	2200	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6441	19.073	3	1094.6084	1094.6084	T	R	470	479
PSM	KILPNYHHL	2201	sp|O00399|DCTN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7387	20.552	3	1133.6346	1133.6346	M	K	169	178
PSM	KIYHPNVDKLG	2202	sp|P61088|UBE2N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6670	19.433	2	1282.7034	1282.7034	T	R	74	85
PSM	KKEQDIYTHLV	2203	sp|Q96SN8-4|CK5P2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8368	21.938	3	1372.7351	1372.7351	L	K	558	569
PSM	KKFGTINIVHP	2204	sp|Q9Y617-2|SERC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8634	22.32	3	1252.7292	1252.7292	A	K	116	127
PSM	KKISSIQSIVPALEIANAH	2205	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10699	26.63	3	2018.1524	2018.1524	E	R	249	268
PSM	KKLSMYGVDLH	2206	sp|P11171-6|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=7296	20.432	3	1305.6751	1305.6751	A	K	147	158
PSM	KKPHTTEEIGVPIS	2207	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7407	20.578	3	1534.8355	1534.8355	M	R	477	491
PSM	KLAENIDAQLK	2208	sp|P37198|NUP62_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6014	18.459	2	1241.698	1241.6980	Y	R	435	446
PSM	KLHIVQVVCK	2209	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:4	ms_run[2]:scan=7523	20.732	3	1222.722	1222.7220	P	K	183	193
PSM	KLHTLSVEHQ	2210	sp|Q5JRA6-2|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5341	17.467	3	1190.6408	1190.6408	A	R	605	615
PSM	KLHYCVSCAIHS	2211	sp|Q5JNZ5|RS26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=7560	20.78	3	1473.6857	1473.6857	V	K	70	82
PSM	KLKEHLGSAVDVAEY	2212	sp|Q9UPW6-2|SATB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8500	22.115	3	1657.8675	1657.8675	G	K	557	572
PSM	KLKQSGEPFLQDGSCINVAPHLH	2213	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:4	ms_run[2]:scan=9594	23.672	5	2574.3013	2574.3013	K	K	890	913
PSM	KLLEHSFIK	2214	sp|O14733|MP2K7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7843	21.183	3	1113.6546	1113.6546	N	R	373	382
PSM	KLQGKPQSHEL	2215	sp|Q8IVD9|NUDC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4318	16.009	2	1263.6935	1263.6935	Q	K	315	326
PSM	KLRDLHPDLEGQL	2216	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9173	23.08	3	1532.8311	1532.8311	G	K	265	278
PSM	KMHFESGSTLK	2217	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35	ms_run[2]:scan=4364	16.077	3	1279.6231	1279.6231	D	K	110	121
PSM	KMKETAENYLGHTA	2218	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35	ms_run[2]:scan=6128	18.645	3	1607.7614	1607.7614	M	K	173	187
PSM	KMLTFNPHK	2219	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35	ms_run[2]:scan=5395	17.545	3	1130.5906	1130.5907	D	R	292	301
PSM	KMSGKHDVGAYMLMY	2220	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=9178	23.086	3	1761.7888	1761.7888	T	K	3814	3829
PSM	KNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEV	2221	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10599	26.213	5	3537.592	3537.5920	N	K	1152	1185
PSM	KNHINNELK	2222	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3781	14.986	3	1108.5989	1108.5989	N	R	469	478
PSM	KNIHINPHF	2223	sp|Q96EV2|RBM33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7539	20.75	3	1118.5985	1118.5985	P	K	383	392
PSM	KNIHLNLDR	2224	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6395	19.008	3	1121.6305	1121.6305	I	R	99	108
PSM	KPLAHHIPVE	2225	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5458	17.658	3	1139.6451	1139.6451	S	K	94	104
PSM	KPRAEHIPSGPL	2226	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7032	20.046	3	1300.7252	1300.7252	N	R	982	994
PSM	KRGFGFVTFDDHDPVD	2227	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11057	28.293	3	1850.8588	1850.8588	K	K	152	168
PSM	KRLIDLHSPSEIV	2228	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9537	23.58	3	1505.8566	1505.8566	H	K	86	99
PSM	KRNLLYVADSYNH	2229	sp|Q8NBF2-2|NHLC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8608	22.276	3	1591.8107	1591.8107	K	K	126	139
PSM	KRPPEIQHF	2230	sp|Q96KQ7-2|EHMT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6230	18.764	3	1150.6247	1150.6247	E	R	200	209
PSM	KRSLATMDSPPHQ	2231	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35	ms_run[2]:scan=3850	15.06	3	1482.7249	1482.7249	R	K	1525	1538
PSM	KRVHLMNPMVPGLTGS	2232	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=8414	21.994	3	1767.9124	1767.9124	S	K	206	222
PSM	KSHILTHA	2233	sp|P25490|TYY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3934	15.19	2	905.5083	905.5083	L	K	401	409
PSM	KSHNSWENSDDSRN	2234	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3953	15.219	3	1674.6982	1674.6982	E	K	122	136
PSM	KSKGQSSLALH	2235	sp|P11234|RALB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4294	15.978	3	1154.6408	1154.6408	N	K	5	16
PSM	KSTLHNWMSEFK	2236	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9902	24.232	3	1506.7289	1506.7289	P	R	238	250
PSM	KTHHNDTELI	2237	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5726	18.025	3	1206.5993	1206.5993	I	R	290	300
PSM	KTKFGYHIIMVEG	2238	sp|Q9Y237|PIN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9592	23.669	3	1521.8014	1521.8014	V	R	117	130
PSM	KTKSPFEQHI	2239	sp|Q92520|FAM3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6717	19.507	3	1213.6455	1213.6455	I	K	191	201
PSM	KTVTAMDVVYALK	2240	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35	ms_run[2]:scan=10127	24.737	3	1453.7851	1453.7851	R	R	80	93
PSM	KVHVIFNYKG	2241	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8074	21.534	3	1203.6764	1203.6764	K	K	143	153
PSM	KVHVQTINAK	2242	sp|Q9NVX0-2|HAUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4199	15.761	3	1136.6666	1136.6666	S	-	132	142
PSM	KVIQTHPHAN	2243	sp|Q86TU7-3|SETD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3512	14.712	3	1143.6149	1143.6149	Y	K	222	232
PSM	KVKHLEVSSASMAEDLC	2244	sp|Q4V328-4|GRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=7200	20.299	3	1918.9128	1918.9128	E	R	697	714
PSM	KVKMTTHL	2245	sp|P63165-2|SUMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=3748	14.952	2	972.54264	972.5426	F	K	12	20
PSM	KYVLIRVHSAP	2246	sp|Q9NRX4-2|PHP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7770	21.082	3	1281.7557	1281.7557	F	R	21	32
PSM	RALELNPKH	2247	sp|Q6ZXV5-2|TMTC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5080	17.106	3	1076.6091	1076.6091	N	K	622	631
PSM	RALQHSYLH	2248	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5038	17.048	3	1123.5887	1123.5887	F	K	288	297
PSM	RAPLPLGHIK	2249	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7360	20.518	3	1100.6818	1100.6818	Q	R	486	496
PSM	RCIIPNHEK	2250	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4	ms_run[2]:scan=4761	16.669	3	1165.6026	1165.6026	V	K	670	679
PSM	RDEPPRAPWNHGEE	2251	sp|P49750-1|YLPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6872	19.788	3	1688.7655	1688.7655	H	R	990	1004
PSM	RDHAVVVGVYRPPP	2252	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7690	20.971	4	1560.8525	1560.8525	E	K	304	318
PSM	RDHPLPEVAHV	2253	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7348	20.502	3	1268.6626	1268.6626	R	K	42	53
PSM	REGQGLGKHEQGLSTALSVE	2254	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8465	22.065	4	2095.0658	2095.0658	F	K	249	269
PSM	REHVMNEVDTNKD	2255	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=3628	14.835	3	1601.7104	1601.7104	M	R	298	311
PSM	RERADDPLGCAVAH	2256	sp|Q96HA7-2|TONSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=6824	19.692	3	1565.7369	1565.7369	L	R	57	71
PSM	RFDDHKGPTISLTQIV	2257	sp|Q15904|VAS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10568	26.102	4	1825.9686	1825.9686	D	-	455	471
PSM	RFPTHVKDVATVC	2258	sp|Q9NZL9-3|MAT2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:4	ms_run[2]:scan=7558	20.778	3	1528.782	1528.7820	Q	R	219	232
PSM	RGAKEEHGGLI	2259	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5098	17.135	3	1165.6204	1165.6204	T	R	67	78
PSM	RGLFIIDDKGIL	2260	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=11129	28.584	3	1358.7922	1358.7922	L	R	200	212
PSM	RGSICLHDKD	2261	sp|Q68D91|MBLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4	ms_run[2]:scan=4317	16.008	3	1199.5717	1199.5717	S	R	172	182
PSM	RHALPPGFVLK	2262	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8593	22.259	3	1233.7346	1233.7346	Y	K	208	219
PSM	RHGFEAASIKEE	2263	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5975	18.406	3	1372.6735	1372.6735	E	R	42	54
PSM	RHLQLAIRNDEELN	2264	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8535	22.181	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLYLFPGHPPT	2265	sp|P42575|CASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9163	23.069	3	1433.7568	1433.7568	C	-	441	453
PSM	RHSPSIHQSVVAVS	2266	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6215	18.74	3	1502.7954	1502.7954	T	R	717	731
PSM	RHTTDHPMQCILT	2267	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=5649	17.918	3	1624.745	1624.7450	T	R	45	58
PSM	RIHTGEKPYECNECG	2268	sp|Q4V348|Z658B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4637	16.491	3	1848.7883	1848.7883	Q	K	382	397
PSM	RITAFHNAHDLS	2269	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6547	19.248	3	1380.6898	1380.6898	K	K	693	705
PSM	RKFLSDPQVHTVLVE	2270	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9272	23.208	3	1766.9679	1766.9679	M	R	66	81
PSM	RKQLEALMAEHQ	2271	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7672	20.943	3	1452.7507	1452.7507	R	R	841	853
PSM	RKSGTLGHPGSLDETTYE	2272	sp|Q16595-2|FRDA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7114	20.168	3	1946.9334	1946.9334	L	R	79	97
PSM	RKSNVESALSHGL	2273	sp|Q76FK4-4|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8035	21.469	3	1396.7423	1396.7423	K	K	430	443
PSM	RKSPYLPSAH	2274	sp|Q9NRH3|TBG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5253	17.35	3	1154.6196	1154.6196	S	R	362	372
PSM	RLGAMDIDTHK	2275	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6598	19.318	3	1255.6343	1255.6343	E	K	441	452
PSM	RLILIESRIH	2276	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9013	22.869	3	1248.7666	1248.7666	F	R	114	124
PSM	RLQILHIHTA	2277	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8614	22.286	3	1200.7091	1200.7091	G	R	309	319
PSM	RLSSHPVLSKD	2278	sp|Q9Y5X3|SNX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4839	16.777	3	1237.6779	1237.6779	Q	R	149	160
PSM	RLTHELPGIK	2279	sp|Q9H147|TDIF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7065	20.096	3	1162.6822	1162.6822	P	R	138	148
PSM	RLVHFEPHM	2280	sp|Q5VT66-3|MARC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:35	ms_run[2]:scan=6546	19.247	3	1180.5811	1180.5811	Y	R	77	86
PSM	RMHEDINEEWISDKT	2281	sp|P28331-3|NDUS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9027	22.891	3	1901.8578	1901.8578	P	R	165	180
PSM	RMHTTFEHDIQALGTQV	2282	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10313	25.244	3	1982.9632	1982.9632	Q	R	1831	1848
PSM	RPGGFPDHPH	2283	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4873	16.814	3	1115.5261	1115.5261	G	R	49	59
PSM	RSAHNPDDIKP	2284	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4501	16.28	3	1248.6211	1248.6211	I	R	245	256
PSM	RSHISDQSPLSSK	2285	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4974	16.972	4	1440.7321	1440.7321	E	R	344	357
PSM	RTHLDIYDHCQS	2286	sp|Q96HA7-2|TONSL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=6671	19.434	3	1543.6838	1543.6838	G	R	115	127
PSM	RTKYDNLHLEDLFIGN	2287	sp|Q9Y5B8-2|NDK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10883	27.498	3	1946.985	1946.9850	K	K	13	29
PSM	RVANDRDQEMHIDLEN	2288	sp|Q9HCG8|CWC22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35	ms_run[2]:scan=6168	18.684	3	1969.8912	1969.8912	S	K	799	815
PSM	RVIKLDHGSGEPY	2289	sp|O75157-2|T22D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7037	20.052	3	1469.7627	1469.7627	F	R	163	176
PSM	RVLEQHKLT	2290	sp|P35241-3|RADI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4576	16.408	3	1122.6509	1122.6509	Q	K	124	133
PSM	RVPVYAHITH	2291	sp|Q5T6F0|DCA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6405	19.019	3	1191.6513	1191.6513	S	K	228	238
PSM	RWASEPEHDH	2292	sp|P08574|CY1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4331	16.026	3	1262.5428	1262.5428	L	R	275	285
PSM	RWPDLQSHHEL	2293	sp|Q15797|SMAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9108	23.001	3	1416.6898	1416.6898	W	K	93	104
PSM	RYNIPHGPVVGSTR	2294	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7495	20.695	3	1551.827	1551.8270	R	R	18	32
PSM	REDSQRPGAHLTV	2295	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6017	18.4664263656	3	1464.751108	1464.743339	S	K	92	105
PSM	RMVNHFIAEFK	2296	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	2-UNIMOD:35	ms_run[1]:scan=9162	23.0663501776	3	1407.6952	1406.7122	N	R	236	247
PSM	RIQHVVEAVRQE	2297	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5793	18.131245502133332	3	1462.800649	1462.800460	E	K	1631	1643
PSM	RAGVHIKLPLLS	2298	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10322	25.27237517893333	3	1303.816313	1302.813591	L	K	325	337
PSM	KQRSLQSLEASLHAMEST	2299	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10473	25.73770548266667	3	2015.014042	2015.010589	P	R	756	774
PSM	RRPSQNAISFFNVGHS	2300	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9863	24.158357508266665	4	1815.907265	1815.912864	Q	K	186	202
PSM	KRTNLPPDHLVEV	2301	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8194	21.696101066666664	3	1518.842015	1516.836177	S	R	208	221
PSM	RKPTHSQEPQGPEAME	2302	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:35	ms_run[1]:scan=3683	14.888648037866666	3	1836.843744	1836.842461	P	R	1484	1500
PSM	KFNEKDGHVE	2303	sp|Q9BW91|NUDT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3866	15.078311244533333	3	1201.573390	1201.572751	P	R	123	133
PSM	RIQVWHEEH	2304	sp|P26038|MOES_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6557	19.26080048373333	3	1232.605077	1232.605054	E	R	171	180
PSM	RMFPHHSITESVNYDV	2305	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:35	ms_run[1]:scan=8510	22.128560678666666	3	1946.893423	1946.894496	T	K	66	82
PSM	RHPHDIIDDINSGAVECPAS	2306	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=10174	24.864888374133333	3	2202.996155	2202.012380	G	-	146	166
PSM	RVHNNIVYNEYISH	2307	sp|O60870|KIN17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8312	21.8558331936	3	1756.864907	1756.864517	K	R	88	102
PSM	KEGAKHFSGLEEAVY	2308	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8653	22.349121745866668	3	1663.820311	1663.820586	L	R	16	31
PSM	RRLEFPSGETIVMHNP	2309	sp|Q9Y6Y8|S23IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9763	23.969221327733333	3	1883.954413	1881.951951	H	K	381	397
PSM	KTATAVAHCK	2310	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=3277	14.396801159466666	3	1085.566299	1085.565164	K	R	17	27
PSM	RSPPLHEHPLY	2311	sp|Q9BZE1|RM37_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7018	20.0279371872	3	1344.695202	1344.693869	Y	K	89	100
PSM	KGFQFFSEQVSHHPPISACHAES	2312	sp|Q9H4L5|OSBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	19-UNIMOD:4	ms_run[1]:scan=9664	23.78333299093333	4	2626.2222	2626.2022	D	R	620	643
PSM	KLHIVQVVCK	2313	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=7470	20.6634285696	3	1222.721424	1222.721999	P	K	183	193
PSM	RLGEENKGHQMLV	2314	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:35	ms_run[1]:scan=5680	17.9496422696	3	1526.770458	1525.767111	S	K	838	851
PSM	RHPQLEAVLMGTR	2315	sp|Q8NFF5|FAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:35	ms_run[1]:scan=8573	22.2293705024	3	1522.804412	1522.803831	A	R	477	490
PSM	KIHQETFGKSGC	2316	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:4	ms_run[1]:scan=4416	16.152806189066666	3	1390.664744	1390.666334	E	R	101	113
PSM	KKALPPEK	2317	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4023	15.361292947733334	2	909.566427	909.564753	S	K	674	682
PSM	KKLPNIKM	2318	sp|Q96EY4|TMA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:35	ms_run[1]:scan=4483	16.2591992648	2	986.595004	986.594673	L	R	151	159
PSM	KKLEDIRT	2319	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4662	16.535989417866666	2	1001.586935	1001.586945	S	R	1206	1214
PSM	KKGAEKEEL	2320	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3764	14.9675557648	2	1030.565882	1030.565875	Q	-	253	262
PSM	KKLMDLLPK	2321	sp|Q16630|CPSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=8217	21.7296780976	3	1100.662122	1100.662752	S	R	138	147
PSM	KKDPGNEVKL	2322	sp|O75521|ECI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5264	17.365914934933336	3	1126.635757	1126.634623	L	K	54	64
PSM	KKAEPVKVLQ	2323	sp|Q15054|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4876	16.816687289333334	3	1138.707209	1138.707394	S	K	286	296
PSM	KKYGLKPPTL	2324	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7955	21.346992993866667	3	1143.702402	1143.701580	A	-	599	609
PSM	KKVEKVTISN	2325	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3879	15.094815312	3	1144.681904	1144.681573	D	R	446	456
PSM	RKSDVVLDKGG	2326	sp|Q8WUR7|CO040_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4102	15.508452158933332	2	1172.651780	1172.651336	L	K	114	125
PSM	KKGDIIQLQR	2327	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6732	19.535334200266668	3	1197.719471	1197.719356	L	R	665	675
PSM	RKAEIMESIK	2328	sp|Q14683|SMC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6157	18.672162562933334	2	1203.662141	1203.664543	Q	R	499	509
PSM	RKGVAINFVTEEDK	2329	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8320	21.8693205792	4	1604.852256	1604.852221	G	R	369	383
PSM	KKKEPEPNFQLLDNPA	2330	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9615	23.703898122666665	3	1868.973393	1866.983963	E	R	867	883
PSM	KKTLDPDPAIR	2331	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5483	17.682096402133332	3	1252.714403	1252.713936	L	R	16	27
PSM	KKLSDYVGKNE	2332	sp|P57076|CF298_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6150	18.666562901333336	3	1279.681582	1279.677216	T	K	202	213
PSM	KRLEAFLTQKA	2333	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8306	21.8476272848	3	1303.759387	1303.761221	K	K	52	63
PSM	RKEQELTQAIK	2334	sp|Q9H501|ESF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5366	17.49635363866667	3	1342.758526	1342.756864	E	K	799	810
PSM	RPSHLTNKFED	2335	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5366	17.49635363866667	3	1342.654580	1342.662963	F	K	207	218
PSM	KRLEAFLTQKQ	2336	sp|Q02750|MP2K1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7960	21.353228111733333	3	1360.783751	1360.782684	R	K	48	59
PSM	KLNGHQLENHAL	2337	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6461	19.099088896	3	1372.720225	1372.721147	M	K	138	150
PSM	KKGPGLAVQSGDKT	2338	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4153	15.651334742133335	3	1384.768223	1384.767428	Q	K	152	166
PSM	KKKAVLQALEVLPVAPPPEP	2339	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10687	26.579256142400002	3	2124.273596	2123.271812	S	R	948	968
PSM	KKAVLFCLSDDK	2340	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=8740	22.465229093599998	3	1422.755140	1422.754087	R	R	33	45
PSM	RKLTPQGQRDLD	2341	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4554	16.374608902133335	3	1425.769273	1425.768825	G	R	121	133
PSM	KIKAPGFAHLAGLD	2342	sp|O75306|NDUS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10039	24.530973852266666	2	1436.814087	1436.813984	C	K	423	437
PSM	KNPHAPTIHFNY	2343	sp|P36551|HEM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8744	22.471324945066666	3	1437.716142	1437.715333	P	R	250	262
PSM	KRASEDTTSGSPPK	2344	sp|Q9BZZ5|API5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3314	14.440050858933335	3	1459.727675	1459.726686	Q	K	454	468
PSM	KRDLTQMADELR	2345	sp|P41227|NAA10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8826	22.590142970666665	3	1474.756303	1474.756212	M	R	148	160
PSM	KRKASGPPVSELIT	2346	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8011	21.428733908	3	1481.856488	1481.856578	G	K	33	47
PSM	KKPKLQNATPTNF	2347	sp|Q9NXF1|TEX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6465	19.103536794666663	3	1485.829123	1485.830363	K	K	21	34
PSM	RKNPLPPSVGVVDK	2348	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6858	19.767859403733333	3	1504.872430	1504.872562	D	K	78	92
PSM	RKNPLPPSVGVVDK	2349	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8233	21.751244342933333	3	1504.873198	1504.872562	D	K	78	92
PSM	RKNPLPPSVGVVDK	2350	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7985	21.390848808533335	3	1504.873198	1504.872562	D	K	78	92
PSM	RKNLLLEPSLEAK	2351	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8758	22.489618601866667	3	1509.891721	1509.887878	A	R	281	294
PSM	RTATEKPLGELWK	2352	sp|P23919|KTHY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9069	22.956223894666667	3	1527.836221	1527.840928	I	-	200	213
PSM	KKLLEGGKGGIADSVA	2353	sp|Q9H2M9|RBGPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7265	20.375059646666667	3	1541.871604	1541.877707	V	K	928	944
PSM	RKQGGSPDEPDSKAT	2354	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3364	14.507992338666666	3	1571.755421	1571.753963	K	R	278	293
PSM	RRAGAADSAPYPGGGGNGASGGGSGGSK	2355	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4170	15.689232500000001	3	2375.101045	2375.096261	S	R	196	224
PSM	KKCLEEKNEILQG	2356	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=6139	18.65583588666667	3	1587.829766	1587.829043	D	K	373	386
PSM	RKTVTAMDVVYALK	2357	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10507	25.8625649968	3	1593.890429	1593.891249	K	R	79	93
PSM	KRPLLAFACDDKDG	2358	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:4	ms_run[1]:scan=8733	22.454579213333332	3	1604.797930	1604.798077	P	K	318	332
PSM	RRALAAPAAEEKEEA	2359	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4976	16.9782340904	3	1610.838385	1610.837633	K	R	8	23
PSM	RRFSDQFPLPLKE	2360	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10111	24.699601954400002	3	1631.879659	1631.878376	W	R	878	891
PSM	KKAEPVKVLQ	2361	sp|Q15054|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4926	16.877580651466666	2	1138.707224	1138.707394	S	K	286	296
PSM	RKEGLLGLQNLLKNQ	2362	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10560	26.074920033333335	3	1723.006270	1723.010453	E	R	670	685
PSM	RKLSEKLDSTDFTGTI	2363	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9439	23.447072960800003	3	1809.947574	1809.947243	K	K	129	145
PSM	KKKCADPDLNAVLYTN	2364	sp|O95801|TTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4	ms_run[1]:scan=8668	22.369500921866667	3	1850.920278	1848.940384	L	R	107	123
PSM	RKEEDPKTASQSLLVNL	2365	sp|Q01826|SATB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10177	24.8733319632	3	1927.038473	1927.037455	L	R	410	427
PSM	KKDAQSNAARDFVNYLV	2366	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10605	26.236027330400002	3	1937.992267	1937.995925	N	R	54	71
PSM	KKPDREEIQMSNMGSNT	2367	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:35	ms_run[1]:scan=5004	17.009348585599998	3	1979.903487	1979.904075	D	K	881	898
PSM	KKQGKQEAADAAL	2368	sp|P55265|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4206	15.7807899408	2	1356.735678	1356.736128	S	R	777	790
PSM	KKKPLFITTDSS	2369	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6905	19.836086117866667	2	1363.769449	1363.771117	A	K	688	700
PSM	RRPQVPIKYQQITPVNQS	2370	sp|Q9NYL2|M3K20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8367	21.935653537866663	3	2151.191733	2151.191271	V	R	616	634
PSM	KKTALPAGLSATEKADAHEEDEL	2371	sp|Q567U6|CCD93_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8401	21.977465788266667	4	2423.220516	2423.217999	D	R	223	246
PSM	KKQKVEGTEPTTAFNLFVGNLNFN	2372	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=11308	29.322935749333332	4	2695.397269	2695.396966	A	K	294	318
PSM	KAKLGDSHDLQ	2373	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4100	15.505	3	1210.6306	1210.6306	R	R	1312	1323
PSM	KAKYHGNVMLL	2374	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=7347	20.5	3	1288.6962	1288.6962	P	R	2436	2447
PSM	KATGNPKHPFS	2375	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4356	16.064	2	1182.6146	1182.6146	E	K	206	217
PSM	KAYHPHCFTCVVCA	2376	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8075	21.536	3	1748.7585	1748.7585	G	R	304	318
PSM	KDHTVRSTGPA	2377	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3440	14.607	3	1167.5996	1167.5996	T	K	188	199
PSM	KDHYEATAMH	2378	sp|O75832-2|PSD10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3985	15.296	3	1201.5186	1201.5186	A	R	135	145
PSM	KDKMHFESGSTL	2379	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:35	ms_run[2]:scan=5456	17.654	3	1394.65	1394.6500	N	K	108	120
PSM	KDKMHFESGSTL	2380	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7158	20.232	3	1378.6551	1378.6551	N	K	108	120
PSM	KDSTLIMQLL	2381	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:35	ms_run[2]:scan=11176	28.772	2	1176.6424	1176.6424	Y	R	212	222
PSM	KEHQETIDELR	2382	sp|Q02224-3|CENPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5944	18.359	3	1396.6947	1396.6947	L	R	1220	1231
PSM	KELAPHVK	2383	sp|Q8N0X7|SPART_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3828	15.037	2	920.54435	920.5444	G	K	507	515
PSM	KELQTLHNLR	2384	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6119	18.631	3	1250.7095	1250.7095	A	K	791	801
PSM	KEVHIKNLPSLF	2385	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10311	25.238	3	1423.8187	1423.8187	R	K	1168	1180
PSM	KFPHSAHQ	2386	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3626	14.831	2	950.47225	950.4722	L	K	63	71
PSM	KFQHPSHELL	2387	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7204	20.306	3	1234.6459	1234.6459	P	K	794	804
PSM	KGKNVIHPFLS	2388	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8065	21.521	3	1238.7135	1238.7135	L	R	560	571
PSM	KHDGSHEGTVYF	2389	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7430	20.609	3	1375.6157	1375.6157	G	K	48	60
PSM	KHDNLLHGT	2390	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4606	16.455	2	1033.5305	1033.5305	E	K	547	556
PSM	KHHEDIVDEIECIE	2391	sp|Q7Z7A1-2|CNTRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=10563	26.082	3	1764.7989	1764.7989	L	K	860	874
PSM	KHKSETDTSLI	2392	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5878	18.239	3	1257.6565	1257.6565	M	R	152	163
PSM	KHLAELNHQ	2393	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4024	15.363	3	1088.5727	1088.5727	Q	K	143	152
PSM	KHPFFDLLK	2394	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10298	25.203	3	1143.6441	1143.6441	L	K	473	482
PSM	KHSQFLGYPITLYLEKE	2395	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10922	27.675	3	2065.0884	2065.0884	E	R	126	143
PSM	KHVFFFDTK	2396	sp|Q9Y3A2|UTP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9505	23.529	3	1167.6077	1167.6077	N	K	135	144
PSM	KHVVFGHV	2397	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5854	18.205	2	921.51847	921.5185	G	K	167	175
PSM	KIAVHCTVRGA	2398	sp|P62913-2|RL11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4	ms_run[2]:scan=4617	16.468	3	1210.6605	1210.6605	E	K	66	77
PSM	KIHHEMQVLE	2399	sp|Q9NPJ6-2|MED4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=4546	16.365	2	1278.6391	1278.6391	G	K	42	52
PSM	KIHLDEKSF	2400	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7755	21.063	3	1115.5975	1115.5975	E	R	286	295
PSM	KIKHEIINEDQENAIDN	2401	sp|Q5TB30-2|DEP1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6800	19.657	3	2022.0018	2022.0018	E	R	162	179
PSM	KIRLQAYHTQTTPLIEYY	2402	sp|P54819-6|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10210	24.954	4	2237.1845	2237.1845	L	R	136	154
PSM	KKHPDASVNFSEFS	2403	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8748	22.476	3	1591.7631	1591.7631	K	K	29	43
PSM	KKILEVHID	2404	sp|P31689-2|DNJA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7741	21.041	3	1093.6495	1093.6495	E	K	205	214
PSM	KKINPICNDHY	2405	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4	ms_run[2]:scan=5910	18.315	3	1400.6871	1400.6871	V	R	64	75
PSM	KKLPIQEFHLS	2406	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9380	23.355	3	1338.766	1338.7660	A	R	136	147
PSM	KKMTFSEHPYNNL	2407	sp|Q9UQ88-8|CD11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35	ms_run[2]:scan=7295	20.431	3	1623.7715	1623.7715	V	R	44	57
PSM	KKNCPHVVVGTPG	2408	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4	ms_run[2]:scan=4859	16.797	3	1391.7344	1391.7344	L	R	161	174
PSM	KKNIPEGSHQYELL	2409	sp|Q7L9L4|MOB1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8251	21.776	3	1654.8679	1654.8679	P	K	16	30
PSM	KKNSGQHLPIFPAWVYE	2410	sp|Q9BSJ2-3|GCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10973	27.918	3	2013.0472	2013.0472	N	R	37	54
PSM	KKTVSSHEVFLQ	2411	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6776	19.613	3	1401.7616	1401.7616	F	R	137	149
PSM	KKVEQDLWNHAF	2412	sp|Q92540-2|SMG7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9677	23.807	3	1513.7678	1513.7678	D	K	54	66
PSM	KLKALYEQSLHI	2413	sp|P61201|CSN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9610	23.695	3	1441.8293	1441.8293	K	K	213	225
PSM	KLQGKPQSHEL	2414	sp|Q8IVD9|NUDC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4331	16.026	3	1263.6935	1263.6935	Q	K	315	326
PSM	KLTTHKEELYP	2415	sp|Q9BUK6-3|MSTO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6550	19.251	3	1357.7242	1357.7242	G	K	100	111
PSM	KMLLNLHK	2416	sp|O00487|PSDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35	ms_run[2]:scan=6158	18.673	2	1011.5899	1011.5899	Q	K	215	223
PSM	KMYEEHLK	2417	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35	ms_run[2]:scan=3814	15.021	3	1092.5274	1092.5274	C	R	34	42
PSM	KNDVLHNFWK	2418	sp|Q53T94-2|TAF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9663	23.781	3	1299.6724	1299.6724	L	R	101	111
PSM	KNGHEIKVDEE	2419	sp|Q9BYD6|RM01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4155	15.654	3	1296.631	1296.6310	F	R	238	249
PSM	KPEHYSELIK	2420	sp|Q8TBZ6|TM10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6354	18.947	3	1242.6608	1242.6608	I	K	170	180
PSM	KPFYYQHPERDI	2421	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8175	21.673	3	1591.7783	1591.7783	C	R	378	390
PSM	KPHNVMIDHQQ	2422	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=3744	14.947	3	1361.651	1361.6510	V	K	159	170
PSM	KPKFQEHIIQAP	2423	sp|Q9UHD1-2|CHRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8019	21.441	3	1434.7983	1434.7983	L	K	70	82
PSM	KPRIPLDVGH	2424	sp|Q9NPB8|GPCP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7355	20.51	3	1130.656	1130.6560	W	R	314	324
PSM	KQATYGYYLGNPAEFHDSSDHHTF	2425	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9915	24.262	5	2784.2205	2784.2205	Y	K	90	114
PSM	KQTIERLEQEHTN	2426	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5581	17.826	3	1624.8169	1624.8169	Q	R	886	899
PSM	KRPELLTHSTTEVTQP	2427	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7427	20.606	3	1835.9741	1835.9741	I	R	498	514
PSM	KRPNPDILDHE	2428	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6530	19.218	2	1332.6786	1332.6786	V	R	51	62
PSM	KSHLGNVHDQDN	2429	sp|Q8WW12-3|PCNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3567	14.777	3	1362.6276	1362.6276	I	-	44	56
PSM	KSKTHAVLVAL	2430	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8088	21.549	3	1165.7183	1165.7183	L	K	39	50
PSM	KSLGHFENLQKY	2431	sp|Q9ULV3-5|CIZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8113	21.59	3	1462.7569	1462.7569	C	K	719	731
PSM	KSTWLILHH	2432	sp|P00167-2|CYB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9074	22.961	3	1133.6346	1133.6346	S	K	24	33
PSM	KTFNIRHPEELSLL	2433	sp|Q96AC1-2|FERM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10399	25.513	3	1695.9308	1695.9308	C	K	128	142
PSM	KTHEIEIKNF	2434	sp|Q9BX63|FANCJ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8036	21.47	3	1257.6717	1257.6717	G	K	1225	1235
PSM	KTHPHFVIPY	2435	sp|P05067-2|A4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9289	23.227	3	1237.6608	1237.6608	C	R	106	116
PSM	KTIHLSSIRPP	2436	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8162	21.655	3	1247.735	1247.7350	Y	R	366	377
PSM	KTKIYHPNIDE	2437	sp|P68036-2|UB2L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5804	18.142	3	1356.7038	1356.7038	F	K	39	50
PSM	KTLQHWPHIL	2438	sp|Q8NEG7|DEN6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9531	23.571	3	1271.7139	1271.7139	I	R	340	350
PSM	KTPCRHQSPEIV	2439	sp|O75575-2|RPC9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4	ms_run[2]:scan=5002	17.008	3	1450.7351	1450.7351	S	R	22	34
PSM	KVHLEKLSL	2440	sp|P52948-6|NUP98_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8862	22.646	3	1065.6546	1065.6546	F	R	1092	1101
PSM	KVHPIKSEFI	2441	sp|Q9Y2X7-2|GIT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7868	21.215	3	1196.6917	1196.6917	D	R	98	108
PSM	KVKFTVHT	2442	sp|Q9Y5X3|SNX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5820	18.161	2	958.56	958.5600	D	K	44	52
PSM	KVKVEHVVSVLE	2443	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8246	21.768	3	1364.8028	1364.8028	E	K	559	571
PSM	KVPHPLEH	2444	sp|Q9H1A7|RPB1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4452	16.21	2	955.52395	955.5240	Y	K	61	69
PSM	KVRESELQVHSALLG	2445	sp|Q6P2H3-4|CEP85_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8817	22.577	3	1664.921	1664.9210	Q	R	306	321
PSM	KYTPPPHHIG	2446	sp|O43920|NDUS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4441	16.19	3	1145.5982	1145.5982	G	K	91	101
PSM	RAPLPLGHIK	2447	sp|P09960-4|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7111	20.165	2	1100.6818	1100.6818	Q	R	486	496
PSM	RDGHDQHVLELEA	2448	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8150	21.64	3	1517.7223	1517.7223	A	K	396	409
PSM	RDYLHLPPEIVPATL	2449	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11148	28.657	3	1732.9512	1732.9512	L	R	80	95
PSM	REAILEYILHQK	2450	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10843	27.309	3	1511.846	1511.8460	E	K	67	79
PSM	REREAILAIH	2451	sp|O43707-3|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7408	20.579	3	1206.6833	1206.6833	D	K	192	202
PSM	RESSGKYTFAAHMDGTY	2452	sp|Q15363|TMED2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:35	ms_run[2]:scan=7311	20.45	3	1935.8421	1935.8421	D	K	74	91
PSM	REVYQHLAHYVP	2453	sp|Q8IWV8-4|UBR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8651	22.347	3	1510.7681	1510.7681	T	K	36	48
PSM	RGIHPIRIADGYEQAA	2454	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8606	22.274	3	1765.9224	1765.9224	D	R	33	49
PSM	RGKPLPEYHV	2455	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6623	19.366	3	1194.6509	1194.6509	G	R	3708	3718
PSM	RGLTAHGINIKD	2456	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7197	20.296	3	1293.7153	1293.7153	R	R	531	543
PSM	RGQNHNVQGFHPY	2457	sp|Q96EP5|DAZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6612	19.352	3	1552.7284	1552.7284	G	R	393	406
PSM	RGRENYSSYSSFSSPHM	2458	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8483	22.092	3	1990.8592	1990.8592	D	K	149	166
PSM	RHDSPEDVK	2459	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3465	14.644	2	1081.5152	1081.5152	N	R	478	487
PSM	RHLAEHSPYYEAM	2460	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:35	ms_run[2]:scan=6056	18.528	3	1618.7198	1618.7198	N	K	452	465
PSM	RHLAVMPHPE	2461	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=4536	16.351	3	1201.6026	1201.6026	G	R	1290	1300
PSM	RHLAVMPHPE	2462	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=4650	16.509	2	1201.6026	1201.6026	G	R	1290	1300
PSM	RHLPNLQTH	2463	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5537	17.753	3	1114.5996	1114.5996	S	K	45	54
PSM	RHNIICLQNDH	2464	sp|O00233-2|PSMD9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4	ms_run[2]:scan=6874	19.79	3	1418.6837	1418.6837	A	K	76	87
PSM	RHPQLEAVLMGTR	2465	sp|Q8NFF5-3|FAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=8561	22.214	3	1522.8038	1522.8038	A	R	380	393
PSM	RHVVQPGYPAH	2466	sp|Q8WVC6-2|DCAKD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4666	16.54	3	1259.6523	1259.6523	A	R	36	47
PSM	RHVYLDEPIKIG	2467	sp|Q14BN4-7|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9250	23.175	3	1438.7932	1438.7932	E	R	20	32
PSM	RKAGQVFLEELGNH	2468	sp|P09543-2|CN37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9577	23.643	4	1596.8372	1596.8372	L	K	183	197
PSM	RKDNAEAISGHSVEADP	2469	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5683	17.954	3	1794.8497	1794.8497	G	K	2742	2759
PSM	RKGEIAASIATHM	2470	sp|O75880|SCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8110	21.587	3	1383.7293	1383.7293	K	R	282	295
PSM	RKGEITGEVHMPSG	2471	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35	ms_run[2]:scan=4612	16.463	3	1512.7355	1512.7355	V	K	1576	1590
PSM	RKLDLFANVVHV	2472	sp|O43837-2|IDH3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10548	26.032	3	1409.8143	1409.8143	R	K	134	146
PSM	RKNIEPTHAPFIE	2473	sp|Q9UPN3-5|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8080	21.539	3	1550.8205	1550.8205	K	K	5490	5503
PSM	RKQMVIDVLHPG	2474	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9079	22.968	3	1391.7707	1391.7707	Q	K	20	32
PSM	RKTILFIDEIH	2475	sp|Q96S55-3|WRIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10122	24.724	3	1383.7874	1383.7874	K	R	101	112
PSM	RKVELPVPTH	2476	sp|Q9BYD3-2|RM04_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7174	20.258	3	1174.6822	1174.6822	L	R	49	59
PSM	RLMGSVKDHLL	2477	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8772	22.511	3	1267.7071	1267.7071	N	R	355	366
PSM	RLNHPPEQIDSHS	2478	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4932	16.885	3	1528.7383	1528.7383	P	R	407	420
PSM	RLTHELPGIK	2479	sp|Q9H147|TDIF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7165	20.24	3	1162.6822	1162.6822	P	R	138	148
PSM	RMGHALEEIK	2480	sp|O75525-2|KHDR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35	ms_run[2]:scan=4919	16.868	3	1198.6128	1198.6128	A	K	143	153
PSM	RNVQRPESVSDHMY	2481	sp|Q7Z4H3-3|HDDC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:35	ms_run[2]:scan=5230	17.314	3	1732.7951	1732.7951	Y	R	38	52
PSM	RPGAHLTVK	2482	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4200	15.763	2	977.57705	977.5770	Q	K	97	106
PSM	RPHATDDFNHGVVLSS	2483	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7957	21.35	3	1750.8387	1750.8387	L	R	542	558
PSM	RRFVTPSEPVAHS	2484	sp|O14654|IRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6106	18.603	3	1481.7739	1481.7739	T	R	397	410
PSM	RRMTQNPNYYNLQGISH	2485	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35	ms_run[2]:scan=8187	21.687	3	2107.0018	2107.0018	Y	R	1762	1779
PSM	RRNGTLPWL	2486	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10421	25.58	2	1111.6251	1111.6251	L	R	105	114
PSM	RSIFDHIKLPQAS	2487	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10314	25.248	4	1510.8256	1510.8256	F	K	413	426
PSM	RSYPDEEGPKHWSDS	2488	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6455	19.092	3	1788.7703	1788.7703	P	R	124	139
PSM	RTETTVTRHEADSSP	2489	sp|O00165-5|HAX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3686	14.891	3	1685.7969	1685.7969	G	R	187	202
PSM	RTPKLQHLQGSALQ	2490	sp|O60826|CCD22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6709	19.49	3	1575.8845	1575.8845	L	K	148	162
PSM	RVHDPVTAKP	2491	sp|P13995-2|MTDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4369	16.083	3	1118.6196	1118.6196	N	K	176	186
PSM	RVMDQHKLT	2492	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35	ms_run[2]:scan=3618	14.825	3	1142.5866	1142.5866	Q	R	156	165
PSM	RVNTHLASVQHV	2493	sp|Q8TEA1|NSUN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6043	18.499	3	1359.7371	1359.7371	V	K	56	68
PSM	RVTVRLNQQQHPDC	2494	sp|Q5T280|CI114_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:4	ms_run[2]:scan=5491	17.69	3	1749.8693	1749.8693	L	K	226	240
PSM	RWHFYDTV	2495	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10165	24.837	2	1122.5247	1122.5247	W	K	120	128
PSM	KLGIHEDSQNR	2496	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4155	15.654155347733333	3	1295.658392	1295.658212	I	K	446	457
PSM	KSKHSEQDELMADIS	2497	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:35	ms_run[1]:scan=6799	19.6560330848	3	1732.801780	1732.793779	E	K	764	779
PSM	KGHFGPIHCV	2498	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=6943	19.9106669056	3	1150.570282	1150.570583	Y	R	262	272
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	2499	sp|P31942|HNRH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=7378	20.54200858986667	4	2574.036094	2574.066558	G	R	174	200
PSM	RPRNEEDAAELVALAQAVNA	2500	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=11106	28.490235070666664	3	2136.099643	2136.092344	P	R	348	368
PSM	KIKFPLPH	2501	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8403	21.979547009866668	2	978.601417	978.601472	S	R	149	157
PSM	RWPDLQSHHEL	2502	sp|Q15797|SMAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9118	23.013546538133333	3	1416.687365	1416.689847	W	K	93	104
PSM	KIMTYLFDFPHGPKPGSSH	2503	sp|P49902|5NTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=10071	24.605411076	5	2174.060596	2174.061896	D	R	258	277
PSM	RMGHAGAIIAGGKGGA	2504	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5393	17.543444961600002	3	1423.736120	1422.751401	R	K	296	312
PSM	RFHMDSETHDPIDLQT	2505	sp|Q9Y2L1|RRP44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35	ms_run[1]:scan=8250	21.7746192904	4	1956.862598	1956.863590	V	K	638	654
PSM	RIIHGAGYSEEDK	2506	sp|P29992|GNA11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4631	16.48430400373333	3	1473.720544	1473.721206	M	R	60	73
PSM	RKVMSQNFTNCHT	2507	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=4853	16.7914229528	3	1638.724599	1637.740245	H	K	63	76
PSM	KHVDSIINK	2508	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4437	16.18323733733333	2	1052.598097	1052.597844	P	R	260	269
PSM	RHVVQPGYPAH	2509	sp|Q8WVC6|DCAKD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4688	16.567174329066667	3	1259.653202	1259.652339	A	R	36	47
PSM	RAHPYYAGPEDGPHL	2510	sp|Q3MII6|TBC25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8253	21.778329451466668	3	1678.786168	1678.785204	D	R	297	312
PSM	RLVKYDEFHDYLE	2511	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9962	24.3642708312	3	1726.839021	1725.836236	C	R	657	670
PSM	RHQLILPAFEHEY	2512	sp|Q9H4Z3|CAPAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10227	24.99500837093333	3	1652.870037	1651.847076	K	R	606	619
PSM	KVTNVSLLEKFE	2513	sp|Q6ZN84|CCD81_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5210	17.288617456266664	3	1405.757092	1405.781681	A	R	270	282
PSM	RSLQNHQFELK	2514	sp|Q92805|GOGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6892	19.811134149866668	3	1399.743722	1398.736797	E	K	456	467
PSM	KIDPEKLSVNSHFM	2515	sp|O14561|ACPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	14-UNIMOD:35	ms_run[1]:scan=8808	22.563963927733333	3	1660.8362	1659.8282	D	K	92	106
PSM	RSAHAVKISIEGN	2516	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6327	18.903202687733334	3	1381.751768	1380.747361	S	K	803	816
PSM	KRTVENIKDPLF	2517	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9067	22.954776093066666	3	1458.799381	1458.819464	L	R	4399	4411
PSM	KKVPEPDNK	2518	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3360	14.502013016000001	2	1053.590584	1053.581859	D	K	183	192
PSM	RILMEHIH	2519	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35	ms_run[1]:scan=5189	17.263680217066668	3	1063.559592	1063.559684	K	K	136	144
PSM	KKLEEVVNK	2520	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4056	15.424513481333333	3	1085.644781	1085.644459	E	K	156	165
PSM	KKFDEALKL	2521	sp|P08237|PFKAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8520	22.141929177333335	3	1090.639080	1090.638646	E	R	365	374
PSM	RKEIMLGLK	2522	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:35	ms_run[1]:scan=6826	19.695070352000002	3	1102.651430	1102.653250	R	R	521	530
PSM	KKLEEIPKY	2523	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6720	19.515563388266667	3	1146.664917	1146.664861	D	K	294	303
PSM	KKLEDGPKFL	2524	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=12154	32.52268109733333	2	1173.676731	1173.675760	G	K	385	395
PSM	RKPMTTKDLL	2525	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:35	ms_run[1]:scan=5825	18.1680158584	3	1217.679954	1217.680193	T	K	465	475
PSM	RKPASLMAPLK	2526	sp|Q8NE01|CNNM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:35	ms_run[1]:scan=5497	17.69528563093333	3	1226.717138	1226.716913	K	R	463	474
PSM	KRALSTPVVEK	2527	sp|P29084|T2EB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5016	17.023323374933334	2	1226.735884	1226.734672	K	R	14	25
PSM	RKQEIVAEKE	2528	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3782	14.986858002133333	3	1228.678315	1228.677551	P	K	204	214
PSM	KKLVEDQEKL	2529	sp|Q9UHQ4|BAP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5410	17.5660760576	3	1228.703645	1228.702703	N	K	178	188
PSM	KKQVYVDKVE	2530	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4573	16.4033672328	3	1234.692701	1234.692138	K	K	595	605
PSM	KKIDKYTEVL	2531	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7592	20.820296291200002	3	1235.712550	1235.712539	E	K	187	197
PSM	KRANEFLEVGK	2532	sp|Q14152|EIF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7250	20.360407632799998	3	1289.707102	1289.709185	L	K	13	24
PSM	RKQQTTVPQKP	2533	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3758	14.960924484266666	3	1309.747100	1309.746633	S	R	101	112
PSM	KIIVACIETLR	2534	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4	ms_run[1]:scan=8724	22.446585876266667	3	1314.776440	1314.769343	P	K	139	150
PSM	RKMVDQLFCK	2535	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7189	20.284062579733334	3	1339.671283	1339.674063	L	K	467	477
PSM	RNYLLSLPHKN	2536	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8680	22.389169276799997	3	1353.752830	1353.751719	A	K	261	272
PSM	KRIEPADAHVLQ	2537	sp|Q9GZZ1|NAA50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6217	18.743864139733333	3	1375.758966	1375.757198	Y	K	140	152
PSM	KKQQEEEAERL	2538	sp|Q9UM54|MYO6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4493	16.2693494464	3	1386.713846	1386.710307	K	R	916	927
PSM	RKSNEMITNLGK	2539	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6296	18.859892572533333	3	1389.742383	1389.739833	K	K	610	622
PSM	RRPNDPVPIPDK	2540	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6264	18.81405760133333	3	1402.769879	1402.768097	R	R	187	199
PSM	KHIVELAVQKEL	2541	sp|O60518|RNBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7211	20.314512272800002	3	1408.851806	1405.829300	L	K	547	559
PSM	RKIPLVPENLLK	2542	sp|Q6DKI1|RL7L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9916	24.263338086933334	3	1418.897680	1418.897320	Q	K	16	28
PSM	RKTSTLQTVRIE	2543	sp|Q8N5I9|CL045_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6614	19.355091312000003	3	1432.826244	1430.820526	S	R	53	65
PSM	KKLKPEYDIMC	2544	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=6285	18.841853138933335	3	1439.716230	1439.715259	D	K	177	188
PSM	RHQLVVSSPPRPV	2545	sp|Q9Y6A1|POMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7037	20.05209101013333	3	1471.845336	1470.841931	R	R	383	396
PSM	KSKKPAGGVDFDET	2546	sp|Q9BUH6|PAXX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5672	17.940565304266666	3	1477.747782	1477.741273	F	-	191	205
PSM	KKPIEDVLLSSVR	2547	sp|Q9H2J4|PDCL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9919	24.2718900856	3	1482.877907	1482.876979	P	R	213	226
PSM	KKLEDDRNSLQAA	2548	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4988	16.994302851733334	3	1486.770533	1486.773970	V	K	1493	1506
PSM	RMHLGLVIPKEGC	2549	sp|Q12797|ASPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=8561	22.214255984799998	3	1524.795051	1524.790489	L	K	688	701
PSM	RKTPVIVTLKENE	2550	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7479	20.674018097066668	3	1525.883692	1525.882792	R	R	66	79
PSM	KRIAEMTDIKPIL	2551	sp|Q5JRX3|PREP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9860	24.15063675813333	3	1526.884504	1526.885435	M	R	750	763
PSM	RREVEVKLTPLIL	2552	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10540	25.9942955048	3	1564.966029	1564.966462	A	K	110	123
PSM	RRGDIIGVQGNPGKT	2553	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5934	18.345925154133333	3	1566.861432	1566.859037	L	K	177	192
PSM	KKKDIPVLVATDVAA	2554	sp|Q86XP3|DDX42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9075	22.963311574933336	3	1566.934477	1566.934494	F	R	545	560
PSM	RKLSYAEVCQKPP	2555	sp|Q71RC2|LARP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=6709	19.489986350666666	3	1574.822972	1574.823898	P	K	615	628
PSM	RKGVAINFVKNDDI	2556	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9011	22.867661897866665	3	1587.875661	1587.873290	G	R	373	387
PSM	RRVELSGPKAAEPVS	2557	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6065	18.5451196392	3	1594.880279	1594.879104	L	R	91	106
PSM	RKEPSKTEQLSCM	2558	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=3783	14.987553486666666	3	1608.760229	1608.759977	S	R	770	783
PSM	KKLLPGKGTTGTQLNG	2559	sp|Q9BX40|LS14B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5734	18.03382312933333	3	1611.929670	1611.930805	A	R	172	188
PSM	KRMGPGAASGGERPNL	2560	sp|Q9H0U4|RAB1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=5082	17.108070802666667	3	1612.810629	1612.810373	K	K	171	187
PSM	RRIVEQDTMPPKGV	2561	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6529	19.217196397866665	3	1624.871845	1624.871910	I	R	362	376
PSM	KKKELEEIVQPIIS	2562	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9712	23.857367913866664	3	1652.971310	1652.971273	A	K	619	633
PSM	RRTDIFGVEETAIGK	2563	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9806	24.047237475466666	4	1690.899249	1690.900233	E	K	472	487
PSM	KKEKEEADLLLEQQ	2564	sp|O60333|KIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8295	21.8312187592	3	1699.923390	1699.899230	Y	R	690	704
PSM	RKAFLDNGPKTINQI	2565	sp|P78344|IF4G2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8835	22.60433867413333	3	1713.951020	1713.952603	P	R	312	327
PSM	KKKEQMIDLQNLLTTQSPSV	2566	sp|Q9BVJ6|UT14A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10835	27.269451486666664	4	2300.241969	2300.240983	K	K	553	573
PSM	KRMTGSEFDFEEMK	2567	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9302	23.242121992266668	3	1733.774601	1733.775292	Y	R	422	436
PSM	KKCSVIRDSLYVDGDCTMDI	2568	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,16-UNIMOD:4,18-UNIMOD:35	ms_run[1]:scan=9268	23.203788854933336	4	2390.090686	2390.091618	A	R	69	89
PSM	RRIEEMEDELQKTE	2569	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35	ms_run[1]:scan=5740	18.0408250552	3	1820.854830	1820.857442	K	R	1571	1585
PSM	RRLLELGPKPEVAQQT	2570	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8494	22.109510845866666	3	1834.042055	1834.042481	A	R	1126	1142
PSM	KLGIHEDSTNR	2571	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4426	16.166704272	2	1269.633637	1268.647313	L	R	438	449
PSM	KKNEEVPGYTK	2572	sp|Q8IZH2|XRN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4165	15.671209421066667	2	1291.678492	1291.677216	N	K	961	972
PSM	KKSTTIRFTCSESQVNS	2573	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4	ms_run[1]:scan=6483	19.126617949333333	3	1971.967247	1971.968390	R	R	1467	1484
PSM	KKGRPMVISSGMQSMDTM	2574	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35,12-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=5354	17.481289091199997	3	2030.922936	2030.925739	A	K	148	166
PSM	RKKDASDDLDDLNFFNQ	2575	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10752	26.8673459584	3	2039.953960	2039.954848	T	K	62	79
PSM	KKFVIKPID	2576	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7565	20.78655068373333	2	1086.680269	1086.680117	D	K	253	262
PSM	KKHDIMIQENGNGLECFE	2577	sp|Q06203|PUR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=9182	23.089718812266664	3	2176.987357	2176.988139	E	K	481	499
PSM	RRDETMQPAKPSFLEYFEQ	2578	sp|Q13043|STK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35	ms_run[1]:scan=10877	27.469596057333334	4	2387.119256	2387.121596	K	K	383	402
PSM	RKDYTSGAMLTGELK	2579	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:35	ms_run[1]:scan=7507	20.710171974133335	2	1684.849526	1684.845421	I	K	417	432
PSM	KRNQELLQSQLTEKDSMIENM	2580	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	17-UNIMOD:35,21-UNIMOD:35	ms_run[1]:scan=8418	21.99967184346667	4	2566.238181	2566.236703	L	K	743	764
PSM	KKVKAEDEALLSEEDDPID	2581	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8954	22.783802128266665	3	2143.055287	2143.053225	P	R	1767	1786
PSM	KADKLAEEHSS	2582	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3522	14.722	3	1213.5939	1213.5939	A	-	519	530
PSM	KAHIHMLLEGL	2583	sp|Q9UBK9|UXT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=9487	23.504	3	1276.6962	1276.6962	I	R	132	143
PSM	KAIRDEAIYHF	2584	sp|Q9Y375|CIA30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8869	22.659	3	1361.7092	1361.7092	D	R	84	95
PSM	KARVLLLSHLA	2585	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9311	23.254	3	1219.7765	1219.7765	L	R	300	311
PSM	KDGKAHFLQL	2586	sp|Q8IUF8-2|RIOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9038	22.91	2	1155.64	1155.6400	N	R	115	125
PSM	KDLYCHKSD	2587	sp|P16220-3|CREB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4	ms_run[2]:scan=3635	14.84	3	1164.5234	1164.5234	L	-	222	231
PSM	KEAHKPPVFIE	2588	sp|Q8WX93-7|PALLD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7486	20.682	3	1293.7081	1293.7081	A	K	230	241
PSM	KEFYHEVH	2589	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4895	16.841	3	1087.5087	1087.5087	P	R	2302	2310
PSM	KEHQHEEIQNV	2590	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4547	16.366	3	1389.6637	1389.6637	V	R	239	250
PSM	KEKLEGDHTI	2591	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4862	16.802	3	1168.6088	1168.6088	E	R	1074	1084
PSM	KERSGVSLAAL	2592	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8983	22.828	3	1129.6455	1129.6455	S	K	52	63
PSM	KFNEKDGHVE	2593	sp|Q9BW91-2|NUDT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3882	15.1	3	1201.5728	1201.5728	P	R	73	83
PSM	KGIPHLVTHDA	2594	sp|P22090|RS4Y1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6427	19.057	3	1186.6459	1186.6459	V	R	134	145
PSM	KHATLWDAVGH	2595	sp|O00423|EMAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8818	22.577	3	1233.6255	1233.6255	D	R	565	576
PSM	KHEGFYSENLTESR	2596	sp|Q96AP4|ZUP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7422	20.6	3	1695.7853	1695.7853	L	K	114	128
PSM	KHETWSGHVISS	2597	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6459	19.098	3	1366.663	1366.6630	T	-	136	148
PSM	KHHYMDGQTPCLFVSS	2598	sp|Q8IXI1|MIRO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=8647	22.342	3	1921.8451	1921.8451	Y	K	509	525
PSM	KHIAVFPCKI	2599	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=8630	22.308	3	1211.6849	1211.6849	F	K	1085	1095
PSM	KHIKENDYYTPTGEF	2600	sp|P46977-2|STT3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8521	22.145	3	1840.8632	1840.8632	G	R	518	533
PSM	KHLVFNPSH	2601	sp|Q7Z3K3-5|POGZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5811	18.15	3	1077.572	1077.5720	A	R	737	746
PSM	KHQQLSDLH	2602	sp|P78332-2|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4353	16.059	3	1104.5676	1104.5676	I	K	450	459
PSM	KHSFTEDHYVEFS	2603	sp|Q9Y4B6-3|DCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8596	22.262	3	1624.7158	1624.7158	M	K	724	737
PSM	KIDEHHFVAVAL	2604	sp|Q9NRN7|ADPPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9776	23.99	3	1377.7405	1377.7405	S	R	234	246
PSM	KIDVHLHDALG	2605	sp|Q9BW92-2|SYTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8353	21.918	3	1216.6564	1216.6564	P	R	409	420
PSM	KIKDNAADWHNLIL	2606	sp|Q9BW66-2|CINP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10574	26.122	3	1649.8889	1649.8889	R	K	22	36
PSM	KIRELENSLHEA	2607	sp|Q02224-3|CENPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7353	20.508	3	1437.7576	1437.7576	E	K	2261	2273
PSM	KIRSQAIHQL	2608	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5624	17.884	3	1192.704	1192.7040	Y	K	78	88
PSM	KKAVTTNQWH	2609	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4248	15.888	3	1211.6411	1211.6411	Y	R	371	381
PSM	KKCGYPGHLTFEC	2610	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8097	21.569	3	1595.7225	1595.7225	C	R	16	29
PSM	KKDAENHEAQL	2611	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4000	15.329	3	1281.6313	1281.6313	Q	K	122	133
PSM	KKELNSNHDGADETSE	2612	sp|Q01105-2|SET_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3489	14.691	3	1772.7813	1772.7813	S	K	10	26
PSM	KKEPNLFSHDAVV	2613	sp|Q04864-2|REL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8764	22.5	3	1482.7831	1482.7831	F	R	329	342
PSM	KKEVPIH	2614	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3617	14.825	2	849.50724	849.5072	S	R	496	503
PSM	KKFVEEQHT	2615	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3717	14.923	3	1144.5877	1144.5877	Q	K	109	118
PSM	KKIANFVEH	2616	sp|Q9Y6Y8-2|S23IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5614	17.869	3	1084.6029	1084.6029	R	K	694	703
PSM	KKLMHQAALLGQALQDS	2617	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9441	23.449	3	1851.0037	1851.0037	P	R	29	46
PSM	KKNSSVNEGSTYH	2618	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3535	14.733	3	1449.6848	1449.6848	L	K	451	464
PSM	KKPEHELFLVYG	2619	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9951	24.342	3	1458.7871	1458.7871	C	K	520	532
PSM	KKPFSQHV	2620	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4232	15.865	2	969.5396	969.5396	G	R	130	138
PSM	KKYNPTWHCIVG	2621	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4	ms_run[2]:scan=8454	22.05	3	1501.75	1501.7500	D	R	48	60
PSM	KLDPHQKDDIN	2622	sp|Q99543-2|DNJC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3950	15.216	3	1321.6626	1321.6626	Q	K	455	466
PSM	KLGIHEDSTNR	2623	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4393	16.119	2	1268.6473	1268.6473	L	R	438	449
PSM	KLGIRGSNTCEVHFENT	2624	sp|Q9H845|ACAD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:4	ms_run[2]:scan=7990	21.398	3	1960.9425	1960.9425	D	K	262	279
PSM	KLHDALDAKS	2625	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4419	16.156	3	1096.5877	1096.5877	Q	K	170	180
PSM	KLHDMLGPHML	2626	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7089	20.138	3	1322.6475	1322.6475	K	R	945	956
PSM	KLHSSSHPTSIV	2627	sp|Q8TEY7-3|UBP33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5246	17.337	2	1291.6884	1291.6884	A	K	517	529
PSM	KLIGVHCTHGLN	2628	sp|O75319-2|DUS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=6166	18.682	3	1347.7081	1347.7081	D	R	193	205
PSM	KLKEAIAEHA	2629	sp|Q4J6C6-4|PPCEL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5009	17.014	3	1108.6241	1108.6241	E	K	570	580
PSM	KLKNCSPHMNVYL	2630	sp|Q9Y6X5|ENPP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6759	19.579	3	1618.796	1618.7960	N	K	283	296
PSM	KLKTHLPTFSQED	2631	sp|P22413|ENPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8219	21.732	3	1542.8042	1542.8042	L	-	913	926
PSM	KLNDHLNNMAHY	2632	sp|Q96HY7|DHTK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=5945	18.36	3	1484.683	1484.6830	A	R	487	499
PSM	KLSLQDGHKA	2633	sp|Q9Y483-4|MTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4569	16.396	3	1095.6037	1095.6037	T	K	30	40
PSM	KPHTVPCKVTG	2634	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=3802	15.007	3	1222.6492	1222.6492	G	R	176	187
PSM	KPWWWHL	2635	sp|P35520|CBS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11077	28.375	2	1051.5392	1051.5392	K	R	406	413
PSM	KQHSLLK	2636	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3968	15.256	2	852.51814	852.5181	R	R	52	59
PSM	KQIALHAELDR	2637	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6865	19.78	3	1292.7201	1292.7201	A	R	623	634
PSM	KQKIHSITGLPPAMQ	2638	sp|O14562|UBFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	14-UNIMOD:35	ms_run[2]:scan=6711	19.494	3	1663.908	1663.9080	L	K	111	126
PSM	KRGAPPSSNIEDFHGLLP	2639	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10397	25.508	3	1934.001	1934.0010	K	K	269	287
PSM	KRGFGFVTFDDHDPVD	2640	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10908	27.619	3	1850.8588	1850.8588	K	K	152	168
PSM	KRGQTCVVHYTGMLEDG	2641	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:4	ms_run[2]:scan=8542	22.19	3	1949.9088	1949.9088	P	K	18	35
PSM	KSIKWTQH	2642	sp|Q9Y697-2|NFS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4910	16.857	2	1026.5611	1026.5611	L	-	390	398
PSM	KSKPMFFCH	2643	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6252	18.797	3	1196.5471	1196.5471	E	R	177	186
PSM	KSSTSPKWAHD	2644	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4384	16.106	3	1242.5993	1242.5993	R	K	915	926
PSM	KTHNEHLAGVL	2645	sp|P29084|T2EB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6836	19.714	3	1217.6517	1217.6517	F	K	271	282
PSM	KTRQEQGAENEELHQLW	2646	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9406	23.394	4	2095.0083	2095.0083	I	R	144	161
PSM	KTSGHVDKFADFMV	2647	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10083	24.626	3	1580.7657	1580.7657	L	K	190	204
PSM	KVAHSDKPGSTSTASF	2648	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4983	16.987	3	1618.7951	1618.7951	R	R	205	221
PSM	KVRCILTGHELPC	2649	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8375	21.947	3	1581.812	1581.8120	R	R	26	39
PSM	RAEIIHHLADLLTDQ	2650	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10927	27.699	3	1743.9268	1743.9268	Q	R	383	398
PSM	RAEQPHQHAMYYL	2651	sp|P14735|IDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:35	ms_run[2]:scan=7363	20.522	3	1658.7624	1658.7624	F	R	674	687
PSM	RCHLSPEKNAEDMEV	2652	sp|Q8WVV5-3|BT2A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=5384	17.527	3	1829.8036	1829.8036	L	R	54	69
PSM	RDGYGSPHHTPPYGP	2653	sp|Q8TAP9|MPLKI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6048	18.509	3	1636.7383	1636.7383	P	R	42	57
PSM	REDMKGIPFH	2654	sp|Q5T6V5|QSPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=6297	18.861	3	1244.5972	1244.5972	H	R	325	335
PSM	REHPTVVPSH	2655	sp|Q96S66-4|CLCC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3986	15.298	3	1157.5942	1157.5942	A	K	268	278
PSM	RGTHQLYSTSHD	2656	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4169	15.687	3	1400.6433	1400.6433	R	R	251	263
PSM	RHLAVMPHPE	2657	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=4675	16.554	3	1201.6026	1201.6026	G	R	1290	1300
PSM	RHPPDEDFRGPPDEDF	2658	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8918	22.73	3	1924.834	1924.8340	F	R	804	820
PSM	RHTAFVIPK	2659	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7243	20.352	3	1067.624	1067.6240	L	K	50	59
PSM	RHVTYVVAK	2660	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4541	16.359	3	1071.6189	1071.6189	K	K	796	805
PSM	RIHLEIKQLN	2661	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8697	22.411	3	1262.7459	1262.7459	N	R	340	350
PSM	RIKSESTNHEQQSPQSG	2662	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3404	14.56	3	1911.9035	1911.9035	H	K	345	362
PSM	RILMEHIH	2663	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=5196	17.271	3	1063.5597	1063.5597	K	K	136	144
PSM	RILMEHIH	2664	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=6563	19.269	3	1063.5597	1063.5597	K	K	136	144
PSM	RILNFLMHPKPSG	2665	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:35	ms_run[2]:scan=9208	23.124	3	1524.8235	1524.8235	K	K	144	157
PSM	RILPCSHAYHC	2666	sp|O43567-2|RNF13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6081	18.576	3	1412.6442	1412.6442	L	K	135	146
PSM	RINHESQWPSHVSQ	2667	sp|Q8NFD5-4|ARI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6156	18.671	3	1703.8128	1703.8128	Q	R	742	756
PSM	RIRGTSYQSPHGIPIDLLD	2668	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10450	25.662	3	2137.128	2137.1280	T	R	289	308
PSM	RITAHLVHEL	2669	sp|P42765|THIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8109	21.586	3	1187.6775	1187.6775	S	R	360	370
PSM	RKEGIIHTLIVDN	2670	sp|Q9NVQ4|FAIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9228	23.146	3	1506.8518	1506.8518	K	R	159	172
PSM	RKFFVGGNW	2671	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10207	24.948	2	1109.577	1109.5770	S	K	5	14
PSM	RKIDQHTLLQSIVN	2672	sp|Q8NDV7-2|TNR6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10078	24.618	3	1663.937	1663.9370	R	R	443	457
PSM	RKLVAIVDPHI	2673	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9131	23.03	3	1259.7714	1259.7714	R	K	461	472
PSM	RKVTNLFCFEH	2674	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=9679	23.809	3	1449.7187	1449.7187	K	R	9	20
PSM	RLPPHGYPLEHPFN	2675	sp|Q9UBL3-2|ASH2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8905	22.712	3	1672.8474	1672.8474	Q	K	230	244
PSM	RMLESYLHAK	2676	sp|Q86X55-2|CARM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:35	ms_run[2]:scan=7180	20.27	3	1262.6441	1262.6441	E	K	267	277
PSM	RPGSEQPGRPGSHGYV	2677	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5116	17.157	3	1679.8128	1679.8128	L	R	1755	1771
PSM	RPRPAPPDWSHM	2678	sp|Q9BW71-2|HIRP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	12-UNIMOD:35	ms_run[2]:scan=6481	19.125	3	1461.6936	1461.6936	E	R	221	233
PSM	RRAFGSGY	2679	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5798	18.137	2	912.4566	912.4566	G	R	239	247
PSM	RRATVVVGDLHPL	2680	sp|Q9NSI2-2|F207A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9043	22.923	3	1431.831	1431.8310	R	R	120	133
PSM	RRNEIWLL	2681	sp|Q9NRV9|HEBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10746	26.84	2	1098.6298	1098.6298	G	K	180	188
PSM	RRPLILQLVHVSQED	2682	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10623	26.311	3	1802.0163	1802.0163	T	K	60	75
PSM	RSCLIHTSEK	2683	sp|Q13433-2|S39A6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4	ms_run[2]:scan=4327	16.021	3	1229.6187	1229.6187	A	K	26	36
PSM	RSGETVKHEISY	2684	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5545	17.767	3	1404.6997	1404.6997	G	R	338	350
PSM	RSLTDQHCVH	2685	sp|Q8ND04-3|SMG8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=3818	15.025	3	1251.5779	1251.5779	E	K	569	579
PSM	RSTPSHGSVSSLNSTGSLSPKHSL	2686	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7224	20.328	4	2422.2201	2422.2201	L	K	237	261
PSM	RTGDKATVHF	2687	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5806	18.143	3	1130.5833	1130.5833	L	R	533	543
PSM	RTKSLIAQDH	2688	sp|O15013-7|ARHGA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4316	16.007	3	1167.636	1167.6360	I	R	313	323
PSM	RVGKVEHGSVALPAIM	2689	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	16-UNIMOD:35	ms_run[2]:scan=8357	21.922	3	1678.9189	1678.9189	N	R	438	454
PSM	RVIKAMNNSWHPECF	2690	sp|P0CW19-2|LIMS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=8719	22.439	3	1903.8822	1903.8822	G	R	143	158
PSM	RVVDLMAHMASKE	2691	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5097	17.133	3	1517.733	1517.7330	N	-	281	294
PSM	RYEIKDIHVPP	2692	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8848	22.624	3	1365.7405	1365.7405	L	R	174	185
PSM	RYELLEHK	2693	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6476	19.117	3	1086.5822	1086.5822	K	K	525	533
PSM	RYKNILPFDHT	2694	sp|Q06124-3|PTN11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9338	23.295	3	1402.7357	1402.7357	N	R	278	289
PSM	KELQTLHNLR	2695	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6110	18.611971466933333	3	1250.711491	1250.709519	A	K	791	801
PSM	RMVVNEGSDGGQSVYHVHLHVLGG	2696	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	2-UNIMOD:35	ms_run[1]:scan=9463	23.474137060266667	4	2562.2350	2562.2392	Y	R	95	119
PSM	KYLHPPPHL	2697	sp|Q9NR56|MBNL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7042	20.05893671333333	3	1100.614036	1100.613100	C	K	67	76
PSM	RHLLPCVIHAAVL	2698	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:4	ms_run[1]:scan=10159	24.824396862933334	3	1497.859821	1497.860223	A	K	778	791
PSM	RVMDQHKLT	2699	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=3596	14.805388061333334	3	1142.587189	1142.586627	Q	R	156	165
PSM	RQLHDDYFYHDEL	2700	sp|Q14257|RCN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9571	23.631988178666667	3	1749.773395	1749.774698	G	-	305	318
PSM	RHLDHVAALFPGDVD	2701	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9891	24.209048876533334	3	1660.833630	1660.832154	Q	R	410	425
PSM	KMLTFNPHK	2702	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:35	ms_run[1]:scan=5383	17.524634694666666	3	1130.590916	1130.590650	D	R	292	301
PSM	RHDQHITAVLT	2703	sp|Q9BWH6|RPAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6691	19.466288604266666	3	1290.683129	1289.684033	R	K	97	108
PSM	RSRGFGFITFTNPEHASVAM	2704	sp|P98179|RBM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	20-UNIMOD:35	ms_run[1]:scan=10414	25.560219103199998	4	2240.078269	2240.079672	Q	R	45	65
PSM	KGKEGSALSHV	2705	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4542	16.360281975733333	3	1111.598867	1111.598572	C	R	152	163
PSM	RHSIQHVPGDIEQTSQE	2706	sp|Q8TEU7|RPGF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6421	19.047381101066666	3	1959.935181	1959.939866	N	K	642	659
PSM	KDGFLHETLLDR	2707	sp|Q14331|FRG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9575	23.638602630666664	3	1442.752884	1442.751778	R	R	236	248
PSM	KKLHDFQDEIVENSVT	2708	sp|Q5VTR2|BRE1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9230	23.1488185688	3	1903.926942	1900.953057	Q	K	856	872
PSM	KIAQLQDGRTLAG	2709	sp|Q14DG7|T132B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7655	20.916783128000002	3	1370.753124	1369.767763	P	R	612	625
PSM	KRTGQPMIHIYLD	2710	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:35	ms_run[1]:scan=9011	22.867661897866665	3	1586.822064	1586.823898	N	K	391	404
PSM	RPFLLLMATPLE	2711	sp|P01137|TGFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=8426	22.014984434133332	3	1399.7937	1399.7892	N	R	255	267
PSM	RMKLMADNYEDDHF	2712	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=7708	20.9938222152	3	1815.755086	1815.755620	N	K	979	993
PSM	KYAAELHLVHWNP	2713	sp|P07451|CAH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=9889	24.2064844792	3	1578.8582	1576.8142	V	K	113	126
PSM	RDLQAHINH	2714	sp|Q75N03|HAKAI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4055	15.422225662933332	3	1102.563996	1102.563189	Q	R	180	189
PSM	KVKMTTHL	2715	sp|P63165|SUMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=3733	14.936428944266668	2	972.543000	972.542637	F	K	37	45
PSM	KTYHALSNLPKA	2716	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7189	20.284062579733334	3	1341.744194	1341.740485	S	R	175	187
PSM	RHTLADNFNPVSEERG	2717	sp|P20645|MPRD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8521	22.14490633333333	3	1840.865976	1840.881623	N	K	147	163
PSM	KKAMENIGELK	2718	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=4905	16.852354061066666	3	1275.685795	1275.685673	R	K	176	187
PSM	KMLQEICTLK	2719	sp|H3BV12|GOG8Q_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=6216	18.742762181866667	3	1278.686749	1278.667580	S	K	258	268
PSM	KKLEIKL	2720	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7953	21.344078498133335	2	870.590393	870.590239	M	R	905	912
PSM	KRADTLAFEMK	2721	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:35	ms_run[1]:scan=6191	18.7079832776	3	1324.681249	1324.680922	S	R	390	401
PSM	KKLEEIK	2722	sp|Q5SZL2|CE85L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3835	15.043036493333334	2	886.549735	886.548768	E	K	550	557
PSM	KKLEEIK	2723	sp|Q5SZL2|CE85L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3824	15.031436606933333	2	886.549735	886.548768	E	K	550	557
PSM	KKLEAAEER	2724	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3562	14.773169579733333	3	1072.587722	1072.587673	Q	R	52	61
PSM	KFQYENRILHWQ	2725	sp|Q9P2N2-2|RHG28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8322	21.8736872928	3	1661.839599	1660.847410	A	R	619	631
PSM	KLKEAIAEHA	2726	sp|Q4J6C6|PPCEL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4995	16.999700914666665	3	1108.625520	1108.624058	E	K	659	669
PSM	KKLIELQAGK	2727	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6116	18.626652381866666	3	1126.707749	1126.707394	Q	K	157	167
PSM	KRLDLDAAKT	2728	sp|Q9Y371|SHLB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5383	17.524634694666666	3	1129.645388	1129.645522	N	R	168	178
PSM	KKIESFGSKSG	2729	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4036	15.378942573066666	3	1166.630009	1166.629538	V	R	182	193
PSM	KKLEDGPKFL	2730	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11684	30.834327991733335	2	1173.675643	1173.675760	G	K	385	395
PSM	KKLEDGPKFL	2731	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11891	31.550023248266665	2	1173.676202	1173.675760	G	K	385	395
PSM	KRVQLAEDLK	2732	sp|O60313|OPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6090	18.586061308	3	1198.705506	1198.703371	G	K	931	941
PSM	KFHNELNAHI	2733	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7523	20.731538576	3	1221.626138	1221.625455	E	K	274	284
PSM	KKQYLEVKAQ	2734	sp|O75179|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5015	17.022312937066665	3	1233.709079	1233.708122	L	R	885	895
PSM	RQLSHLQQHT	2735	sp|Q5T0B9|ZN362_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3908	15.144583879466667	3	1246.652660	1246.653067	F	R	293	303
PSM	RKLSQMILDK	2736	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:35	ms_run[1]:scan=5978	18.407495599733334	3	1246.706365	1246.706743	E	K	363	373
PSM	KKVPWFDQQNGRTYL	2737	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=10347	25.3452059664	3	1878.991207	1878.974067	A	K	75	90
PSM	KKEEAYELVR	2738	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6326	18.901988337066665	3	1263.683338	1263.682302	G	R	61	71
PSM	RRAEVLALPFK	2739	sp|Q9NV88|INT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9663	23.781443356266667	3	1298.782900	1298.782290	Y	R	500	511
PSM	RSMEAHNILSK	2740	sp|Q9NP77|SSU72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=4750	16.655188708266667	3	1302.643311	1300.655770	N	R	18	29
PSM	KKLSDILNEKAG	2741	sp|Q9NVI1|FANCI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8294	21.829783587466668	3	1314.751152	1314.750716	Y	K	779	791
PSM	KRMTGSEFDFEEMK	2742	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=7540	20.751569647733334	4	1765.764901	1765.765122	Y	R	422	436
PSM	REHSAFQAPAVK	2743	sp|Q15629|TRAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5935	18.346933419466666	3	1340.722972	1339.699683	W	K	324	336
PSM	RKMVDQLFCK	2744	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7145	20.214504468533335	3	1339.671283	1339.674063	L	K	467	477
PSM	KEHALAQAELLK	2745	sp|O15126|SCAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7516	20.72309683066667	3	1351.773855	1349.766700	A	R	78	90
PSM	RKNMQLTAGSKL	2746	sp|O75934|SPF27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=5109	17.147837577866667	3	1361.739271	1361.744919	Q	R	167	179
PSM	RVKLLLQVQHAS	2747	sp|P12235|ADT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8845	22.620095241066668	3	1391.824856	1390.840868	E	K	31	43
PSM	KKNSDEVKSSFE	2748	sp|O00566|MPP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4607	16.456796095999998	3	1396.684076	1396.683424	V	K	350	362
PSM	RKEMEQLVLDK	2749	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=5865	18.222005157599998	3	1403.744403	1403.744250	L	K	291	302
PSM	RKLYPTVGKPSSS	2750	sp|Q9UDX5|MTFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5628	17.887940812533333	3	1418.788929	1418.788164	L	-	154	167
PSM	RKIALEDVPEKQ	2751	sp|O43148|MCES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6737	19.541904736	3	1424.801744	1424.798728	K	K	127	139
PSM	KKLKPEYDIMC	2752	sp|Q9NTK5|OLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	11-UNIMOD:4	ms_run[1]:scan=7968	21.365048918933333	3	1426.729762	1423.720344	D	K	177	188
PSM	KLTSIQIEFQQE	2753	sp|Q96N16|JKIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3800	15.004695388	2	1462.788535	1462.766760	A	K	29	41
PSM	RKVEDLFLTFAK	2754	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=10702	26.642068220533336	3	1465.829375	1465.829300	F	K	2087	2099
PSM	KKKEEPSQNDISP	2755	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4328	16.022205013866667	3	1498.763035	1498.762737	A	K	78	91
PSM	RKEDWNEIDPIK	2756	sp|Q10471|GALT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9086	22.976625903466665	3	1541.786720	1541.783807	G	K	41	53
PSM	RFHWEQDQIAHM	2757	sp|Q9UG63|ABCF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:35	ms_run[1]:scan=8440	22.036069638666667	3	1612.722447	1612.720495	K	K	327	339
PSM	RSQHDILQMICSK	2758	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=8335	21.8954288664	3	1630.792041	1630.791946	S	R	633	646
PSM	RKNSTQPEKESNLD	2759	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3632	14.8375545904	3	1644.813659	1644.806727	K	R	1419	1433
PSM	KKLGEMWSEQSAKD	2760	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:35	ms_run[1]:scan=6684	19.456465752	3	1651.784578	1651.787572	A	K	127	141
PSM	KTVETRDGQVINETSQHHDDLE	2761	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6415	19.03828735786667	3	2550.194131	2550.194637	I	-	445	467
PSM	RKASGSENEGDYNPGR	2762	sp|Q02880|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3741	14.944451709600001	3	1735.788091	1735.787388	K	K	1547	1563
PSM	RSRPLATGPSSQSHQE	2763	sp|Q96RL1|UIMC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3741	14.944451709600001	3	1736.857269	1736.855408	T	K	130	146
PSM	KKIRELGSLPQEAFE	2764	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9346	23.304475732799997	3	1743.952503	1743.951935	M	K	941	956
PSM	KKEKEEEELFPESE	2765	sp|Q9UHX1|PUF60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8075	21.535612638933333	3	1749.831829	1749.830876	P	R	416	430
PSM	KQDEEINQIEEERT	2766	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8967	22.8017979936	3	1761.836830	1759.822437	K	K	206	220
PSM	KKKAGPGSLELCGLPSQ	2767	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:4	ms_run[1]:scan=8777	22.517753794666664	3	1768.951173	1768.950555	Q	K	572	589
PSM	RKSWPEPDQKPEPVD	2768	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6860	19.7714573824	3	1806.894917	1806.890063	L	K	91	106
PSM	KKCVSELEEEKQQLV	2769	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=7920	21.2918390936	3	1845.944958	1845.950614	L	K	1962	1977
PSM	RKPENTTRAEALTEPLNA	2770	sp|Q9NX76|CKLF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7781	21.095319513333333	3	2010.049452	2010.049417	L	-	166	184
PSM	RRYPSSISSSPQKDLTQA	2771	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7320	20.46130900533333	3	2020.032223	2020.033767	T	K	600	618
PSM	KRATVLESEGTRESAINVAEG	2772	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7971	21.369643001066667	3	2216.138634	2216.139689	R	K	200	221
PSM	KKLLDRFDYDDEPEAVEES	2773	sp|O95104|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9642	23.7468395128	3	2297.067385	2297.069937	D	K	259	278
PSM	KKYEDICPSTHNMDVPNIK	2774	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=7494	20.694059605066666	4	2305.071467	2304.087853	G	R	67	86
PSM	RKTEELEEESFPERS	2775	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7277	20.3923428672	4	1864.879695	1864.880286	Q	K	485	500
PSM	RKLMGIKSEDEAGCSSVDEESY	2776	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=7131	20.19305883173333	4	2505.097340	2505.099934	F	K	369	391